F407956
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 192 | 319 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300044684|Ga0466966_0085813|Ga0466966_0085813_352_1104 |
| Length | 250 |
| Sequence | VRGPYRAPDQRGVTPQGRGRFPGFDVLDEVHRWDDVTAGVVLARLAPTTDLSFFTLAENGCATALADLLLAQDAEPRVPVVAMIDARLAADETDGWHYDDMPPDPEAWRRTLAALDEDAEELAGRPFARLEREQQAALVQRVQDLGSDGKPWHELPAKHVWSLWTRYACAAFYSHPWAWNEMGFPGPAYPRGYKNTGVDAREGFEVPDSGGTDAGHPDPVPFADRVEKVRTEHARLVGEQLGDGEPGDEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 2 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 3 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 4 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 5 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 6 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 70 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 74 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 120 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 122 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 123 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 124 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 129 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 130 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 131 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 132 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 133 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 135 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 136 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 137 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 138 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 139 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 140 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 141 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 142 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 143 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 144 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 145 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 146 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 147 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 148 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 149 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 174 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 175 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 176 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 177 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 178 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 179 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 182 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 183 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 184 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 185 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 186 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 187 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 188 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 192 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.15 |
| Metatranscriptomes | 8 |
| Isolates | 1.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0.62 |
| Rhizoplane | 11.69 |
| Rhizosphere | 84.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10273004 | 3300003323 | Bacteria | 1679 |
| 2 | Ga0070658_10000321 | 3300005327 | Bacteria | 41064 |
| 3 | Ga0070658_10332330 | 3300005327 | Bacteria | 1299 |
| 4 | Ga0070683_100330140 | 3300005329 | Bacteria | 1452 |
| 5 | Ga0070666_10010762 | 3300005335 | Bacteria | 5724 |
| 6 | Ga0070666_10368720 | 3300005335 | Bacteria | 1029 |
| 7 | Ga0070682_100001487 | 3300005337 | Bacteria | 13140 |
| 8 | Ga0068868_100186317 | 3300005338 | Bacteria | 1724 |
| 9 | Ga0070692_10255506 | 3300005345 | Bacteria | 1051 |
| 10 | Ga0070668_100132694 | 3300005347 | Bacteria | 2000 |
| 11 | Ga0070671_100067905 | 3300005355 | Bacteria | 2973 |
| 12 | Ga0070671_100104338 | 3300005355 | Bacteria | 2379 |
| 13 | Ga0070667_100119657 | 3300005367 | Bacteria | 2290 |
| 14 | Ga0070667_100342735 | 3300005367 | Bacteria | 1352 |
| 15 | Ga0070714_100000014 | 3300005435 | Bacteria | 210194 |
| 16 | Ga0070714_100156207 | 3300005435 | Bacteria | 2059 |
| 17 | Ga0070714_100258686 | 3300005435 | Bacteria | 1611 |
| 18 | Ga0070713_100304320 | 3300005436 | Bacteria | 1468 |
| 19 | Ga0070710_10048135 | 3300005437 | Bacteria | 2380 |
| 20 | Ga0070710_10266266 | 3300005437 | Bacteria | 1107 |
| 21 | Ga0070710_10295531 | 3300005437 | Bacteria | 1055 |
| 22 | Ga0070663_100032959 | 3300005455 | Bacteria | 3575 |
| 23 | Ga0070678_100145724 | 3300005456 | Bacteria | 1901 |
| 24 | Ga0068867_100068492 | 3300005459 | Bacteria | 2648 |
| 25 | Ga0070706_100791428 | 3300005467 | Bacteria | 878 |
| 26 | Ga0070698_100013008 | 3300005471 | Bacteria | 8809 |
| 27 | Ga0070699_100334600 | 3300005518 | Bacteria | 1362 |
| 28 | Ga0070679_100067235 | 3300005530 | Bacteria | 3574 |
| 29 | Ga0070679_100233710 | 3300005530 | Bacteria | 1797 |
| 30 | Ga0070679_100374265 | 3300005530 | Bacteria | 1371 |
| 31 | Ga0070679_100783225 | 3300005530 | Bacteria | 897 |
| 32 | Ga0070679_100897204 | 3300005530 | Bacteria | 830 |
| 33 | Ga0070684_100695383 | 3300005535 | Bacteria | 948 |
| 34 | Ga0068853_100239968 | 3300005539 | Bacteria | 1661 |
| 35 | Ga0070696_100001701 | 3300005546 | Bacteria | 14420 |
| 36 | Ga0070665_100016290 | 3300005548 | Bacteria | 7456 |
| 37 | Ga0068855_100010827 | 3300005563 | Bacteria | 11013 |
| 38 | Ga0068855_100015844 | 3300005563 | Bacteria | 9068 |
| 39 | Ga0068855_100132762 | 3300005563 | Bacteria | 2842 |
| 40 | Ga0068854_100013004 | 3300005578 | Bacteria | 5455 |
| 41 | Ga0068856_100620712 | 3300005614 | Bacteria | 1102 |
| 42 | Ga0070702_100072090 | 3300005615 | Bacteria | 2043 |
| 43 | Ga0068852_100040241 | 3300005616 | Bacteria | 3942 |
| 44 | Ga0068864_100878607 | 3300005618 | Bacteria | 884 |
| 45 | Ga0068866_10003522 | 3300005718 | Bacteria | 6408 |
| 46 | Ga0068870_10178610 | 3300005840 | Bacteria | 1272 |
| 47 | Ga0068863_100021429 | 3300005841 | Bacteria | 6168 |
| 48 | Ga0068863_100239345 | 3300005841 | Bacteria | 1752 |
| 49 | Ga0068863_100638097 | 3300005841 | Bacteria | 1056 |
| 50 | Ga0068858_100235689 | 3300005842 | Bacteria | 1735 |
| 51 | Ga0068858_100394182 | 3300005842 | Bacteria | 1330 |
| 52 | Ga0068860_100005253 | 3300005843 | Bacteria | 13144 |
| 53 | Ga0070717_10092656 | 3300006028 | Bacteria | 2553 |
| 54 | Ga0070717_10331532 | 3300006028 | Bacteria | 1357 |
| 55 | Ga0070715_10295386 | 3300006163 | Bacteria | 865 |
| 56 | Ga0070716_100030949 | 3300006173 | Bacteria | 2908 |
| 57 | Ga0070712_100044726 | 3300006175 | Bacteria | 3054 |
| 58 | Ga0070712_100066633 | 3300006175 | Bacteria | 2560 |
| 59 | Ga0070712_100208028 | 3300006175 | Bacteria | 1541 |
| 60 | Ga0070712_100331103 | 3300006175 | Bacteria | 1241 |
| 61 | Ga0070712_100446240 | 3300006175 | Bacteria | 1076 |
| 62 | Ga0068871_100526036 | 3300006358 | Bacteria | 1068 |
| 63 | Ga0068865_100035429 | 3300006881 | Bacteria | 3356 |
| 64 | Ga0105240_10026928 | 3300009093 | Bacteria | 7538 |
| 65 | Ga0105240_10040140 | 3300009093 | Bacteria | 5990 |
| 66 | Ga0105240_10542561 | 3300009093 | Bacteria | 1288 |
| 67 | Ga0105245_10002198 | 3300009098 | Bacteria | 17676 |
| 68 | Ga0105241_10005186 | 3300009174 | Bacteria | 9614 |
| 69 | Ga0105241_10107366 | 3300009174 | Bacteria | 2230 |
| 70 | Ga0105248_10276961 | 3300009177 | Bacteria | 1889 |
| 71 | Ga0105237_10268238 | 3300009545 | Bacteria | 1710 |
| 72 | Ga0105238_10057205 | 3300009551 | Bacteria | 3911 |
| 73 | Ga0105238_10070999 | 3300009551 | Bacteria | 3480 |
| 74 | Ga0105238_10128892 | 3300009551 | Bacteria | 2508 |
| 75 | Ga0105249_10608669 | 3300009553 | Bacteria | 1148 |
| 76 | Ga0105239_10348216 | 3300010375 | Bacteria | 1672 |
| 77 | Ga0105246_10125206 | 3300011119 | Bacteria | 1911 |
| 78 | Ga0157370_10004063 | 3300013104 | Bacteria | 16964 |
| 79 | Ga0157370_10239735 | 3300013104 | Bacteria | 1678 |
| 80 | Ga0157370_10264514 | 3300013104 | Bacteria | 1589 |
| 81 | Ga0157369_10014211 | 3300013105 | Bacteria | 8993 |
| 82 | Ga0157369_10036203 | 3300013105 | Bacteria | 5409 |
| 83 | Ga0157369_10077317 | 3300013105 | Bacteria | 3567 |
| 84 | Ga0157369_10622257 | 3300013105 | Bacteria | 1114 |
| 85 | Ga0157374_10124956 | 3300013296 | Bacteria | 2486 |
| 86 | Ga0157374_10244474 | 3300013296 | Bacteria | 1765 |
| 87 | Ga0157378_10235045 | 3300013297 | Bacteria | 1748 |
| 88 | Ga0163162_10510093 | 3300013306 | Bacteria | 1333 |
| 89 | Ga0157372_10000006 | 3300013307 | Bacteria | 354669 |
| 90 | Ga0157372_10613647 | 3300013307 | Bacteria | 1268 |
| 91 | Ga0157380_10037106 | 3300014326 | Bacteria | 3775 |
| 92 | Ga0157379_10325541 | 3300014968 | Bacteria | 1404 |
| 93 | Ga0157376_10493775 | 3300014969 | Bacteria | 1202 |
| 94 | Ga0157376_10802803 | 3300014969 | Bacteria | 954 |
| 95 | Ga0197907_10131703 | 3300020069 | Bacteria | 1591 |
| 96 | Ga0197907_10550438 | 3300020069 | Bacteria | 5927 |
| 97 | Ga0206356_10377962 | 3300020070 | Bacteria | 1613 |
| 98 | Ga0206356_11361686 | 3300020070 | Bacteria | 1824 |
| 99 | Ga0206349_1467147 | 3300020075 | Bacteria | 1635 |
| 100 | Ga0206355_1497021 | 3300020076 | Bacteria | 1762 |
| 101 | Ga0206351_10332717 | 3300020077 | Bacteria | 1304 |
| 102 | Ga0206351_10602002 | 3300020077 | Bacteria | 1780 |
| 103 | Ga0206350_10018262 | 3300020080 | Bacteria | 5225 |
| 104 | Ga0206350_10382195 | 3300020080 | Bacteria | 1628 |
| 105 | Ga0206350_10656528 | 3300020080 | Bacteria | 1663 |
| 106 | Ga0206350_10668316 | 3300020080 | Bacteria | 2214 |
| 107 | Ga0206350_11338705 | 3300020080 | Bacteria | 1299 |
| 108 | Ga0206353_10412565 | 3300020082 | Bacteria | 9730 |
| 109 | Ga0206353_10578181 | 3300020082 | Bacteria | 1031 |
| 110 | Ga0206353_11356432 | 3300020082 | Bacteria | 2909 |
| 111 | Ga0154015_1095088 | 3300020610 | Bacteria | 1356 |
| 112 | Ga0154015_1200931 | 3300020610 | Bacteria | 1414 |
| 113 | Ga0154015_1420689 | 3300020610 | Bacteria | 1669 |
| 114 | Ga0224712_10001708 | 3300022467 | Bacteria | 5208 |
| 115 | Ga0224712_10013729 | 3300022467 | Bacteria | 2588 |
| 116 | Ga0224712_10018506 | 3300022467 | Bacteria | 2330 |
| 117 | Ga0224712_10043910 | 3300022467 | Bacteria | 1702 |
| 118 | Ga0224712_10045466 | 3300022467 | Bacteria | 1680 |
| 119 | Ga0224712_10117150 | 3300022467 | Bacteria | 1149 |
| 120 | Ga0207692_10007687 | 3300025898 | Bacteria | 4426 |
| 121 | Ga0207692_10039417 | 3300025898 | Bacteria | 2324 |
| 122 | Ga0207692_10127291 | 3300025898 | Bacteria | 1434 |
| 123 | Ga0207692_10148458 | 3300025898 | Bacteria | 1340 |
| 124 | Ga0207692_10265196 | 3300025898 | Bacteria | 1034 |
| 125 | Ga0207642_10020288 | 3300025899 | Bacteria | 2591 |
| 126 | Ga0207710_10031860 | 3300025900 | Bacteria | 2308 |
| 127 | Ga0207688_10022810 | 3300025901 | Bacteria | 3428 |
| 128 | Ga0207680_10006628 | 3300025903 | Bacteria | 5619 |
| 129 | Ga0207680_10010310 | 3300025903 | Bacteria | 4669 |
| 130 | Ga0207647_10004421 | 3300025904 | Bacteria | 10420 |
| 131 | Ga0207699_10015749 | 3300025906 | Bacteria | 3936 |
| 132 | Ga0207705_10005023 | 3300025909 | Bacteria | 9922 |
| 133 | Ga0207654_10017964 | 3300025911 | Bacteria | 3707 |
| 134 | Ga0207695_10005844 | 3300025913 | Bacteria | 16167 |
| 135 | Ga0207695_10153632 | 3300025913 | Bacteria | 2238 |
| 136 | Ga0207695_10178532 | 3300025913 | Bacteria | 2045 |
| 137 | Ga0207671_10000421 | 3300025914 | Bacteria | 58859 |
| 138 | Ga0207693_10057726 | 3300025915 | Bacteria | 3041 |
| 139 | Ga0207693_10083077 | 3300025915 | Bacteria | 2509 |
| 140 | Ga0207693_10226646 | 3300025915 | Bacteria | 1468 |
| 141 | Ga0207663_10219474 | 3300025916 | Bacteria | 1382 |
| 142 | Ga0207662_10001273 | 3300025918 | Bacteria | 12127 |
| 143 | Ga0207657_10433764 | 3300025919 | Bacteria | 1032 |
| 144 | Ga0207652_10056706 | 3300025921 | Bacteria | 3373 |
| 145 | Ga0207652_10090169 | 3300025921 | Bacteria | 2693 |
| 146 | Ga0207652_10275735 | 3300025921 | Bacteria | 1517 |
| 147 | Ga0207652_10539561 | 3300025921 | Bacteria | 1049 |
| 148 | Ga0207646_10159443 | 3300025922 | Bacteria | 2035 |
| 149 | Ga0207694_10059440 | 3300025924 | Bacteria | 2973 |
| 150 | Ga0207694_10097951 | 3300025924 | Bacteria | 2321 |
| 151 | Ga0207650_10444960 | 3300025925 | Bacteria | 1078 |
| 152 | Ga0207687_10000303 | 3300025927 | Bacteria | 33416 |
| 153 | Ga0207700_10129304 | 3300025928 | Bacteria | 2059 |
| 154 | Ga0207700_10227756 | 3300025928 | Bacteria | 1583 |
| 155 | Ga0207700_10685567 | 3300025928 | Bacteria | 914 |
| 156 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 157 | Ga0207664_10297305 | 3300025929 | Bacteria | 1420 |
| 158 | Ga0207686_10001214 | 3300025934 | Bacteria | 14958 |
| 159 | Ga0207670_10043650 | 3300025936 | Bacteria | 2962 |
| 160 | Ga0207669_10000848 | 3300025937 | Bacteria | 13040 |
| 161 | Ga0207665_10094130 | 3300025939 | Bacteria | 2081 |
| 162 | Ga0207711_10257356 | 3300025941 | Bacteria | 1604 |
| 163 | Ga0207689_10024178 | 3300025942 | Bacteria | 5096 |
| 164 | Ga0207667_10015432 | 3300025949 | Bacteria | 8677 |
| 165 | Ga0207667_10029752 | 3300025949 | Bacteria | 5917 |
| 166 | Ga0207667_10098932 | 3300025949 | Bacteria | 3009 |
| 167 | Ga0207668_10050182 | 3300025972 | Bacteria | 2874 |
| 168 | Ga0207668_10110786 | 3300025972 | Bacteria | 2059 |
| 169 | Ga0207640_10043927 | 3300025981 | Bacteria | 2860 |
| 170 | Ga0207658_10096167 | 3300025986 | Bacteria | 2309 |
| 171 | Ga0207658_10413373 | 3300025986 | Bacteria | 1188 |
| 172 | Ga0207677_10196085 | 3300026023 | Bacteria | 1601 |
| 173 | Ga0207703_10025704 | 3300026035 | Bacteria | 4632 |
| 174 | Ga0207703_10100610 | 3300026035 | Bacteria | 2450 |
| 175 | Ga0207702_10192772 | 3300026078 | Bacteria | 1884 |
| 176 | Ga0207641_10018644 | 3300026088 | Bacteria | 5688 |
| 177 | Ga0207641_10486897 | 3300026088 | Bacteria | 1196 |
| 178 | Ga0207648_10004258 | 3300026089 | Bacteria | 14772 |
| 179 | Ga0207676_10369498 | 3300026095 | Bacteria | 1332 |
| 180 | Ga0207675_100285487 | 3300026118 | Bacteria | 1604 |
| 181 | Ga0207683_10089428 | 3300026121 | Bacteria | 2741 |
| 182 | Ga0207683_10148926 | 3300026121 | Bacteria | 2112 |
| 183 | Ga0207698_10125911 | 3300026142 | Bacteria | 2179 |
| 184 | Ga0268266_10008877 | 3300028379 | Bacteria | 8899 |
| 185 | Ga0268266_10219967 | 3300028379 | Bacteria | 1745 |
| 186 | Ga0268264_10007512 | 3300028381 | Bacteria | 9094 |
| 187 | Ga0265773_1000833 | 3300031018 | Bacteria | 1448 |
| 188 | Ga0373923_0025534 | 3300035111 | Bacteria | 2342 |
| 189 | Ga0373924_0024845 | 3300035410 | Bacteria | 2364 |
| 190 | Ga0373931_0185104 | 3300035691 | Bacteria | 1236 |
| 191 | Ga0373935_0175684 | 3300035692 | Bacteria | 1467 |
| 192 | Ga0373927_0203866 | 3300035695 | Bacteria | 1299 |
| 193 | Ga0373925_0266538 | 3300037068 | Bacteria | 1377 |
| 194 | Ga0395899_0051490 | 3300037312 | Bacteria | 3056 |
| 195 | Ga0395900_0192447 | 3300037418 | Bacteria | 2068 |
| 196 | Ga0395898_0216952 | 3300037466 | Bacteria | 1825 |
| 197 | Ga0436364_1086226 | 3300037853 | Bacteria | 5887 |
| 198 | Ga0395901_0098003 | 3300038443 | Bacteria | 3074 |
| 199 | Ga0395901_0136927 | 3300038443 | Bacteria | 2573 |
| 200 | Ga0395901_0779981 | 3300038443 | Bacteria | 946 |
| 201 | Ga0436365_0066733 | 3300039437 | Bacteria | 1969 |
| 202 | Ga0436363_0675038 | 3300039450 | Bacteria | 1071 |
| 203 | Ga0451789_0097158 | 3300041443 | Bacteria | 1123 |
| 204 | Ga0451793_0173599 | 3300041452 | Bacteria | 1662 |
| 205 | Ga0451793_1814972 | 3300041452 | Bacteria | 1393 |
| 206 | Ga0451841_0658615 | 3300041498 | Bacteria | 1620 |
| 207 | Ga0451853_2641902 | 3300041512 | Bacteria | 1535 |
| 208 | Ga0466969_0017641 | 3300044656 | Bacteria | 3724 |
| 209 | Ga0466966_0057780 | 3300044684 | Bacteria | 2453 |
| 210 | Ga0466966_0085813 | 3300044684 | Bacteria | 1957 |
| 211 | Ga0466966_0149245 | 3300044684 | Bacteria | 1426 |
| 212 | Ga0466966_0198537 | 3300044684 | Bacteria | 1214 |
| 213 | Ga0466966_0245975 | 3300044684 | Bacteria | 1078 |
| 214 | Ga0466961_0005645 | 3300044693 | Bacteria | 7911 |
| 215 | Ga0466961_0020895 | 3300044693 | Bacteria | 4212 |
| 216 | Ga0466961_0047969 | 3300044693 | Bacteria | 2730 |
| 217 | Ga0466961_0130488 | 3300044693 | Bacteria | 1575 |
| 218 | Ga0466961_0179418 | 3300044693 | Bacteria | 1315 |
| 219 | Ga0466963_0064141 | 3300044694 | Bacteria | 2460 |
| 220 | Ga0466963_0152656 | 3300044694 | Bacteria | 1604 |
| 221 | Ga0466963_0289948 | 3300044694 | Bacteria | 1150 |
| 222 | Ga0466963_0304177 | 3300044694 | Bacteria | 1122 |
| 223 | Ga0466964_0171839 | 3300044706 | Bacteria | 1021 |
| 224 | Ga0466971_0058481 | 3300044719 | Bacteria | 1740 |
| 225 | Ga0466968_0221336 | 3300044735 | Bacteria | 892 |
| 226 | Ga0466968_0250012 | 3300044735 | Bacteria | 842 |
| 227 | Ga0466970_0012673 | 3300044765 | Bacteria | 4313 |
| 228 | Ga0466970_0023133 | 3300044765 | Bacteria | 3244 |
| 229 | Ga0466970_0180198 | 3300044765 | Bacteria | 1172 |
| 230 | Ga0466957_0214217 | 3300044842 | Bacteria | 1269 |
| 231 | Ga0466960_0012969 | 3300044901 | Bacteria | 3531 |
| 232 | Ga0466960_0056517 | 3300044901 | Bacteria | 1911 |
| 233 | Ga0466960_0090058 | 3300044901 | Bacteria | 1562 |
| 234 | Ga0466959_0039279 | 3300045049 | Bacteria | 3497 |
| 235 | Ga0466959_0046645 | 3300045049 | Bacteria | 3188 |
| 236 | Ga0466959_0054115 | 3300045049 | Bacteria | 2933 |
| 237 | Ga0466959_0058115 | 3300045049 | Bacteria | 2818 |
| 238 | Ga0466959_0075373 | 3300045049 | Bacteria | 2437 |
| 239 | Ga0466959_0114010 | 3300045049 | Bacteria | 1927 |
| 240 | Ga0466959_0215117 | 3300045049 | Bacteria | 1334 |
| 241 | Ga0466959_0342789 | 3300045049 | Bacteria | 1019 |
| 242 | Ga0466958_0080231 | 3300045836 | Bacteria | 2007 |
| 243 | Ga0466958_0103327 | 3300045836 | Bacteria | 1774 |
| 244 | Ga0466958_0148021 | 3300045836 | Bacteria | 1480 |
| 245 | Ga0466958_0372182 | 3300045836 | Bacteria | 921 |
| 246 | Ga0466958_0488249 | 3300045836 | Bacteria | 799 |
| 247 | Ga0466967_0122457 | 3300045976 | Bacteria | 2405 |
| 248 | Ga0466967_0306072 | 3300045976 | Bacteria | 1530 |
| 249 | Ga0495651_0311972 | 3300046462 | Bacteria | 1051 |
| 250 | Ga0495653_0065801 | 3300046463 | Bacteria | 2727 |
| 251 | Ga0495664_0198036 | 3300046477 | Bacteria | 1217 |
| 252 | Ga0495608_0235550 | 3300046511 | Bacteria | 1145 |
| 253 | Ga0495618_0040911 | 3300046514 | Bacteria | 2918 |
| 254 | Ga0495628_0054070 | 3300046516 | Bacteria | 3166 |
| 255 | Ga0495652_0044788 | 3300046529 | Bacteria | 3808 |
| 256 | Ga0495652_0142017 | 3300046529 | Bacteria | 1887 |
| 257 | Ga0495665_0093638 | 3300046531 | Bacteria | 1579 |
| 258 | Ga0495640_0168065 | 3300046533 | Bacteria | 1402 |
| 259 | Ga0495586_0048628 | 3300046535 | Bacteria | 2292 |
| 260 | Ga0495586_0271134 | 3300046535 | Bacteria | 970 |
| 261 | Ga0495587_0023610 | 3300046536 | Bacteria | 3778 |
| 262 | Ga0495634_0019436 | 3300046642 | Bacteria | 4827 |
| 263 | Ga0495635_0022316 | 3300046663 | Bacteria | 4406 |
| 264 | Ga0495635_0223765 | 3300046663 | Bacteria | 1272 |
| 265 | Ga0495657_0266125 | 3300046675 | Bacteria | 1029 |
| 266 | Ga0495599_0060826 | 3300046678 | Bacteria | 2361 |
| 267 | Ga0495623_0206990 | 3300046679 | Bacteria | 1125 |
| 268 | Ga0495613_0147966 | 3300046689 | Bacteria | 1676 |
| 269 | Ga0495624_0244649 | 3300046690 | Bacteria | 1085 |
| 270 | Ga0495600_0220447 | 3300046809 | Bacteria | 1213 |
| 271 | Ga0495604_0114053 | 3300047317 | Bacteria | 1966 |
| 272 | Ga0495604_0139759 | 3300047317 | Bacteria | 1731 |
| 273 | Ga0495676_0058270 | 3300047321 | Bacteria | 3040 |
| 274 | Ga0495676_0120045 | 3300047321 | Bacteria | 1914 |
| 275 | Ga0495675_0052468 | 3300047444 | Bacteria | 2589 |
| 276 | Ga0495602_0367638 | 3300048088 | Bacteria | 1034 |
| 277 | Ga0496101_0001476 | 3300048904 | Bacteria | 14048 |
| 278 | Ga0496101_0122733 | 3300048904 | Bacteria | 1965 |
| 279 | Ga0496101_0788132 | 3300048904 | Bacteria | 750 |
| 280 | Ga0496102_0002454 | 3300048905 | Bacteria | 15827 |
| 281 | Ga0496102_0101866 | 3300048905 | Bacteria | 2669 |
| 282 | Ga0496103_0139623 | 3300048906 | Bacteria | 1549 |
| 283 | Ga0496104_0010331 | 3300048907 | Bacteria | 8336 |
| 284 | Ga0496104_0280105 | 3300048907 | Bacteria | 1580 |
| 285 | Ga0496104_0797845 | 3300048907 | Bacteria | 850 |
| 286 | Ga0496105_0021614 | 3300048908 | Bacteria | 5208 |
| 287 | Ga0496106_0002261 | 3300048909 | Bacteria | 14362 |
| 288 | Ga0496107_0319541 | 3300048910 | Bacteria | 1155 |
| 289 | Ga0496108_0001789 | 3300048911 | Bacteria | 17120 |
| 290 | Ga0496108_0003012 | 3300048911 | Bacteria | 13540 |
| 291 | Ga0496108_0352861 | 3300048911 | Bacteria | 1283 |
| 292 | Ga0496109_0003825 | 3300048912 | Bacteria | 12574 |
| 293 | Ga0496109_0105046 | 3300048912 | Bacteria | 2623 |
| 294 | Ga0496109_0117754 | 3300048912 | Bacteria | 2473 |
| 295 | Ga0496109_0123156 | 3300048912 | Bacteria | 2416 |
| 296 | Ga0496109_0164881 | 3300048912 | Bacteria | 2077 |
| 297 | Ga0496110_0199112 | 3300048913 | Bacteria | 1819 |
| 298 | Ga0496110_0238770 | 3300048913 | Bacteria | 1653 |
| 299 | Ga0496111_0225933 | 3300048914 | Bacteria | 1390 |
| 300 | Ga0496111_0467685 | 3300048914 | Bacteria | 930 |
| 301 | Ga0496113_0009096 | 3300048916 | Bacteria | 6509 |
| 302 | Ga0496113_0346603 | 3300048916 | Bacteria | 1191 |
| 303 | Ga0496114_0002128 | 3300048917 | Bacteria | 15059 |
| 304 | Ga0496114_0003346 | 3300048917 | Bacteria | 12323 |
| 305 | Ga0496114_0028661 | 3300048917 | Bacteria | 4570 |
| 306 | Ga0496114_0058761 | 3300048917 | Bacteria | 3211 |
| 307 | Ga0496114_0150412 | 3300048917 | Bacteria | 2019 |
| 308 | Ga0496114_0301958 | 3300048917 | Bacteria | 1413 |
| 309 | Ga0496115_0001135 | 3300048918 | Bacteria | 19236 |
| 310 | Ga0496115_0028547 | 3300048918 | Bacteria | 4374 |
| 311 | Ga0496115_0255028 | 3300048918 | Bacteria | 1443 |
| 312 | Ga0496121_0179125 | 3300048924 | Bacteria | 1531 |
| 313 | Ga0496124_0243456 | 3300048927 | Bacteria | 1336 |
| 314 | Ga0495601_0201019 | 3300053077 | Bacteria | 1302 |
| 315 | Ga0495595_0292006 | 3300053084 | Bacteria | 819 |
| 316 | Ga0495619_0190856 | 3300053085 | Bacteria | 1418 |
| 317 | Ga0495619_0351517 | 3300053085 | Bacteria | 1020 |
| 318 | Ga0500620_032604 | 3300053155 | Bacteria | 1660 |
| 319 | Ga0466962_0082356 | 3300061719 | Bacteria | 1539 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035695 | Ga0373927_0203866 | Ga0373927_0203866_732_1286 | 178 |
| 2 | 3300035692 | Ga0373935_0175684 | Ga0373935_0175684_52_750 | 187 |
| 3 | 3300037068 | Ga0373925_0266538 | Ga0373925_0266538_520_1218 | 187 |
| 4 | 3300005435 | Ga0070714_100156207 | Ga0070714_1001562072 | 190 |
| 5 | 3300005437 | Ga0070710_10048135 | Ga0070710_100481352 | 190 |
| 6 | 3300006175 | Ga0070712_100066633 | Ga0070712_1000666332 | 190 |
| 7 | 3300025898 | Ga0207692_10265196 | Ga0207692_102651962 | 190 |
| 8 | 3300025915 | Ga0207693_10083077 | Ga0207693_100830772 | 190 |
| 9 | 3300026078 | Ga0207702_10192772 | Ga0207702_101927722 | 190 |
| 10 | 3300046511 | Ga0495608_0235550 | Ga0495608_0235550_420_1085 | 191 |
| 11 | 3300048907 | Ga0496104_0797845 | Ga0496104_0797845_59_700 | 191 |
| 12 | 3300053155 | Ga0500620_032604 | Ga0500620_032604_41_685 | 191 |
| 13 | 3300005530 | Ga0070679_100067235 | Ga0070679_1000672354 | 193 |
| 14 | 3300025921 | Ga0207652_10056706 | Ga0207652_100567062 | 193 |
| 15 | 3300022467 | Ga0224712_10045466 | Ga0224712_100454662 | 195 |
| 16 | 3300039450 | Ga0436363_0675038 | Ga0436363_0675038_158_766 | 196 |
| 17 | 3300044735 | Ga0466968_0250012 | Ga0466968_0250012_50_658 | 196 |
| 18 | 3300045049 | Ga0466959_0046645 | Ga0466959_0046645_1468_2076 | 196 |
| 19 | 3300045836 | Ga0466958_0488249 | Ga0466958_0488249_161_769 | 196 |
| 20 | 3300005546 | Ga0070696_100001701 | Ga0070696_1000017019 | 197 |
| 21 | 3300046678 | Ga0495599_0060826 | Ga0495599_0060826_245_940 | 197 |
| 22 | 3300005530 | Ga0070679_100374265 | Ga0070679_1003742651 | 198 |
| 23 | 3300025928 | Ga0207700_10685567 | Ga0207700_106855672 | 198 |
| 24 | 3300005530 | Ga0070679_100783225 | Ga0070679_1007832251 | 199 |
| 25 | 3300020082 | Ga0206353_10578181 | Ga0206353_105781811 | 199 |
| 26 | 3300022467 | Ga0224712_10117150 | Ga0224712_101171502 | 199 |
| 27 | 3300038443 | Ga0395901_0136927 | Ga0395901_0136927_860_1528 | 199 |
| 28 | 3300045836 | Ga0466958_0372182 | Ga0466958_0372182_220_873 | 199 |
| 29 | 3300005329 | Ga0070683_100330140 | Ga0070683_1003301402 | 200 |
| 30 | 3300005435 | Ga0070714_100258686 | Ga0070714_1002586862 | 200 |
| 31 | 3300005437 | Ga0070710_10295531 | Ga0070710_102955311 | 200 |
| 32 | 3300006028 | Ga0070717_10092656 | Ga0070717_100926562 | 200 |
| 33 | 3300006175 | Ga0070712_100044726 | Ga0070712_1000447262 | 200 |
| 34 | 3300013105 | Ga0157369_10077317 | Ga0157369_100773173 | 200 |
| 35 | 3300020069 | Ga0197907_10550438 | Ga0197907_105504382 | 200 |
| 36 | 3300020070 | Ga0206356_11361686 | Ga0206356_113616862 | 200 |
| 37 | 3300020075 | Ga0206349_1467147 | Ga0206349_14671472 | 200 |
| 38 | 3300020076 | Ga0206355_1497021 | Ga0206355_14970212 | 200 |
| 39 | 3300020077 | Ga0206351_10332717 | Ga0206351_103327172 | 200 |
| 40 | 3300020080 | Ga0206350_10018262 | Ga0206350_100182622 | 200 |
| 41 | 3300020082 | Ga0206353_11356432 | Ga0206353_113564322 | 200 |
| 42 | 3300020610 | Ga0154015_1095088 | Ga0154015_10950882 | 200 |
| 43 | 3300022467 | Ga0224712_10001708 | Ga0224712_100017082 | 200 |
| 44 | 3300025898 | Ga0207692_10148458 | Ga0207692_101484581 | 200 |
| 45 | 3300037853 | Ga0436364_1086226 | Ga0436364_1086226_3505_4149 | 200 |
| 46 | 3300046516 | Ga0495628_0054070 | Ga0495628_0054070_1014_1709 | 200 |
| 47 | 3300046529 | Ga0495652_0142017 | Ga0495652_0142017_701_1396 | 200 |
| 48 | 3300046535 | Ga0495586_0271134 | Ga0495586_0271134_153_848 | 200 |
| 49 | 3300048918 | Ga0496115_0028547 | Ga0496115_0028547_2502_3161 | 200 |
| 50 | 3300005467 | Ga0070706_100791428 | Ga0070706_1007914281 | 203 |
| 51 | 3300005471 | Ga0070698_100013008 | Ga0070698_1000130085 | 203 |
| 52 | 3300005518 | Ga0070699_100334600 | Ga0070699_1003346002 | 203 |
| 53 | 3300006175 | Ga0070712_100446240 | Ga0070712_1004462402 | 203 |
| 54 | 3300025922 | Ga0207646_10159443 | Ga0207646_101594433 | 203 |
| 55 | 3300025928 | Ga0207700_10129304 | Ga0207700_101293043 | 203 |
| 56 | 3300031018 | Ga0265773_1000833 | Ga0265773_10008332 | 203 |
| 57 | 3300035111 | Ga0373923_0025534 | Ga0373923_0025534_1465_2112 | 203 |
| 58 | 3300035410 | Ga0373924_0024845 | Ga0373924_0024845_287_934 | 203 |
| 59 | 3300039437 | Ga0436365_0066733 | Ga0436365_0066733_937_1608 | 203 |
| 60 | 3300046462 | Ga0495651_0311972 | Ga0495651_0311972_115_762 | 203 |
| 61 | 3300046463 | Ga0495653_0065801 | Ga0495653_0065801_1304_1951 | 203 |
| 62 | 3300046477 | Ga0495664_0198036 | Ga0495664_0198036_199_846 | 203 |
| 63 | 3300046514 | Ga0495618_0040911 | Ga0495618_0040911_514_1161 | 203 |
| 64 | 3300046529 | Ga0495652_0044788 | Ga0495652_0044788_249_896 | 203 |
| 65 | 3300046533 | Ga0495640_0168065 | Ga0495640_0168065_52_699 | 203 |
| 66 | 3300046535 | Ga0495586_0048628 | Ga0495586_0048628_1192_1839 | 203 |
| 67 | 3300046536 | Ga0495587_0023610 | Ga0495587_0023610_256_903 | 203 |
| 68 | 3300046642 | Ga0495634_0019436 | Ga0495634_0019436_2618_3265 | 203 |
| 69 | 3300046663 | Ga0495635_0022316 | Ga0495635_0022316_2171_2818 | 203 |
| 70 | 3300046689 | Ga0495613_0147966 | Ga0495613_0147966_608_1255 | 203 |
| 71 | 3300046809 | Ga0495600_0220447 | Ga0495600_0220447_315_962 | 203 |
| 72 | 3300047317 | Ga0495604_0139759 | Ga0495604_0139759_854_1501 | 203 |
| 73 | 3300047321 | Ga0495676_0058270 | Ga0495676_0058270_2028_2675 | 203 |
| 74 | 3300047444 | Ga0495675_0052468 | Ga0495675_0052468_85_735 | 203 |
| 75 | 3300053077 | Ga0495601_0201019 | Ga0495601_0201019_549_1196 | 203 |
| 76 | 3300053084 | Ga0495595_0292006 | Ga0495595_0292006_14_661 | 203 |
| 77 | 3300053085 | Ga0495619_0190856 | Ga0495619_0190856_336_983 | 203 |
| 78 | 3300061719 | Ga0466962_0082356 | Ga0466962_0082356_494_1180 | 204 |
| 79 | 3300044684 | Ga0466966_0198537 | Ga0466966_0198537_328_1029 | 205 |
| 80 | 3300044694 | Ga0466963_0304177 | Ga0466963_0304177_393_1094 | 205 |
| 81 | 3300045049 | Ga0466959_0114010 | Ga0466959_0114010_714_1415 | 205 |
| 82 | 3300005436 | Ga0070713_100304320 | Ga0070713_1003043202 | 206 |
| 83 | 3300006028 | Ga0070717_10331532 | Ga0070717_103315322 | 206 |
| 84 | 3300006173 | Ga0070716_100030949 | Ga0070716_1000309492 | 206 |
| 85 | 3300006175 | Ga0070712_100208028 | Ga0070712_1002080282 | 206 |
| 86 | 3300025898 | Ga0207692_10007687 | Ga0207692_100076872 | 206 |
| 87 | 3300025906 | Ga0207699_10015749 | Ga0207699_100157493 | 206 |
| 88 | 3300025915 | Ga0207693_10226646 | Ga0207693_102266462 | 206 |
| 89 | 3300025916 | Ga0207663_10219474 | Ga0207663_102194742 | 206 |
| 90 | 3300025928 | Ga0207700_10227756 | Ga0207700_102277562 | 206 |
| 91 | 3300025929 | Ga0207664_10297305 | Ga0207664_102973052 | 206 |
| 92 | 3300025939 | Ga0207665_10094130 | Ga0207665_100941302 | 206 |
| 93 | 3300044694 | Ga0466963_0064141 | Ga0466963_0064141_957_1646 | 206 |
| 94 | 3300005437 | Ga0070710_10266266 | Ga0070710_102662661 | 207 |
| 95 | 3300006175 | Ga0070712_100331103 | Ga0070712_1003311032 | 207 |
| 96 | 3300025898 | Ga0207692_10039417 | Ga0207692_100394174 | 207 |
| 97 | 3300025915 | Ga0207693_10057726 | Ga0207693_100577264 | 207 |
| 98 | 3300044693 | Ga0466961_0005645 | Ga0466961_0005645_5844_6599 | 207 |
| 99 | 3300044901 | Ga0466960_0056517 | Ga0466960_0056517_1030_1656 | 207 |
| 100 | 3300045836 | Ga0466958_0080231 | Ga0466958_0080231_944_1699 | 207 |
| 101 | 3300045976 | Ga0466967_0122457 | Ga0466967_0122457_13_639 | 207 |
| 102 | 3300022467 | Ga0224712_10013729 | Ga0224712_100137292 | 208 |
| 103 | 3300044656 | Ga0466969_0017641 | Ga0466969_0017641_1485_2294 | 209 |
| 104 | 3300044693 | Ga0466961_0020895 | Ga0466961_0020895_640_1449 | 209 |
| 105 | 3300044765 | Ga0466970_0012673 | Ga0466970_0012673_2142_2951 | 209 |
| 106 | 3300045976 | Ga0466967_0306072 | Ga0466967_0306072_135_860 | 209 |
| 107 | 3300005539 | Ga0068853_100239968 | Ga0068853_1002399682 | 210 |
| 108 | 3300005563 | Ga0068855_100010827 | Ga0068855_1000108276 | 210 |
| 109 | 3300005578 | Ga0068854_100013004 | Ga0068854_1000130043 | 210 |
| 110 | 3300009093 | Ga0105240_10040140 | Ga0105240_100401403 | 210 |
| 111 | 3300009174 | Ga0105241_10005186 | Ga0105241_100051863 | 210 |
| 112 | 3300009551 | Ga0105238_10070999 | Ga0105238_100709993 | 210 |
| 113 | 3300022467 | Ga0224712_10018506 | Ga0224712_100185063 | 210 |
| 114 | 3300025904 | Ga0207647_10004421 | Ga0207647_100044215 | 210 |
| 115 | 3300025911 | Ga0207654_10017964 | Ga0207654_100179643 | 210 |
| 116 | 3300025913 | Ga0207695_10005844 | Ga0207695_1000584412 | 210 |
| 117 | 3300025914 | Ga0207671_10000421 | Ga0207671_100004217 | 210 |
| 118 | 3300025924 | Ga0207694_10059440 | Ga0207694_100594402 | 210 |
| 119 | 3300025949 | Ga0207667_10029752 | Ga0207667_100297523 | 210 |
| 120 | 3300025981 | Ga0207640_10043927 | Ga0207640_100439273 | 210 |
| 121 | 3300026142 | Ga0207698_10125911 | Ga0207698_101259112 | 210 |
| 122 | 3300028379 | Ga0268266_10219967 | Ga0268266_102199673 | 210 |
| 123 | iso_pu_bacteria | 2675902999 | 2676201975 | 210 |
| 124 | iso_pu_bacteria | 2773857921 | 2774846551 | 210 |
| 125 | iso_pu_bacteria | 2811994882 | 2812372788 | 210 |
| 126 | iso_pu_bacteria | 2818991462 | 2819689689 | 210 |
| 127 | iso_pu_bacteria | 2818991469 | 2819726756 | 210 |
| 128 | 3300013104 | Ga0157370_10239735 | Ga0157370_102397352 | 211 |
| 129 | 3300045049 | Ga0466959_0039279 | Ga0466959_0039279_2442_3089 | 211 |
| 130 | iso_pu_bacteria | 2902837492 | 2902840397 | 211 |
| 131 | 3300005327 | Ga0070658_10000321 | Ga0070658_1000032115 | 212 |
| 132 | 3300005563 | Ga0068855_100015844 | Ga0068855_1000158446 | 212 |
| 133 | 3300020069 | Ga0197907_10131703 | Ga0197907_101317031 | 212 |
| 134 | 3300020077 | Ga0206351_10602002 | Ga0206351_106020024 | 212 |
| 135 | 3300020080 | Ga0206350_10382195 | Ga0206350_103821952 | 212 |
| 136 | 3300020080 | Ga0206350_10656528 | Ga0206350_106565282 | 212 |
| 137 | 3300020080 | Ga0206350_10668316 | Ga0206350_106683162 | 212 |
| 138 | 3300020610 | Ga0154015_1200931 | Ga0154015_12009312 | 212 |
| 139 | 3300020610 | Ga0154015_1420689 | Ga0154015_14206893 | 212 |
| 140 | 3300025909 | Ga0207705_10005023 | Ga0207705_100050232 | 212 |
| 141 | 3300025913 | Ga0207695_10178532 | Ga0207695_101785322 | 212 |
| 142 | 3300025949 | Ga0207667_10015432 | Ga0207667_100154327 | 212 |
| 143 | 3300005327 | Ga0070658_10332330 | Ga0070658_103323302 | 214 |
| 144 | 3300005335 | Ga0070666_10368720 | Ga0070666_103687201 | 214 |
| 145 | 3300005337 | Ga0070682_100001487 | Ga0070682_1000014873 | 214 |
| 146 | 3300005338 | Ga0068868_100186317 | Ga0068868_1001863172 | 214 |
| 147 | 3300005345 | Ga0070692_10255506 | Ga0070692_102555061 | 214 |
| 148 | 3300005355 | Ga0070671_100104338 | Ga0070671_1001043382 | 214 |
| 149 | 3300005367 | Ga0070667_100342735 | Ga0070667_1003427352 | 214 |
| 150 | 3300005435 | Ga0070714_100000014 | Ga0070714_100000014160 | 214 |
| 151 | 3300005455 | Ga0070663_100032959 | Ga0070663_1000329593 | 214 |
| 152 | 3300005456 | Ga0070678_100145724 | Ga0070678_1001457242 | 214 |
| 153 | 3300005459 | Ga0068867_100068492 | Ga0068867_1000684922 | 214 |
| 154 | 3300005530 | Ga0070679_100233710 | Ga0070679_1002337102 | 214 |
| 155 | 3300005530 | Ga0070679_100897204 | Ga0070679_1008972041 | 214 |
| 156 | 3300005535 | Ga0070684_100695383 | Ga0070684_1006953831 | 214 |
| 157 | 3300005563 | Ga0068855_100132762 | Ga0068855_1001327622 | 214 |
| 158 | 3300005615 | Ga0070702_100072090 | Ga0070702_1000720902 | 214 |
| 159 | 3300005616 | Ga0068852_100040241 | Ga0068852_1000402414 | 214 |
| 160 | 3300005718 | Ga0068866_10003522 | Ga0068866_100035227 | 214 |
| 161 | 3300005840 | Ga0068870_10178610 | Ga0068870_101786102 | 214 |
| 162 | 3300005841 | Ga0068863_100239345 | Ga0068863_1002393452 | 214 |
| 163 | 3300005841 | Ga0068863_100638097 | Ga0068863_1006380972 | 214 |
| 164 | 3300005842 | Ga0068858_100235689 | Ga0068858_1002356893 | 214 |
| 165 | 3300006163 | Ga0070715_10295386 | Ga0070715_102953862 | 214 |
| 166 | 3300006358 | Ga0068871_100526036 | Ga0068871_1005260362 | 214 |
| 167 | 3300006881 | Ga0068865_100035429 | Ga0068865_1000354292 | 214 |
| 168 | 3300009093 | Ga0105240_10026928 | Ga0105240_100269287 | 214 |
| 169 | 3300009093 | Ga0105240_10542561 | Ga0105240_105425612 | 214 |
| 170 | 3300009098 | Ga0105245_10002198 | Ga0105245_100021987 | 214 |
| 171 | 3300009174 | Ga0105241_10107366 | Ga0105241_101073662 | 214 |
| 172 | 3300009545 | Ga0105237_10268238 | Ga0105237_102682382 | 214 |
| 173 | 3300009551 | Ga0105238_10057205 | Ga0105238_100572052 | 214 |
| 174 | 3300009551 | Ga0105238_10128892 | Ga0105238_101288922 | 214 |
| 175 | 3300009553 | Ga0105249_10608669 | Ga0105249_106086692 | 214 |
| 176 | 3300010375 | Ga0105239_10348216 | Ga0105239_103482162 | 214 |
| 177 | 3300011119 | Ga0105246_10125206 | Ga0105246_101252062 | 214 |
| 178 | 3300013104 | Ga0157370_10004063 | Ga0157370_100040635 | 214 |
| 179 | 3300013104 | Ga0157370_10264514 | Ga0157370_102645143 | 214 |
| 180 | 3300013105 | Ga0157369_10014211 | Ga0157369_100142114 | 214 |
| 181 | 3300013105 | Ga0157369_10036203 | Ga0157369_100362038 | 214 |
| 182 | 3300013105 | Ga0157369_10622257 | Ga0157369_106222572 | 214 |
| 183 | 3300013296 | Ga0157374_10124956 | Ga0157374_101249563 | 214 |
| 184 | 3300013296 | Ga0157374_10244474 | Ga0157374_102444742 | 214 |
| 185 | 3300013297 | Ga0157378_10235045 | Ga0157378_102350453 | 214 |
| 186 | 3300013306 | Ga0163162_10510093 | Ga0163162_105100932 | 214 |
| 187 | 3300013307 | Ga0157372_10000006 | Ga0157372_1000000652 | 214 |
| 188 | 3300013307 | Ga0157372_10613647 | Ga0157372_106136472 | 214 |
| 189 | 3300014326 | Ga0157380_10037106 | Ga0157380_100371064 | 214 |
| 190 | 3300014968 | Ga0157379_10325541 | Ga0157379_103255412 | 214 |
| 191 | 3300014969 | Ga0157376_10493775 | Ga0157376_104937752 | 214 |
| 192 | 3300014969 | Ga0157376_10802803 | Ga0157376_108028032 | 214 |
| 193 | 3300020070 | Ga0206356_10377962 | Ga0206356_103779622 | 214 |
| 194 | 3300020080 | Ga0206350_11338705 | Ga0206350_113387052 | 214 |
| 195 | 3300020082 | Ga0206353_10412565 | Ga0206353_1041256511 | 214 |
| 196 | 3300022467 | Ga0224712_10043910 | Ga0224712_100439102 | 214 |
| 197 | 3300025898 | Ga0207692_10127291 | Ga0207692_101272912 | 214 |
| 198 | 3300025899 | Ga0207642_10020288 | Ga0207642_100202882 | 214 |
| 199 | 3300025900 | Ga0207710_10031860 | Ga0207710_100318602 | 214 |
| 200 | 3300025901 | Ga0207688_10022810 | Ga0207688_100228102 | 214 |
| 201 | 3300025903 | Ga0207680_10006628 | Ga0207680_100066286 | 214 |
| 202 | 3300025913 | Ga0207695_10153632 | Ga0207695_101536322 | 214 |
| 203 | 3300025918 | Ga0207662_10001273 | Ga0207662_1000127314 | 214 |
| 204 | 3300025919 | Ga0207657_10433764 | Ga0207657_104337642 | 214 |
| 205 | 3300025921 | Ga0207652_10090169 | Ga0207652_100901692 | 214 |
| 206 | 3300025921 | Ga0207652_10275735 | Ga0207652_102757352 | 214 |
| 207 | 3300025921 | Ga0207652_10539561 | Ga0207652_105395612 | 214 |
| 208 | 3300025924 | Ga0207694_10097951 | Ga0207694_100979512 | 214 |
| 209 | 3300025927 | Ga0207687_10000303 | Ga0207687_1000030331 | 214 |
| 210 | 3300025929 | Ga0207664_10000001 | Ga0207664_10000001198 | 214 |
| 211 | 3300025934 | Ga0207686_10001214 | Ga0207686_1000121413 | 214 |
| 212 | 3300025936 | Ga0207670_10043650 | Ga0207670_100436502 | 214 |
| 213 | 3300025937 | Ga0207669_10000848 | Ga0207669_100008482 | 214 |
| 214 | 3300025942 | Ga0207689_10024178 | Ga0207689_100241783 | 214 |
| 215 | 3300025949 | Ga0207667_10098932 | Ga0207667_100989323 | 214 |
| 216 | 3300025972 | Ga0207668_10050182 | Ga0207668_100501823 | 214 |
| 217 | 3300025986 | Ga0207658_10413373 | Ga0207658_104133732 | 214 |
| 218 | 3300026023 | Ga0207677_10196085 | Ga0207677_101960852 | 214 |
| 219 | 3300026035 | Ga0207703_10100610 | Ga0207703_101006102 | 214 |
| 220 | 3300026088 | Ga0207641_10486897 | Ga0207641_104868972 | 214 |
| 221 | 3300026089 | Ga0207648_10004258 | Ga0207648_100042583 | 214 |
| 222 | 3300026095 | Ga0207676_10369498 | Ga0207676_103694982 | 214 |
| 223 | 3300026118 | Ga0207675_100285487 | Ga0207675_1002854873 | 214 |
| 224 | 3300026121 | Ga0207683_10089428 | Ga0207683_100894283 | 214 |
| 225 | 3300026121 | Ga0207683_10148926 | Ga0207683_101489263 | 214 |
| 226 | 3300035691 | Ga0373931_0185104 | Ga0373931_0185104_480_1214 | 214 |
| 227 | 3300037312 | Ga0395899_0051490 | Ga0395899_0051490_306_1022 | 214 |
| 228 | 3300037418 | Ga0395900_0192447 | Ga0395900_0192447_993_1709 | 214 |
| 229 | 3300037466 | Ga0395898_0216952 | Ga0395898_0216952_780_1496 | 214 |
| 230 | 3300038443 | Ga0395901_0098003 | Ga0395901_0098003_393_1124 | 214 |
| 231 | 3300038443 | Ga0395901_0779981 | Ga0395901_0779981_216_932 | 214 |
| 232 | 3300041443 | Ga0451789_0097158 | Ga0451789_0097158_184_918 | 214 |
| 233 | 3300041452 | Ga0451793_0173599 | Ga0451793_0173599_749_1483 | 214 |
| 234 | 3300041452 | Ga0451793_1814972 | Ga0451793_1814972_480_1214 | 214 |
| 235 | 3300041498 | Ga0451841_0658615 | Ga0451841_0658615_677_1411 | 214 |
| 236 | 3300041512 | Ga0451853_2641902 | Ga0451853_2641902_297_1031 | 214 |
| 237 | 3300044684 | Ga0466966_0057780 | Ga0466966_0057780_1080_1793 | 214 |
| 238 | 3300044684 | Ga0466966_0245975 | Ga0466966_0245975_76_786 | 214 |
| 239 | 3300044693 | Ga0466961_0047969 | Ga0466961_0047969_1168_1881 | 214 |
| 240 | 3300044693 | Ga0466961_0130488 | Ga0466961_0130488_371_1084 | 214 |
| 241 | 3300044694 | Ga0466963_0289948 | Ga0466963_0289948_303_1034 | 214 |
| 242 | 3300044706 | Ga0466964_0171839 | Ga0466964_0171839_102_833 | 214 |
| 243 | 3300044719 | Ga0466971_0058481 | Ga0466971_0058481_748_1479 | 214 |
| 244 | 3300044735 | Ga0466968_0221336 | Ga0466968_0221336_74_766 | 214 |
| 245 | 3300044901 | Ga0466960_0012969 | Ga0466960_0012969_1291_2022 | 214 |
| 246 | 3300044901 | Ga0466960_0090058 | Ga0466960_0090058_179_898 | 214 |
| 247 | 3300045049 | Ga0466959_0054115 | Ga0466959_0054115_15_728 | 214 |
| 248 | 3300045049 | Ga0466959_0215117 | Ga0466959_0215117_282_1013 | 214 |
| 249 | 3300045049 | Ga0466959_0342789 | Ga0466959_0342789_151_873 | 214 |
| 250 | 3300045836 | Ga0466958_0103327 | Ga0466958_0103327_303_1034 | 214 |
| 251 | 3300046531 | Ga0495665_0093638 | Ga0495665_0093638_735_1469 | 214 |
| 252 | 3300046663 | Ga0495635_0223765 | Ga0495635_0223765_296_1030 | 214 |
| 253 | 3300046675 | Ga0495657_0266125 | Ga0495657_0266125_207_941 | 214 |
| 254 | 3300046679 | Ga0495623_0206990 | Ga0495623_0206990_25_759 | 214 |
| 255 | 3300046690 | Ga0495624_0244649 | Ga0495624_0244649_100_834 | 214 |
| 256 | 3300047317 | Ga0495604_0114053 | Ga0495604_0114053_1056_1790 | 214 |
| 257 | 3300047321 | Ga0495676_0120045 | Ga0495676_0120045_977_1711 | 214 |
| 258 | 3300048088 | Ga0495602_0367638 | Ga0495602_0367638_196_930 | 214 |
| 259 | 3300048904 | Ga0496101_0001476 | Ga0496101_0001476_11188_11922 | 214 |
| 260 | 3300048904 | Ga0496101_0122733 | Ga0496101_0122733_591_1325 | 214 |
| 261 | 3300048904 | Ga0496101_0788132 | Ga0496101_0788132_14_682 | 214 |
| 262 | 3300048905 | Ga0496102_0002454 | Ga0496102_0002454_792_1526 | 214 |
| 263 | 3300048905 | Ga0496102_0101866 | Ga0496102_0101866_1158_1823 | 214 |
| 264 | 3300048907 | Ga0496104_0010331 | Ga0496104_0010331_336_1070 | 214 |
| 265 | 3300048907 | Ga0496104_0280105 | Ga0496104_0280105_531_1265 | 214 |
| 266 | 3300048908 | Ga0496105_0021614 | Ga0496105_0021614_2618_3352 | 214 |
| 267 | 3300048909 | Ga0496106_0002261 | Ga0496106_0002261_4224_4958 | 214 |
| 268 | 3300048910 | Ga0496107_0319541 | Ga0496107_0319541_240_974 | 214 |
| 269 | 3300048911 | Ga0496108_0001789 | Ga0496108_0001789_13791_14525 | 214 |
| 270 | 3300048911 | Ga0496108_0003012 | Ga0496108_0003012_1681_2415 | 214 |
| 271 | 3300048911 | Ga0496108_0352861 | Ga0496108_0352861_73_807 | 214 |
| 272 | 3300048912 | Ga0496109_0003825 | Ga0496109_0003825_1986_2720 | 214 |
| 273 | 3300048912 | Ga0496109_0105046 | Ga0496109_0105046_1895_2608 | 214 |
| 274 | 3300048912 | Ga0496109_0117754 | Ga0496109_0117754_517_1215 | 214 |
| 275 | 3300048912 | Ga0496109_0123156 | Ga0496109_0123156_241_975 | 214 |
| 276 | 3300048912 | Ga0496109_0164881 | Ga0496109_0164881_975_1709 | 214 |
| 277 | 3300048913 | Ga0496110_0199112 | Ga0496110_0199112_333_1067 | 214 |
| 278 | 3300048913 | Ga0496110_0238770 | Ga0496110_0238770_791_1525 | 214 |
| 279 | 3300048914 | Ga0496111_0225933 | Ga0496111_0225933_398_1132 | 214 |
| 280 | 3300048914 | Ga0496111_0467685 | Ga0496111_0467685_138_848 | 214 |
| 281 | 3300048916 | Ga0496113_0009096 | Ga0496113_0009096_1800_2498 | 214 |
| 282 | 3300048916 | Ga0496113_0346603 | Ga0496113_0346603_148_882 | 214 |
| 283 | 3300048917 | Ga0496114_0002128 | Ga0496114_0002128_13500_14234 | 214 |
| 284 | 3300048917 | Ga0496114_0003346 | Ga0496114_0003346_3023_3757 | 214 |
| 285 | 3300048917 | Ga0496114_0028661 | Ga0496114_0028661_1458_2192 | 214 |
| 286 | 3300048917 | Ga0496114_0058761 | Ga0496114_0058761_409_1134 | 214 |
| 287 | 3300048917 | Ga0496114_0150412 | Ga0496114_0150412_1183_1851 | 214 |
| 288 | 3300048917 | Ga0496114_0301958 | Ga0496114_0301958_288_1022 | 214 |
| 289 | 3300048918 | Ga0496115_0001135 | Ga0496115_0001135_7178_7912 | 214 |
| 290 | 3300048918 | Ga0496115_0255028 | Ga0496115_0255028_411_1145 | 214 |
| 291 | 3300048924 | Ga0496121_0179125 | Ga0496121_0179125_697_1407 | 214 |
| 292 | 3300053085 | Ga0495619_0351517 | Ga0495619_0351517_175_909 | 214 |
| 293 | 3300003323 | rootH1_10273004 | rootH1_102730043 | 215 |
| 294 | 3300005335 | Ga0070666_10010762 | Ga0070666_100107622 | 215 |
| 295 | 3300005347 | Ga0070668_100132694 | Ga0070668_1001326943 | 215 |
| 296 | 3300005355 | Ga0070671_100067905 | Ga0070671_1000679053 | 215 |
| 297 | 3300005367 | Ga0070667_100119657 | Ga0070667_1001196572 | 215 |
| 298 | 3300005548 | Ga0070665_100016290 | Ga0070665_1000162904 | 215 |
| 299 | 3300005614 | Ga0068856_100620712 | Ga0068856_1006207122 | 215 |
| 300 | 3300005618 | Ga0068864_100878607 | Ga0068864_1008786071 | 215 |
| 301 | 3300005841 | Ga0068863_100021429 | Ga0068863_1000214294 | 215 |
| 302 | 3300005842 | Ga0068858_100394182 | Ga0068858_1003941822 | 215 |
| 303 | 3300005843 | Ga0068860_100005253 | Ga0068860_1000052534 | 215 |
| 304 | 3300009177 | Ga0105248_10276961 | Ga0105248_102769612 | 215 |
| 305 | 3300025903 | Ga0207680_10010310 | Ga0207680_100103104 | 215 |
| 306 | 3300025925 | Ga0207650_10444960 | Ga0207650_104449602 | 215 |
| 307 | 3300025941 | Ga0207711_10257356 | Ga0207711_102573562 | 215 |
| 308 | 3300025972 | Ga0207668_10110786 | Ga0207668_101107863 | 215 |
| 309 | 3300025986 | Ga0207658_10096167 | Ga0207658_100961673 | 215 |
| 310 | 3300026035 | Ga0207703_10025704 | Ga0207703_100257042 | 215 |
| 311 | 3300026088 | Ga0207641_10018644 | Ga0207641_100186443 | 215 |
| 312 | 3300028379 | Ga0268266_10008877 | Ga0268266_100088774 | 215 |
| 313 | 3300028381 | Ga0268264_10007512 | Ga0268264_100075124 | 215 |
| 314 | 3300044684 | Ga0466966_0085813 | Ga0466966_0085813_352_1104 | 215 |
| 315 | 3300044684 | Ga0466966_0149245 | Ga0466966_0149245_142_879 | 215 |
| 316 | 3300044693 | Ga0466961_0179418 | Ga0466961_0179418_265_1017 | 215 |
| 317 | 3300044694 | Ga0466963_0152656 | Ga0466963_0152656_159_896 | 215 |
| 318 | 3300044765 | Ga0466970_0023133 | Ga0466970_0023133_1441_2178 | 215 |
| 319 | 3300044765 | Ga0466970_0180198 | Ga0466970_0180198_259_1011 | 215 |
| 320 | 3300044842 | Ga0466957_0214217 | Ga0466957_0214217_372_1109 | 215 |
| 321 | 3300045049 | Ga0466959_0058115 | Ga0466959_0058115_1305_2057 | 215 |
| 322 | 3300045049 | Ga0466959_0075373 | Ga0466959_0075373_136_873 | 215 |
| 323 | 3300045836 | Ga0466958_0148021 | Ga0466958_0148021_386_1123 | 215 |
| 324 | 3300048906 | Ga0496103_0139623 | Ga0496103_0139623_228_968 | 215 |
| 325 | 3300048927 | Ga0496124_0243456 | Ga0496124_0243456_292_993 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hyb-assembly1.cif.gz_B | crystal structure of myristoylated y81a mutant mmtv matrix protein | 0.3135 | 53 | 166 |
| 1ks9-assembly1.cif.gz_A | ketopantoate reductase from escherichia coli | 0.3094 | 54 | 167 |
| 5hyb-assembly1.cif.gz_B | crystal structure of myristoylated y81a mutant mmtv matrix protein | 0.2999 | 53 | 166 |
| 3ge4-assembly1.cif.gz_E | crystal structure of ferritin:dna-binding protein dps from brucella melitensis | 0.2968 | 55 | 171 |
| 8bgw-assembly1.cif.gz_B | cryoem structure of quinol-dependent nitric oxide reductase (qnor) from alcaligenes xylosoxidans at 2.2 a resolution | 0.2923 | 24 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q96LL9_48_122_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.411 | 118 | 185 | 1.10.287.110 |
| af_Q96LL9_48_122_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.3734 | 118 | 185 | 1.10.287.110 |
| af_O60437_25_130_1.20.58.60 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.3458 | 24 | 177 | 1.20.58.60 |
| af_I1KNZ9_171_268_1.20.58.160 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.3317 | 50 | 179 | 1.20.58.160 |
| af_Q9VNU2_20_247_1.20.144.10 | Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase | 0.3228 | 50 | 193 | 1.20.144.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E3J8I2-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 | 0.9454 | 1 | 204 |
|
| AF-A0A0F2THQ6-F1-model_v4 | Gluconate 2-dehydrogenase | 0.9158 | 15 | 207 |
|
| AF-A0A1M3EPB3-F1-model_v4 | Gluconate 2-dehydrogenase | 0.9127 | 1 | 214 |
|
| AF-A0A1M3EPB3-F1-model_v4 | Gluconate 2-dehydrogenase | 0.9005 | 1 | 214 |
|
| AF-A0A838SNJ8-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.8952 | 3 | 209 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar