F407956

General Info

Members Datasets Scaffolds Average Seq Length
325 192 319 234

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0085813|Ga0466966_0085813_352_1104
Length 250
Sequence VRGPYRAPDQRGVTPQGRGRFPGFDVLDEVHRWDDVTAGVVLARLAPTTDLSFFTLAENGCATALADLLLAQDAEPRVPVVAMIDARLAADETDGWHYDDMPPDPEAWRRTLAALDEDAEELAGRPFARLEREQQAALVQRVQDLGSDGKPWHELPAKHVWSLWTRYACAAFYSHPWAWNEMGFPGPAYPRGYKNTGVDAREGFEVPDSGGTDAGHPDPVPFADRVEKVRTEHARLVGEQLGDGEPGDEQ

Samples

Sample ID Description Type Environment
1 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
2 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
3 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
4 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
5 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
6 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
70 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.15
Metatranscriptomes 8
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0.62
Rhizoplane 11.69
Rhizosphere 84.31
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10273004 3300003323 Bacteria 1679
2 Ga0070658_10000321 3300005327 Bacteria 41064
3 Ga0070658_10332330 3300005327 Bacteria 1299
4 Ga0070683_100330140 3300005329 Bacteria 1452
5 Ga0070666_10010762 3300005335 Bacteria 5724
6 Ga0070666_10368720 3300005335 Bacteria 1029
7 Ga0070682_100001487 3300005337 Bacteria 13140
8 Ga0068868_100186317 3300005338 Bacteria 1724
9 Ga0070692_10255506 3300005345 Bacteria 1051
10 Ga0070668_100132694 3300005347 Bacteria 2000
11 Ga0070671_100067905 3300005355 Bacteria 2973
12 Ga0070671_100104338 3300005355 Bacteria 2379
13 Ga0070667_100119657 3300005367 Bacteria 2290
14 Ga0070667_100342735 3300005367 Bacteria 1352
15 Ga0070714_100000014 3300005435 Bacteria 210194
16 Ga0070714_100156207 3300005435 Bacteria 2059
17 Ga0070714_100258686 3300005435 Bacteria 1611
18 Ga0070713_100304320 3300005436 Bacteria 1468
19 Ga0070710_10048135 3300005437 Bacteria 2380
20 Ga0070710_10266266 3300005437 Bacteria 1107
21 Ga0070710_10295531 3300005437 Bacteria 1055
22 Ga0070663_100032959 3300005455 Bacteria 3575
23 Ga0070678_100145724 3300005456 Bacteria 1901
24 Ga0068867_100068492 3300005459 Bacteria 2648
25 Ga0070706_100791428 3300005467 Bacteria 878
26 Ga0070698_100013008 3300005471 Bacteria 8809
27 Ga0070699_100334600 3300005518 Bacteria 1362
28 Ga0070679_100067235 3300005530 Bacteria 3574
29 Ga0070679_100233710 3300005530 Bacteria 1797
30 Ga0070679_100374265 3300005530 Bacteria 1371
31 Ga0070679_100783225 3300005530 Bacteria 897
32 Ga0070679_100897204 3300005530 Bacteria 830
33 Ga0070684_100695383 3300005535 Bacteria 948
34 Ga0068853_100239968 3300005539 Bacteria 1661
35 Ga0070696_100001701 3300005546 Bacteria 14420
36 Ga0070665_100016290 3300005548 Bacteria 7456
37 Ga0068855_100010827 3300005563 Bacteria 11013
38 Ga0068855_100015844 3300005563 Bacteria 9068
39 Ga0068855_100132762 3300005563 Bacteria 2842
40 Ga0068854_100013004 3300005578 Bacteria 5455
41 Ga0068856_100620712 3300005614 Bacteria 1102
42 Ga0070702_100072090 3300005615 Bacteria 2043
43 Ga0068852_100040241 3300005616 Bacteria 3942
44 Ga0068864_100878607 3300005618 Bacteria 884
45 Ga0068866_10003522 3300005718 Bacteria 6408
46 Ga0068870_10178610 3300005840 Bacteria 1272
47 Ga0068863_100021429 3300005841 Bacteria 6168
48 Ga0068863_100239345 3300005841 Bacteria 1752
49 Ga0068863_100638097 3300005841 Bacteria 1056
50 Ga0068858_100235689 3300005842 Bacteria 1735
51 Ga0068858_100394182 3300005842 Bacteria 1330
52 Ga0068860_100005253 3300005843 Bacteria 13144
53 Ga0070717_10092656 3300006028 Bacteria 2553
54 Ga0070717_10331532 3300006028 Bacteria 1357
55 Ga0070715_10295386 3300006163 Bacteria 865
56 Ga0070716_100030949 3300006173 Bacteria 2908
57 Ga0070712_100044726 3300006175 Bacteria 3054
58 Ga0070712_100066633 3300006175 Bacteria 2560
59 Ga0070712_100208028 3300006175 Bacteria 1541
60 Ga0070712_100331103 3300006175 Bacteria 1241
61 Ga0070712_100446240 3300006175 Bacteria 1076
62 Ga0068871_100526036 3300006358 Bacteria 1068
63 Ga0068865_100035429 3300006881 Bacteria 3356
64 Ga0105240_10026928 3300009093 Bacteria 7538
65 Ga0105240_10040140 3300009093 Bacteria 5990
66 Ga0105240_10542561 3300009093 Bacteria 1288
67 Ga0105245_10002198 3300009098 Bacteria 17676
68 Ga0105241_10005186 3300009174 Bacteria 9614
69 Ga0105241_10107366 3300009174 Bacteria 2230
70 Ga0105248_10276961 3300009177 Bacteria 1889
71 Ga0105237_10268238 3300009545 Bacteria 1710
72 Ga0105238_10057205 3300009551 Bacteria 3911
73 Ga0105238_10070999 3300009551 Bacteria 3480
74 Ga0105238_10128892 3300009551 Bacteria 2508
75 Ga0105249_10608669 3300009553 Bacteria 1148
76 Ga0105239_10348216 3300010375 Bacteria 1672
77 Ga0105246_10125206 3300011119 Bacteria 1911
78 Ga0157370_10004063 3300013104 Bacteria 16964
79 Ga0157370_10239735 3300013104 Bacteria 1678
80 Ga0157370_10264514 3300013104 Bacteria 1589
81 Ga0157369_10014211 3300013105 Bacteria 8993
82 Ga0157369_10036203 3300013105 Bacteria 5409
83 Ga0157369_10077317 3300013105 Bacteria 3567
84 Ga0157369_10622257 3300013105 Bacteria 1114
85 Ga0157374_10124956 3300013296 Bacteria 2486
86 Ga0157374_10244474 3300013296 Bacteria 1765
87 Ga0157378_10235045 3300013297 Bacteria 1748
88 Ga0163162_10510093 3300013306 Bacteria 1333
89 Ga0157372_10000006 3300013307 Bacteria 354669
90 Ga0157372_10613647 3300013307 Bacteria 1268
91 Ga0157380_10037106 3300014326 Bacteria 3775
92 Ga0157379_10325541 3300014968 Bacteria 1404
93 Ga0157376_10493775 3300014969 Bacteria 1202
94 Ga0157376_10802803 3300014969 Bacteria 954
95 Ga0197907_10131703 3300020069 Bacteria 1591
96 Ga0197907_10550438 3300020069 Bacteria 5927
97 Ga0206356_10377962 3300020070 Bacteria 1613
98 Ga0206356_11361686 3300020070 Bacteria 1824
99 Ga0206349_1467147 3300020075 Bacteria 1635
100 Ga0206355_1497021 3300020076 Bacteria 1762
101 Ga0206351_10332717 3300020077 Bacteria 1304
102 Ga0206351_10602002 3300020077 Bacteria 1780
103 Ga0206350_10018262 3300020080 Bacteria 5225
104 Ga0206350_10382195 3300020080 Bacteria 1628
105 Ga0206350_10656528 3300020080 Bacteria 1663
106 Ga0206350_10668316 3300020080 Bacteria 2214
107 Ga0206350_11338705 3300020080 Bacteria 1299
108 Ga0206353_10412565 3300020082 Bacteria 9730
109 Ga0206353_10578181 3300020082 Bacteria 1031
110 Ga0206353_11356432 3300020082 Bacteria 2909
111 Ga0154015_1095088 3300020610 Bacteria 1356
112 Ga0154015_1200931 3300020610 Bacteria 1414
113 Ga0154015_1420689 3300020610 Bacteria 1669
114 Ga0224712_10001708 3300022467 Bacteria 5208
115 Ga0224712_10013729 3300022467 Bacteria 2588
116 Ga0224712_10018506 3300022467 Bacteria 2330
117 Ga0224712_10043910 3300022467 Bacteria 1702
118 Ga0224712_10045466 3300022467 Bacteria 1680
119 Ga0224712_10117150 3300022467 Bacteria 1149
120 Ga0207692_10007687 3300025898 Bacteria 4426
121 Ga0207692_10039417 3300025898 Bacteria 2324
122 Ga0207692_10127291 3300025898 Bacteria 1434
123 Ga0207692_10148458 3300025898 Bacteria 1340
124 Ga0207692_10265196 3300025898 Bacteria 1034
125 Ga0207642_10020288 3300025899 Bacteria 2591
126 Ga0207710_10031860 3300025900 Bacteria 2308
127 Ga0207688_10022810 3300025901 Bacteria 3428
128 Ga0207680_10006628 3300025903 Bacteria 5619
129 Ga0207680_10010310 3300025903 Bacteria 4669
130 Ga0207647_10004421 3300025904 Bacteria 10420
131 Ga0207699_10015749 3300025906 Bacteria 3936
132 Ga0207705_10005023 3300025909 Bacteria 9922
133 Ga0207654_10017964 3300025911 Bacteria 3707
134 Ga0207695_10005844 3300025913 Bacteria 16167
135 Ga0207695_10153632 3300025913 Bacteria 2238
136 Ga0207695_10178532 3300025913 Bacteria 2045
137 Ga0207671_10000421 3300025914 Bacteria 58859
138 Ga0207693_10057726 3300025915 Bacteria 3041
139 Ga0207693_10083077 3300025915 Bacteria 2509
140 Ga0207693_10226646 3300025915 Bacteria 1468
141 Ga0207663_10219474 3300025916 Bacteria 1382
142 Ga0207662_10001273 3300025918 Bacteria 12127
143 Ga0207657_10433764 3300025919 Bacteria 1032
144 Ga0207652_10056706 3300025921 Bacteria 3373
145 Ga0207652_10090169 3300025921 Bacteria 2693
146 Ga0207652_10275735 3300025921 Bacteria 1517
147 Ga0207652_10539561 3300025921 Bacteria 1049
148 Ga0207646_10159443 3300025922 Bacteria 2035
149 Ga0207694_10059440 3300025924 Bacteria 2973
150 Ga0207694_10097951 3300025924 Bacteria 2321
151 Ga0207650_10444960 3300025925 Bacteria 1078
152 Ga0207687_10000303 3300025927 Bacteria 33416
153 Ga0207700_10129304 3300025928 Bacteria 2059
154 Ga0207700_10227756 3300025928 Bacteria 1583
155 Ga0207700_10685567 3300025928 Bacteria 914
156 Ga0207664_10000001 3300025929 Bacteria 724213
157 Ga0207664_10297305 3300025929 Bacteria 1420
158 Ga0207686_10001214 3300025934 Bacteria 14958
159 Ga0207670_10043650 3300025936 Bacteria 2962
160 Ga0207669_10000848 3300025937 Bacteria 13040
161 Ga0207665_10094130 3300025939 Bacteria 2081
162 Ga0207711_10257356 3300025941 Bacteria 1604
163 Ga0207689_10024178 3300025942 Bacteria 5096
164 Ga0207667_10015432 3300025949 Bacteria 8677
165 Ga0207667_10029752 3300025949 Bacteria 5917
166 Ga0207667_10098932 3300025949 Bacteria 3009
167 Ga0207668_10050182 3300025972 Bacteria 2874
168 Ga0207668_10110786 3300025972 Bacteria 2059
169 Ga0207640_10043927 3300025981 Bacteria 2860
170 Ga0207658_10096167 3300025986 Bacteria 2309
171 Ga0207658_10413373 3300025986 Bacteria 1188
172 Ga0207677_10196085 3300026023 Bacteria 1601
173 Ga0207703_10025704 3300026035 Bacteria 4632
174 Ga0207703_10100610 3300026035 Bacteria 2450
175 Ga0207702_10192772 3300026078 Bacteria 1884
176 Ga0207641_10018644 3300026088 Bacteria 5688
177 Ga0207641_10486897 3300026088 Bacteria 1196
178 Ga0207648_10004258 3300026089 Bacteria 14772
179 Ga0207676_10369498 3300026095 Bacteria 1332
180 Ga0207675_100285487 3300026118 Bacteria 1604
181 Ga0207683_10089428 3300026121 Bacteria 2741
182 Ga0207683_10148926 3300026121 Bacteria 2112
183 Ga0207698_10125911 3300026142 Bacteria 2179
184 Ga0268266_10008877 3300028379 Bacteria 8899
185 Ga0268266_10219967 3300028379 Bacteria 1745
186 Ga0268264_10007512 3300028381 Bacteria 9094
187 Ga0265773_1000833 3300031018 Bacteria 1448
188 Ga0373923_0025534 3300035111 Bacteria 2342
189 Ga0373924_0024845 3300035410 Bacteria 2364
190 Ga0373931_0185104 3300035691 Bacteria 1236
191 Ga0373935_0175684 3300035692 Bacteria 1467
192 Ga0373927_0203866 3300035695 Bacteria 1299
193 Ga0373925_0266538 3300037068 Bacteria 1377
194 Ga0395899_0051490 3300037312 Bacteria 3056
195 Ga0395900_0192447 3300037418 Bacteria 2068
196 Ga0395898_0216952 3300037466 Bacteria 1825
197 Ga0436364_1086226 3300037853 Bacteria 5887
198 Ga0395901_0098003 3300038443 Bacteria 3074
199 Ga0395901_0136927 3300038443 Bacteria 2573
200 Ga0395901_0779981 3300038443 Bacteria 946
201 Ga0436365_0066733 3300039437 Bacteria 1969
202 Ga0436363_0675038 3300039450 Bacteria 1071
203 Ga0451789_0097158 3300041443 Bacteria 1123
204 Ga0451793_0173599 3300041452 Bacteria 1662
205 Ga0451793_1814972 3300041452 Bacteria 1393
206 Ga0451841_0658615 3300041498 Bacteria 1620
207 Ga0451853_2641902 3300041512 Bacteria 1535
208 Ga0466969_0017641 3300044656 Bacteria 3724
209 Ga0466966_0057780 3300044684 Bacteria 2453
210 Ga0466966_0085813 3300044684 Bacteria 1957
211 Ga0466966_0149245 3300044684 Bacteria 1426
212 Ga0466966_0198537 3300044684 Bacteria 1214
213 Ga0466966_0245975 3300044684 Bacteria 1078
214 Ga0466961_0005645 3300044693 Bacteria 7911
215 Ga0466961_0020895 3300044693 Bacteria 4212
216 Ga0466961_0047969 3300044693 Bacteria 2730
217 Ga0466961_0130488 3300044693 Bacteria 1575
218 Ga0466961_0179418 3300044693 Bacteria 1315
219 Ga0466963_0064141 3300044694 Bacteria 2460
220 Ga0466963_0152656 3300044694 Bacteria 1604
221 Ga0466963_0289948 3300044694 Bacteria 1150
222 Ga0466963_0304177 3300044694 Bacteria 1122
223 Ga0466964_0171839 3300044706 Bacteria 1021
224 Ga0466971_0058481 3300044719 Bacteria 1740
225 Ga0466968_0221336 3300044735 Bacteria 892
226 Ga0466968_0250012 3300044735 Bacteria 842
227 Ga0466970_0012673 3300044765 Bacteria 4313
228 Ga0466970_0023133 3300044765 Bacteria 3244
229 Ga0466970_0180198 3300044765 Bacteria 1172
230 Ga0466957_0214217 3300044842 Bacteria 1269
231 Ga0466960_0012969 3300044901 Bacteria 3531
232 Ga0466960_0056517 3300044901 Bacteria 1911
233 Ga0466960_0090058 3300044901 Bacteria 1562
234 Ga0466959_0039279 3300045049 Bacteria 3497
235 Ga0466959_0046645 3300045049 Bacteria 3188
236 Ga0466959_0054115 3300045049 Bacteria 2933
237 Ga0466959_0058115 3300045049 Bacteria 2818
238 Ga0466959_0075373 3300045049 Bacteria 2437
239 Ga0466959_0114010 3300045049 Bacteria 1927
240 Ga0466959_0215117 3300045049 Bacteria 1334
241 Ga0466959_0342789 3300045049 Bacteria 1019
242 Ga0466958_0080231 3300045836 Bacteria 2007
243 Ga0466958_0103327 3300045836 Bacteria 1774
244 Ga0466958_0148021 3300045836 Bacteria 1480
245 Ga0466958_0372182 3300045836 Bacteria 921
246 Ga0466958_0488249 3300045836 Bacteria 799
247 Ga0466967_0122457 3300045976 Bacteria 2405
248 Ga0466967_0306072 3300045976 Bacteria 1530
249 Ga0495651_0311972 3300046462 Bacteria 1051
250 Ga0495653_0065801 3300046463 Bacteria 2727
251 Ga0495664_0198036 3300046477 Bacteria 1217
252 Ga0495608_0235550 3300046511 Bacteria 1145
253 Ga0495618_0040911 3300046514 Bacteria 2918
254 Ga0495628_0054070 3300046516 Bacteria 3166
255 Ga0495652_0044788 3300046529 Bacteria 3808
256 Ga0495652_0142017 3300046529 Bacteria 1887
257 Ga0495665_0093638 3300046531 Bacteria 1579
258 Ga0495640_0168065 3300046533 Bacteria 1402
259 Ga0495586_0048628 3300046535 Bacteria 2292
260 Ga0495586_0271134 3300046535 Bacteria 970
261 Ga0495587_0023610 3300046536 Bacteria 3778
262 Ga0495634_0019436 3300046642 Bacteria 4827
263 Ga0495635_0022316 3300046663 Bacteria 4406
264 Ga0495635_0223765 3300046663 Bacteria 1272
265 Ga0495657_0266125 3300046675 Bacteria 1029
266 Ga0495599_0060826 3300046678 Bacteria 2361
267 Ga0495623_0206990 3300046679 Bacteria 1125
268 Ga0495613_0147966 3300046689 Bacteria 1676
269 Ga0495624_0244649 3300046690 Bacteria 1085
270 Ga0495600_0220447 3300046809 Bacteria 1213
271 Ga0495604_0114053 3300047317 Bacteria 1966
272 Ga0495604_0139759 3300047317 Bacteria 1731
273 Ga0495676_0058270 3300047321 Bacteria 3040
274 Ga0495676_0120045 3300047321 Bacteria 1914
275 Ga0495675_0052468 3300047444 Bacteria 2589
276 Ga0495602_0367638 3300048088 Bacteria 1034
277 Ga0496101_0001476 3300048904 Bacteria 14048
278 Ga0496101_0122733 3300048904 Bacteria 1965
279 Ga0496101_0788132 3300048904 Bacteria 750
280 Ga0496102_0002454 3300048905 Bacteria 15827
281 Ga0496102_0101866 3300048905 Bacteria 2669
282 Ga0496103_0139623 3300048906 Bacteria 1549
283 Ga0496104_0010331 3300048907 Bacteria 8336
284 Ga0496104_0280105 3300048907 Bacteria 1580
285 Ga0496104_0797845 3300048907 Bacteria 850
286 Ga0496105_0021614 3300048908 Bacteria 5208
287 Ga0496106_0002261 3300048909 Bacteria 14362
288 Ga0496107_0319541 3300048910 Bacteria 1155
289 Ga0496108_0001789 3300048911 Bacteria 17120
290 Ga0496108_0003012 3300048911 Bacteria 13540
291 Ga0496108_0352861 3300048911 Bacteria 1283
292 Ga0496109_0003825 3300048912 Bacteria 12574
293 Ga0496109_0105046 3300048912 Bacteria 2623
294 Ga0496109_0117754 3300048912 Bacteria 2473
295 Ga0496109_0123156 3300048912 Bacteria 2416
296 Ga0496109_0164881 3300048912 Bacteria 2077
297 Ga0496110_0199112 3300048913 Bacteria 1819
298 Ga0496110_0238770 3300048913 Bacteria 1653
299 Ga0496111_0225933 3300048914 Bacteria 1390
300 Ga0496111_0467685 3300048914 Bacteria 930
301 Ga0496113_0009096 3300048916 Bacteria 6509
302 Ga0496113_0346603 3300048916 Bacteria 1191
303 Ga0496114_0002128 3300048917 Bacteria 15059
304 Ga0496114_0003346 3300048917 Bacteria 12323
305 Ga0496114_0028661 3300048917 Bacteria 4570
306 Ga0496114_0058761 3300048917 Bacteria 3211
307 Ga0496114_0150412 3300048917 Bacteria 2019
308 Ga0496114_0301958 3300048917 Bacteria 1413
309 Ga0496115_0001135 3300048918 Bacteria 19236
310 Ga0496115_0028547 3300048918 Bacteria 4374
311 Ga0496115_0255028 3300048918 Bacteria 1443
312 Ga0496121_0179125 3300048924 Bacteria 1531
313 Ga0496124_0243456 3300048927 Bacteria 1336
314 Ga0495601_0201019 3300053077 Bacteria 1302
315 Ga0495595_0292006 3300053084 Bacteria 819
316 Ga0495619_0190856 3300053085 Bacteria 1418
317 Ga0495619_0351517 3300053085 Bacteria 1020
318 Ga0500620_032604 3300053155 Bacteria 1660
319 Ga0466962_0082356 3300061719 Bacteria 1539

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0203866 Ga0373927_0203866_732_1286 178
2 3300035692 Ga0373935_0175684 Ga0373935_0175684_52_750 187
3 3300037068 Ga0373925_0266538 Ga0373925_0266538_520_1218 187
4 3300005435 Ga0070714_100156207 Ga0070714_1001562072 190
5 3300005437 Ga0070710_10048135 Ga0070710_100481352 190
6 3300006175 Ga0070712_100066633 Ga0070712_1000666332 190
7 3300025898 Ga0207692_10265196 Ga0207692_102651962 190
8 3300025915 Ga0207693_10083077 Ga0207693_100830772 190
9 3300026078 Ga0207702_10192772 Ga0207702_101927722 190
10 3300046511 Ga0495608_0235550 Ga0495608_0235550_420_1085 191
11 3300048907 Ga0496104_0797845 Ga0496104_0797845_59_700 191
12 3300053155 Ga0500620_032604 Ga0500620_032604_41_685 191
13 3300005530 Ga0070679_100067235 Ga0070679_1000672354 193
14 3300025921 Ga0207652_10056706 Ga0207652_100567062 193
15 3300022467 Ga0224712_10045466 Ga0224712_100454662 195
16 3300039450 Ga0436363_0675038 Ga0436363_0675038_158_766 196
17 3300044735 Ga0466968_0250012 Ga0466968_0250012_50_658 196
18 3300045049 Ga0466959_0046645 Ga0466959_0046645_1468_2076 196
19 3300045836 Ga0466958_0488249 Ga0466958_0488249_161_769 196
20 3300005546 Ga0070696_100001701 Ga0070696_1000017019 197
21 3300046678 Ga0495599_0060826 Ga0495599_0060826_245_940 197
22 3300005530 Ga0070679_100374265 Ga0070679_1003742651 198
23 3300025928 Ga0207700_10685567 Ga0207700_106855672 198
24 3300005530 Ga0070679_100783225 Ga0070679_1007832251 199
25 3300020082 Ga0206353_10578181 Ga0206353_105781811 199
26 3300022467 Ga0224712_10117150 Ga0224712_101171502 199
27 3300038443 Ga0395901_0136927 Ga0395901_0136927_860_1528 199
28 3300045836 Ga0466958_0372182 Ga0466958_0372182_220_873 199
29 3300005329 Ga0070683_100330140 Ga0070683_1003301402 200
30 3300005435 Ga0070714_100258686 Ga0070714_1002586862 200
31 3300005437 Ga0070710_10295531 Ga0070710_102955311 200
32 3300006028 Ga0070717_10092656 Ga0070717_100926562 200
33 3300006175 Ga0070712_100044726 Ga0070712_1000447262 200
34 3300013105 Ga0157369_10077317 Ga0157369_100773173 200
35 3300020069 Ga0197907_10550438 Ga0197907_105504382 200
36 3300020070 Ga0206356_11361686 Ga0206356_113616862 200
37 3300020075 Ga0206349_1467147 Ga0206349_14671472 200
38 3300020076 Ga0206355_1497021 Ga0206355_14970212 200
39 3300020077 Ga0206351_10332717 Ga0206351_103327172 200
40 3300020080 Ga0206350_10018262 Ga0206350_100182622 200
41 3300020082 Ga0206353_11356432 Ga0206353_113564322 200
42 3300020610 Ga0154015_1095088 Ga0154015_10950882 200
43 3300022467 Ga0224712_10001708 Ga0224712_100017082 200
44 3300025898 Ga0207692_10148458 Ga0207692_101484581 200
45 3300037853 Ga0436364_1086226 Ga0436364_1086226_3505_4149 200
46 3300046516 Ga0495628_0054070 Ga0495628_0054070_1014_1709 200
47 3300046529 Ga0495652_0142017 Ga0495652_0142017_701_1396 200
48 3300046535 Ga0495586_0271134 Ga0495586_0271134_153_848 200
49 3300048918 Ga0496115_0028547 Ga0496115_0028547_2502_3161 200
50 3300005467 Ga0070706_100791428 Ga0070706_1007914281 203
51 3300005471 Ga0070698_100013008 Ga0070698_1000130085 203
52 3300005518 Ga0070699_100334600 Ga0070699_1003346002 203
53 3300006175 Ga0070712_100446240 Ga0070712_1004462402 203
54 3300025922 Ga0207646_10159443 Ga0207646_101594433 203
55 3300025928 Ga0207700_10129304 Ga0207700_101293043 203
56 3300031018 Ga0265773_1000833 Ga0265773_10008332 203
57 3300035111 Ga0373923_0025534 Ga0373923_0025534_1465_2112 203
58 3300035410 Ga0373924_0024845 Ga0373924_0024845_287_934 203
59 3300039437 Ga0436365_0066733 Ga0436365_0066733_937_1608 203
60 3300046462 Ga0495651_0311972 Ga0495651_0311972_115_762 203
61 3300046463 Ga0495653_0065801 Ga0495653_0065801_1304_1951 203
62 3300046477 Ga0495664_0198036 Ga0495664_0198036_199_846 203
63 3300046514 Ga0495618_0040911 Ga0495618_0040911_514_1161 203
64 3300046529 Ga0495652_0044788 Ga0495652_0044788_249_896 203
65 3300046533 Ga0495640_0168065 Ga0495640_0168065_52_699 203
66 3300046535 Ga0495586_0048628 Ga0495586_0048628_1192_1839 203
67 3300046536 Ga0495587_0023610 Ga0495587_0023610_256_903 203
68 3300046642 Ga0495634_0019436 Ga0495634_0019436_2618_3265 203
69 3300046663 Ga0495635_0022316 Ga0495635_0022316_2171_2818 203
70 3300046689 Ga0495613_0147966 Ga0495613_0147966_608_1255 203
71 3300046809 Ga0495600_0220447 Ga0495600_0220447_315_962 203
72 3300047317 Ga0495604_0139759 Ga0495604_0139759_854_1501 203
73 3300047321 Ga0495676_0058270 Ga0495676_0058270_2028_2675 203
74 3300047444 Ga0495675_0052468 Ga0495675_0052468_85_735 203
75 3300053077 Ga0495601_0201019 Ga0495601_0201019_549_1196 203
76 3300053084 Ga0495595_0292006 Ga0495595_0292006_14_661 203
77 3300053085 Ga0495619_0190856 Ga0495619_0190856_336_983 203
78 3300061719 Ga0466962_0082356 Ga0466962_0082356_494_1180 204
79 3300044684 Ga0466966_0198537 Ga0466966_0198537_328_1029 205
80 3300044694 Ga0466963_0304177 Ga0466963_0304177_393_1094 205
81 3300045049 Ga0466959_0114010 Ga0466959_0114010_714_1415 205
82 3300005436 Ga0070713_100304320 Ga0070713_1003043202 206
83 3300006028 Ga0070717_10331532 Ga0070717_103315322 206
84 3300006173 Ga0070716_100030949 Ga0070716_1000309492 206
85 3300006175 Ga0070712_100208028 Ga0070712_1002080282 206
86 3300025898 Ga0207692_10007687 Ga0207692_100076872 206
87 3300025906 Ga0207699_10015749 Ga0207699_100157493 206
88 3300025915 Ga0207693_10226646 Ga0207693_102266462 206
89 3300025916 Ga0207663_10219474 Ga0207663_102194742 206
90 3300025928 Ga0207700_10227756 Ga0207700_102277562 206
91 3300025929 Ga0207664_10297305 Ga0207664_102973052 206
92 3300025939 Ga0207665_10094130 Ga0207665_100941302 206
93 3300044694 Ga0466963_0064141 Ga0466963_0064141_957_1646 206
94 3300005437 Ga0070710_10266266 Ga0070710_102662661 207
95 3300006175 Ga0070712_100331103 Ga0070712_1003311032 207
96 3300025898 Ga0207692_10039417 Ga0207692_100394174 207
97 3300025915 Ga0207693_10057726 Ga0207693_100577264 207
98 3300044693 Ga0466961_0005645 Ga0466961_0005645_5844_6599 207
99 3300044901 Ga0466960_0056517 Ga0466960_0056517_1030_1656 207
100 3300045836 Ga0466958_0080231 Ga0466958_0080231_944_1699 207
101 3300045976 Ga0466967_0122457 Ga0466967_0122457_13_639 207
102 3300022467 Ga0224712_10013729 Ga0224712_100137292 208
103 3300044656 Ga0466969_0017641 Ga0466969_0017641_1485_2294 209
104 3300044693 Ga0466961_0020895 Ga0466961_0020895_640_1449 209
105 3300044765 Ga0466970_0012673 Ga0466970_0012673_2142_2951 209
106 3300045976 Ga0466967_0306072 Ga0466967_0306072_135_860 209
107 3300005539 Ga0068853_100239968 Ga0068853_1002399682 210
108 3300005563 Ga0068855_100010827 Ga0068855_1000108276 210
109 3300005578 Ga0068854_100013004 Ga0068854_1000130043 210
110 3300009093 Ga0105240_10040140 Ga0105240_100401403 210
111 3300009174 Ga0105241_10005186 Ga0105241_100051863 210
112 3300009551 Ga0105238_10070999 Ga0105238_100709993 210
113 3300022467 Ga0224712_10018506 Ga0224712_100185063 210
114 3300025904 Ga0207647_10004421 Ga0207647_100044215 210
115 3300025911 Ga0207654_10017964 Ga0207654_100179643 210
116 3300025913 Ga0207695_10005844 Ga0207695_1000584412 210
117 3300025914 Ga0207671_10000421 Ga0207671_100004217 210
118 3300025924 Ga0207694_10059440 Ga0207694_100594402 210
119 3300025949 Ga0207667_10029752 Ga0207667_100297523 210
120 3300025981 Ga0207640_10043927 Ga0207640_100439273 210
121 3300026142 Ga0207698_10125911 Ga0207698_101259112 210
122 3300028379 Ga0268266_10219967 Ga0268266_102199673 210
123 iso_pu_bacteria 2675902999 2676201975 210
124 iso_pu_bacteria 2773857921 2774846551 210
125 iso_pu_bacteria 2811994882 2812372788 210
126 iso_pu_bacteria 2818991462 2819689689 210
127 iso_pu_bacteria 2818991469 2819726756 210
128 3300013104 Ga0157370_10239735 Ga0157370_102397352 211
129 3300045049 Ga0466959_0039279 Ga0466959_0039279_2442_3089 211
130 iso_pu_bacteria 2902837492 2902840397 211
131 3300005327 Ga0070658_10000321 Ga0070658_1000032115 212
132 3300005563 Ga0068855_100015844 Ga0068855_1000158446 212
133 3300020069 Ga0197907_10131703 Ga0197907_101317031 212
134 3300020077 Ga0206351_10602002 Ga0206351_106020024 212
135 3300020080 Ga0206350_10382195 Ga0206350_103821952 212
136 3300020080 Ga0206350_10656528 Ga0206350_106565282 212
137 3300020080 Ga0206350_10668316 Ga0206350_106683162 212
138 3300020610 Ga0154015_1200931 Ga0154015_12009312 212
139 3300020610 Ga0154015_1420689 Ga0154015_14206893 212
140 3300025909 Ga0207705_10005023 Ga0207705_100050232 212
141 3300025913 Ga0207695_10178532 Ga0207695_101785322 212
142 3300025949 Ga0207667_10015432 Ga0207667_100154327 212
143 3300005327 Ga0070658_10332330 Ga0070658_103323302 214
144 3300005335 Ga0070666_10368720 Ga0070666_103687201 214
145 3300005337 Ga0070682_100001487 Ga0070682_1000014873 214
146 3300005338 Ga0068868_100186317 Ga0068868_1001863172 214
147 3300005345 Ga0070692_10255506 Ga0070692_102555061 214
148 3300005355 Ga0070671_100104338 Ga0070671_1001043382 214
149 3300005367 Ga0070667_100342735 Ga0070667_1003427352 214
150 3300005435 Ga0070714_100000014 Ga0070714_100000014160 214
151 3300005455 Ga0070663_100032959 Ga0070663_1000329593 214
152 3300005456 Ga0070678_100145724 Ga0070678_1001457242 214
153 3300005459 Ga0068867_100068492 Ga0068867_1000684922 214
154 3300005530 Ga0070679_100233710 Ga0070679_1002337102 214
155 3300005530 Ga0070679_100897204 Ga0070679_1008972041 214
156 3300005535 Ga0070684_100695383 Ga0070684_1006953831 214
157 3300005563 Ga0068855_100132762 Ga0068855_1001327622 214
158 3300005615 Ga0070702_100072090 Ga0070702_1000720902 214
159 3300005616 Ga0068852_100040241 Ga0068852_1000402414 214
160 3300005718 Ga0068866_10003522 Ga0068866_100035227 214
161 3300005840 Ga0068870_10178610 Ga0068870_101786102 214
162 3300005841 Ga0068863_100239345 Ga0068863_1002393452 214
163 3300005841 Ga0068863_100638097 Ga0068863_1006380972 214
164 3300005842 Ga0068858_100235689 Ga0068858_1002356893 214
165 3300006163 Ga0070715_10295386 Ga0070715_102953862 214
166 3300006358 Ga0068871_100526036 Ga0068871_1005260362 214
167 3300006881 Ga0068865_100035429 Ga0068865_1000354292 214
168 3300009093 Ga0105240_10026928 Ga0105240_100269287 214
169 3300009093 Ga0105240_10542561 Ga0105240_105425612 214
170 3300009098 Ga0105245_10002198 Ga0105245_100021987 214
171 3300009174 Ga0105241_10107366 Ga0105241_101073662 214
172 3300009545 Ga0105237_10268238 Ga0105237_102682382 214
173 3300009551 Ga0105238_10057205 Ga0105238_100572052 214
174 3300009551 Ga0105238_10128892 Ga0105238_101288922 214
175 3300009553 Ga0105249_10608669 Ga0105249_106086692 214
176 3300010375 Ga0105239_10348216 Ga0105239_103482162 214
177 3300011119 Ga0105246_10125206 Ga0105246_101252062 214
178 3300013104 Ga0157370_10004063 Ga0157370_100040635 214
179 3300013104 Ga0157370_10264514 Ga0157370_102645143 214
180 3300013105 Ga0157369_10014211 Ga0157369_100142114 214
181 3300013105 Ga0157369_10036203 Ga0157369_100362038 214
182 3300013105 Ga0157369_10622257 Ga0157369_106222572 214
183 3300013296 Ga0157374_10124956 Ga0157374_101249563 214
184 3300013296 Ga0157374_10244474 Ga0157374_102444742 214
185 3300013297 Ga0157378_10235045 Ga0157378_102350453 214
186 3300013306 Ga0163162_10510093 Ga0163162_105100932 214
187 3300013307 Ga0157372_10000006 Ga0157372_1000000652 214
188 3300013307 Ga0157372_10613647 Ga0157372_106136472 214
189 3300014326 Ga0157380_10037106 Ga0157380_100371064 214
190 3300014968 Ga0157379_10325541 Ga0157379_103255412 214
191 3300014969 Ga0157376_10493775 Ga0157376_104937752 214
192 3300014969 Ga0157376_10802803 Ga0157376_108028032 214
193 3300020070 Ga0206356_10377962 Ga0206356_103779622 214
194 3300020080 Ga0206350_11338705 Ga0206350_113387052 214
195 3300020082 Ga0206353_10412565 Ga0206353_1041256511 214
196 3300022467 Ga0224712_10043910 Ga0224712_100439102 214
197 3300025898 Ga0207692_10127291 Ga0207692_101272912 214
198 3300025899 Ga0207642_10020288 Ga0207642_100202882 214
199 3300025900 Ga0207710_10031860 Ga0207710_100318602 214
200 3300025901 Ga0207688_10022810 Ga0207688_100228102 214
201 3300025903 Ga0207680_10006628 Ga0207680_100066286 214
202 3300025913 Ga0207695_10153632 Ga0207695_101536322 214
203 3300025918 Ga0207662_10001273 Ga0207662_1000127314 214
204 3300025919 Ga0207657_10433764 Ga0207657_104337642 214
205 3300025921 Ga0207652_10090169 Ga0207652_100901692 214
206 3300025921 Ga0207652_10275735 Ga0207652_102757352 214
207 3300025921 Ga0207652_10539561 Ga0207652_105395612 214
208 3300025924 Ga0207694_10097951 Ga0207694_100979512 214
209 3300025927 Ga0207687_10000303 Ga0207687_1000030331 214
210 3300025929 Ga0207664_10000001 Ga0207664_10000001198 214
211 3300025934 Ga0207686_10001214 Ga0207686_1000121413 214
212 3300025936 Ga0207670_10043650 Ga0207670_100436502 214
213 3300025937 Ga0207669_10000848 Ga0207669_100008482 214
214 3300025942 Ga0207689_10024178 Ga0207689_100241783 214
215 3300025949 Ga0207667_10098932 Ga0207667_100989323 214
216 3300025972 Ga0207668_10050182 Ga0207668_100501823 214
217 3300025986 Ga0207658_10413373 Ga0207658_104133732 214
218 3300026023 Ga0207677_10196085 Ga0207677_101960852 214
219 3300026035 Ga0207703_10100610 Ga0207703_101006102 214
220 3300026088 Ga0207641_10486897 Ga0207641_104868972 214
221 3300026089 Ga0207648_10004258 Ga0207648_100042583 214
222 3300026095 Ga0207676_10369498 Ga0207676_103694982 214
223 3300026118 Ga0207675_100285487 Ga0207675_1002854873 214
224 3300026121 Ga0207683_10089428 Ga0207683_100894283 214
225 3300026121 Ga0207683_10148926 Ga0207683_101489263 214
226 3300035691 Ga0373931_0185104 Ga0373931_0185104_480_1214 214
227 3300037312 Ga0395899_0051490 Ga0395899_0051490_306_1022 214
228 3300037418 Ga0395900_0192447 Ga0395900_0192447_993_1709 214
229 3300037466 Ga0395898_0216952 Ga0395898_0216952_780_1496 214
230 3300038443 Ga0395901_0098003 Ga0395901_0098003_393_1124 214
231 3300038443 Ga0395901_0779981 Ga0395901_0779981_216_932 214
232 3300041443 Ga0451789_0097158 Ga0451789_0097158_184_918 214
233 3300041452 Ga0451793_0173599 Ga0451793_0173599_749_1483 214
234 3300041452 Ga0451793_1814972 Ga0451793_1814972_480_1214 214
235 3300041498 Ga0451841_0658615 Ga0451841_0658615_677_1411 214
236 3300041512 Ga0451853_2641902 Ga0451853_2641902_297_1031 214
237 3300044684 Ga0466966_0057780 Ga0466966_0057780_1080_1793 214
238 3300044684 Ga0466966_0245975 Ga0466966_0245975_76_786 214
239 3300044693 Ga0466961_0047969 Ga0466961_0047969_1168_1881 214
240 3300044693 Ga0466961_0130488 Ga0466961_0130488_371_1084 214
241 3300044694 Ga0466963_0289948 Ga0466963_0289948_303_1034 214
242 3300044706 Ga0466964_0171839 Ga0466964_0171839_102_833 214
243 3300044719 Ga0466971_0058481 Ga0466971_0058481_748_1479 214
244 3300044735 Ga0466968_0221336 Ga0466968_0221336_74_766 214
245 3300044901 Ga0466960_0012969 Ga0466960_0012969_1291_2022 214
246 3300044901 Ga0466960_0090058 Ga0466960_0090058_179_898 214
247 3300045049 Ga0466959_0054115 Ga0466959_0054115_15_728 214
248 3300045049 Ga0466959_0215117 Ga0466959_0215117_282_1013 214
249 3300045049 Ga0466959_0342789 Ga0466959_0342789_151_873 214
250 3300045836 Ga0466958_0103327 Ga0466958_0103327_303_1034 214
251 3300046531 Ga0495665_0093638 Ga0495665_0093638_735_1469 214
252 3300046663 Ga0495635_0223765 Ga0495635_0223765_296_1030 214
253 3300046675 Ga0495657_0266125 Ga0495657_0266125_207_941 214
254 3300046679 Ga0495623_0206990 Ga0495623_0206990_25_759 214
255 3300046690 Ga0495624_0244649 Ga0495624_0244649_100_834 214
256 3300047317 Ga0495604_0114053 Ga0495604_0114053_1056_1790 214
257 3300047321 Ga0495676_0120045 Ga0495676_0120045_977_1711 214
258 3300048088 Ga0495602_0367638 Ga0495602_0367638_196_930 214
259 3300048904 Ga0496101_0001476 Ga0496101_0001476_11188_11922 214
260 3300048904 Ga0496101_0122733 Ga0496101_0122733_591_1325 214
261 3300048904 Ga0496101_0788132 Ga0496101_0788132_14_682 214
262 3300048905 Ga0496102_0002454 Ga0496102_0002454_792_1526 214
263 3300048905 Ga0496102_0101866 Ga0496102_0101866_1158_1823 214
264 3300048907 Ga0496104_0010331 Ga0496104_0010331_336_1070 214
265 3300048907 Ga0496104_0280105 Ga0496104_0280105_531_1265 214
266 3300048908 Ga0496105_0021614 Ga0496105_0021614_2618_3352 214
267 3300048909 Ga0496106_0002261 Ga0496106_0002261_4224_4958 214
268 3300048910 Ga0496107_0319541 Ga0496107_0319541_240_974 214
269 3300048911 Ga0496108_0001789 Ga0496108_0001789_13791_14525 214
270 3300048911 Ga0496108_0003012 Ga0496108_0003012_1681_2415 214
271 3300048911 Ga0496108_0352861 Ga0496108_0352861_73_807 214
272 3300048912 Ga0496109_0003825 Ga0496109_0003825_1986_2720 214
273 3300048912 Ga0496109_0105046 Ga0496109_0105046_1895_2608 214
274 3300048912 Ga0496109_0117754 Ga0496109_0117754_517_1215 214
275 3300048912 Ga0496109_0123156 Ga0496109_0123156_241_975 214
276 3300048912 Ga0496109_0164881 Ga0496109_0164881_975_1709 214
277 3300048913 Ga0496110_0199112 Ga0496110_0199112_333_1067 214
278 3300048913 Ga0496110_0238770 Ga0496110_0238770_791_1525 214
279 3300048914 Ga0496111_0225933 Ga0496111_0225933_398_1132 214
280 3300048914 Ga0496111_0467685 Ga0496111_0467685_138_848 214
281 3300048916 Ga0496113_0009096 Ga0496113_0009096_1800_2498 214
282 3300048916 Ga0496113_0346603 Ga0496113_0346603_148_882 214
283 3300048917 Ga0496114_0002128 Ga0496114_0002128_13500_14234 214
284 3300048917 Ga0496114_0003346 Ga0496114_0003346_3023_3757 214
285 3300048917 Ga0496114_0028661 Ga0496114_0028661_1458_2192 214
286 3300048917 Ga0496114_0058761 Ga0496114_0058761_409_1134 214
287 3300048917 Ga0496114_0150412 Ga0496114_0150412_1183_1851 214
288 3300048917 Ga0496114_0301958 Ga0496114_0301958_288_1022 214
289 3300048918 Ga0496115_0001135 Ga0496115_0001135_7178_7912 214
290 3300048918 Ga0496115_0255028 Ga0496115_0255028_411_1145 214
291 3300048924 Ga0496121_0179125 Ga0496121_0179125_697_1407 214
292 3300053085 Ga0495619_0351517 Ga0495619_0351517_175_909 214
293 3300003323 rootH1_10273004 rootH1_102730043 215
294 3300005335 Ga0070666_10010762 Ga0070666_100107622 215
295 3300005347 Ga0070668_100132694 Ga0070668_1001326943 215
296 3300005355 Ga0070671_100067905 Ga0070671_1000679053 215
297 3300005367 Ga0070667_100119657 Ga0070667_1001196572 215
298 3300005548 Ga0070665_100016290 Ga0070665_1000162904 215
299 3300005614 Ga0068856_100620712 Ga0068856_1006207122 215
300 3300005618 Ga0068864_100878607 Ga0068864_1008786071 215
301 3300005841 Ga0068863_100021429 Ga0068863_1000214294 215
302 3300005842 Ga0068858_100394182 Ga0068858_1003941822 215
303 3300005843 Ga0068860_100005253 Ga0068860_1000052534 215
304 3300009177 Ga0105248_10276961 Ga0105248_102769612 215
305 3300025903 Ga0207680_10010310 Ga0207680_100103104 215
306 3300025925 Ga0207650_10444960 Ga0207650_104449602 215
307 3300025941 Ga0207711_10257356 Ga0207711_102573562 215
308 3300025972 Ga0207668_10110786 Ga0207668_101107863 215
309 3300025986 Ga0207658_10096167 Ga0207658_100961673 215
310 3300026035 Ga0207703_10025704 Ga0207703_100257042 215
311 3300026088 Ga0207641_10018644 Ga0207641_100186443 215
312 3300028379 Ga0268266_10008877 Ga0268266_100088774 215
313 3300028381 Ga0268264_10007512 Ga0268264_100075124 215
314 3300044684 Ga0466966_0085813 Ga0466966_0085813_352_1104 215
315 3300044684 Ga0466966_0149245 Ga0466966_0149245_142_879 215
316 3300044693 Ga0466961_0179418 Ga0466961_0179418_265_1017 215
317 3300044694 Ga0466963_0152656 Ga0466963_0152656_159_896 215
318 3300044765 Ga0466970_0023133 Ga0466970_0023133_1441_2178 215
319 3300044765 Ga0466970_0180198 Ga0466970_0180198_259_1011 215
320 3300044842 Ga0466957_0214217 Ga0466957_0214217_372_1109 215
321 3300045049 Ga0466959_0058115 Ga0466959_0058115_1305_2057 215
322 3300045049 Ga0466959_0075373 Ga0466959_0075373_136_873 215
323 3300045836 Ga0466958_0148021 Ga0466958_0148021_386_1123 215
324 3300048906 Ga0496103_0139623 Ga0496103_0139623_228_968 215
325 3300048927 Ga0496124_0243456 Ga0496124_0243456_292_993 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13618

Gluconate_2-dh3

Gluconate 2-dehydrogenase subunit 3

57

186

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hyb-assembly1.cif.gz_B crystal structure of myristoylated y81a mutant mmtv matrix protein 0.3135 53 166
1ks9-assembly1.cif.gz_A ketopantoate reductase from escherichia coli 0.3094 54 167
5hyb-assembly1.cif.gz_B crystal structure of myristoylated y81a mutant mmtv matrix protein 0.2999 53 166
3ge4-assembly1.cif.gz_E crystal structure of ferritin:dna-binding protein dps from brucella melitensis 0.2968 55 171
8bgw-assembly1.cif.gz_B cryoem structure of quinol-dependent nitric oxide reductase (qnor) from alcaligenes xylosoxidans at 2.2 a resolution 0.2923 24 177
ID Description Score Start End Superfamily
af_Q96LL9_48_122_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.411 118 185 1.10.287.110
af_Q96LL9_48_122_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.3734 118 185 1.10.287.110
af_O60437_25_130_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3458 24 177 1.20.58.60
af_I1KNZ9_171_268_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3317 50 179 1.20.58.160
af_Q9VNU2_20_247_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.3228 50 193 1.20.144.10
ID Description Score Start End GO Terms
AF-E3J8I2-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 0.9454 1 204
AF-A0A0F2THQ6-F1-model_v4 Gluconate 2-dehydrogenase 0.9158 15 207
AF-A0A1M3EPB3-F1-model_v4 Gluconate 2-dehydrogenase 0.9127 1 214
AF-A0A1M3EPB3-F1-model_v4 Gluconate 2-dehydrogenase 0.9005 1 214
AF-A0A838SNJ8-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.8952 3 209

Feature Viewer

pLDDT pTM Quality
86.01 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map