F407938

General Info

Members Datasets Scaffolds Average Seq Length
325 211 319 166

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_253344|Ga0400483_253344_707_1291
Length 194
Sequence MYLAEETFEKADFSQDPLKMGEYEKGERWHMITMRLFKEQDWIAVWQIIAPVFRAGETYAFSPDITRDESRKVWIETPSATFVAMDDNDRILGTYYIKPNQPALGAHVCNCGYIVSEDARGLGVASAMCEHSQREAVSRGFRSMQYNLVVSTNDVAVRLWQKHGFEIVGKLPEAFQHPTLGFQDAFVMYKQLVT

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
3 2885198086 Variovorax sp. 679 Isolate Unclassified
4 2885211737 Variovorax sp. 553 Isolate Unclassified
5 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
6 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
7 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
115 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
126 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
127 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
134 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
137 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
138 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
181 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
182 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
183 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
184 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
185 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
186 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
187 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
190 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
191 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
192 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
193 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
194 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
195 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
196 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
197 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
198 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
199 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
202 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
205 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
206 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
207 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
208 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
209 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
210 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 0
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 39.38
Nodule 0.62
Rhizoplane 0.62
Rhizosphere 48.92
Stem 0
Stem Tuber 0
Unclassified 10.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1004178 3300000532 Bacteria 935
2 JGI24740J21852_10017643 3300001979 Bacteria 2547
3 JGI24739J22299_10088820 3300001989 Bacteria 943
4 JGI25155J39150_1000086 3300002704 Bacteria 52913
5 JGI25156J39149_1000111 3300002705 Bacteria 59224
6 JGI25154J39366_1000134 3300002738 Bacteria 58169
7 JGI25157J39369_1000152 3300002741 Bacteria 58260
8 JGI25150J39212_1005943 3300002774 Bacteria 2564
9 JGI25150J39212_1012138 3300002774 Bacteria 1535
10 JGI25159J45721_1001476 3300002987 Bacteria 9701
11 JGI25159J45721_1001834 3300002987 Bacteria 8497
12 JGI25151J46595_10006321 3300003187 Bacteria 5970
13 JGI25151J46595_10006979 3300003187 Bacteria 5592
14 JGI25151J46595_10073551 3300003187 Bacteria 1022
15 JGI25160J50197_1002492 3300003354 Bacteria 8556
16 JGI25161J50226_1000109 3300003374 Bacteria 64835
17 JGI25161J50226_1002903 3300003374 Bacteria 4165
18 Ga0055542_1000109 3300003762 Bacteria 111107
19 Ga0055526_1003708 3300003771 Bacteria 9545
20 Ga0055537_1000086 3300003773 Bacteria 67416
21 Ga0055524_1000093 3300003775 Bacteria 111953
22 Ga0055524_1000194 3300003775 Bacteria 66522
23 Ga0055534_1000938 3300003784 Bacteria 13004
24 Ga0055534_1007750 3300003784 Bacteria 2515
25 Ga0055528_1000961 3300003790 Bacteria 19107
26 Ga0055530_10000541 3300003791 Bacteria 32834
27 Ga0055530_10041611 3300003791 Bacteria 1120
28 Ga0055530_10043510 3300003791 Bacteria 1082
29 Ga0055530_10043874 3300003791 Bacteria 1076
30 Ga0055530_10048422 3300003791 Bacteria 998
31 Ga0055540_1000089 3300003792 Bacteria 100214
32 Ga0055531_10013404 3300003794 Bacteria 3778
33 Ga0055531_10041930 3300003794 Bacteria 1317
34 Ga0055543_1003541 3300004625 Bacteria 4539
35 Ga0055543_1006769 3300004625 Bacteria 2729
36 Ga0065165_1015950 3300005262 Bacteria 2839
37 Ga0065165_1016740 3300005262 Bacteria 2732
38 Ga0065165_1024279 3300005262 Bacteria 2039
39 Ga0065165_1027754 3300005262 Bacteria 1838
40 Ga0068869_100061143 3300005334 Bacteria 2762
41 Ga0070668_100072322 3300005347 Bacteria 2687
42 Ga0070668_100317342 3300005347 Bacteria 1311
43 Ga0070701_10102290 3300005438 Bacteria 1589
44 Ga0070663_100622677 3300005455 Bacteria 910
45 Ga0068867_100595848 3300005459 Bacteria 963
46 Ga0068867_100936144 3300005459 Unclassified 782
47 Ga0070698_100484702 3300005471 Bacteria 1174
48 Ga0068853_100017819 3300005539 Bacteria 5865
49 Ga0068853_100024536 3300005539 Bacteria 5057
50 Ga0068853_101054504 3300005539 Unclassified 783
51 Ga0070665_100005322 3300005548 Bacteria 13294
52 Ga0070665_100448846 3300005548 Bacteria 1299
53 Ga0068855_100164520 3300005563 Bacteria 2516
54 Ga0068859_100109911 3300005617 Bacteria 2818
55 Ga0068861_100539975 3300005719 Bacteria 1060
56 Ga0068851_10654227 3300005834 Unclassified 643
57 Ga0068860_100053466 3300005843 Bacteria 3840
58 Ga0068860_100342904 3300005843 Bacteria 1469
59 Ga0068862_100216989 3300005844 Bacteria 1731
60 Ga0081455_10276903 3300005937 Archaea 1214
61 Ga0070717_10721809 3300006028 Bacteria 906
62 Ga0075365_10209031 3300006038 Bacteria 1368
63 Ga0075363_100120609 3300006048 Bacteria 1464
64 Ga0075363_100131945 3300006048 Bacteria 1401
65 Ga0075369_10048385 3300006186 Bacteria 1835
66 Ga0075366_10218259 3300006195 Bacteria 1162
67 Ga0075366_10418330 3300006195 Bacteria 825
68 Ga0075370_10064879 3300006353 Bacteria 2083
69 Ga0097620_100109907 3300006931 Bacteria 2818
70 Ga0099826_10171534 3300006948 Bacteria 1217
71 Ga0075435_100397324 3300007076 Bacteria 1185
72 Ga0099794_10107721 3300007265 Bacteria 1394
73 Ga0099795_10078090 3300007788 Bacteria 1262
74 Ga0105244_10207488 3300009036 Bacteria 922
75 Ga0111539_11460175 3300009094 Unclassified 793
76 Ga0105247_10280928 3300009101 Bacteria 1148
77 Ga0105243_10367725 3300009148 Bacteria 1326
78 Ga0105248_10422693 3300009177 Bacteria 1501
79 Ga0105238_10111626 3300009551 Bacteria 2714
80 Ga0105249_11416788 3300009553 Bacteria 767
81 Ga0105249_11495051 3300009553 Bacteria 748
82 Ga0105239_10382391 3300010375 Unclassified 1591
83 Ga0105239_10723558 3300010375 Bacteria 1139
84 Ga0157378_10185209 3300013297 Bacteria 1961
85 Ga0163162_10187254 3300013306 Bacteria 2197
86 Ga0182008_10000163 3300014497 Bacteria 52248
87 Ga0157379_10074364 3300014968 Bacteria 3042
88 Ga0157379_10123157 3300014968 Bacteria 2333
89 Ga0157376_10079749 3300014969 Bacteria 2807
90 Ga0182005_1065627 3300015265 Bacteria 994
91 Ga0163161_10050573 3300017792 Bacteria 3008
92 Ga0209435_100014 3300025206 Bacteria 322129
93 Ga0209436_116935 3300025208 Bacteria 1079
94 Ga0209672_100871 3300025228 Bacteria 13813
95 Ga0209147_104091 3300025229 Bacteria 2543
96 Ga0209258_100048 3300025242 Bacteria 365881
97 Ga0207425_1004810 3300025245 Bacteria 3969
98 Ga0207425_1013606 3300025245 Bacteria 1873
99 Ga0209646_1000001 3300025246 Bacteria 3092932
100 Ga0209026_1000137 3300025250 Bacteria 116282
101 Ga0209148_1000040 3300025254 Bacteria 473531
102 Ga0209759_1000013 3300025256 Bacteria 399300
103 Ga0209565_1000028 3300025263 Bacteria 348536
104 Ga0209565_1002390 3300025263 Bacteria 6812
105 Ga0209565_1039210 3300025263 Bacteria 889
106 Ga0209673_1000035 3300025273 Bacteria 328411
107 Ga0209130_1000052 3300025284 Bacteria 216971
108 Ga0209130_1000118 3300025284 Bacteria 129005
109 Ga0209130_1000769 3300025284 Bacteria 27726
110 Ga0209130_1051747 3300025284 Bacteria 744
111 Ga0209675_1000111 3300025291 Bacteria 114805
112 Ga0209675_1003688 3300025291 Bacteria 7148
113 Ga0209675_1048608 3300025291 Unclassified 886
114 Ga0209676_1000054 3300025292 Bacteria 365890
115 Ga0209676_1005385 3300025292 Bacteria 6714
116 Ga0209025_1002317 3300025294 Bacteria 20602
117 Ga0209025_1003784 3300025294 Bacteria 13848
118 Ga0209025_1009907 3300025294 Bacteria 6551
119 Ga0209025_1054891 3300025294 Bacteria 1546
120 Ga0209564_1001181 3300025295 Bacteria 30229
121 Ga0209564_1001242 3300025295 Bacteria 28585
122 Ga0209564_1012755 3300025295 Bacteria 3634
123 Ga0209758_1015776 3300025297 Bacteria 3886
124 Ga0209050_1000066 3300025298 Bacteria 305458
125 Ga0209050_1001192 3300025298 Bacteria 30549
126 Ga0209050_1005314 3300025298 Bacteria 8171
127 Ga0209050_1056460 3300025298 Bacteria 955
128 Ga0209256_1000003 3300025299 Bacteria 1661127
129 Ga0209256_1012379 3300025299 Bacteria 3278
130 Ga0209256_1028560 3300025299 Bacteria 1570
131 Ga0209256_1051024 3300025299 Bacteria 1000
132 Ga0207426_1000197 3300025302 Bacteria 146366
133 Ga0207426_1000762 3300025302 Bacteria 35839
134 Ga0207426_1002057 3300025302 Bacteria 13996
135 Ga0209051_1000044 3300025303 Bacteria 305458
136 Ga0209051_1034718 3300025303 Bacteria 1887
137 Ga0209257_1000082 3300025304 Bacteria 305458
138 Ga0209257_1009180 3300025304 Bacteria 5375
139 Ga0207705_10219387 3300025909 Unclassified 1444
140 Ga0207684_10004328 3300025910 Bacteria 13426
141 Ga0207646_10059908 3300025922 Bacteria 3400
142 Ga0207694_10017472 3300025924 Bacteria 5421
143 Ga0207706_10262199 3300025933 Bacteria 1508
144 Ga0207706_11436152 3300025933 Unclassified 565
145 Ga0207709_10379472 3300025935 Bacteria 1075
146 Ga0207711_10521900 3300025941 Bacteria 1107
147 Ga0207689_10048153 3300025942 Bacteria 3516
148 Ga0207668_10116304 3300025972 Bacteria 2016
149 Ga0207668_10949447 3300025972 Bacteria 767
150 Ga0207639_10020197 3300026041 Bacteria 4765
151 Ga0207639_10801062 3300026041 Unclassified 878
152 Ga0207641_10177137 3300026088 Bacteria 1950
153 Ga0207648_10432856 3300026089 Bacteria 1196
154 Ga0207675_100620364 3300026118 Bacteria 1086
155 Ga0209282_1214723 3300027666 Bacteria 876
156 Ga0268266_10011811 3300028379 Bacteria 7569
157 Ga0268266_10392133 3300028379 Bacteria 1311
158 Ga0268265_10660133 3300028380 Bacteria 1006
159 Ga0268264_10088050 3300028381 Bacteria 2671
160 Ga0268264_11104689 3300028381 Bacteria 801
161 Ga0307511_10000379 3300030521 Bacteria 47487
162 Ga0307513_10000011 3300031456 Bacteria 354929
163 Ga0307408_100004501 3300031548 Bacteria 9450
164 Ga0307408_101555935 3300031548 Bacteria 627
165 Ga0316575_10020754 3300031665 Unclassified 2522
166 Ga0316575_10079603 3300031665 Bacteria 1321
167 Ga0316579_10203855 3300031691 Unclassified 956
168 Ga0316576_10046477 3300031727 Unclassified 3142
169 Ga0316576_10076599 3300031727 Bacteria 2475
170 Ga0316576_10186677 3300031727 Bacteria 1563
171 Ga0316576_10259201 3300031727 Bacteria 1304
172 Ga0316576_10263103 3300031727 Bacteria 1294
173 Ga0316578_10011458 3300031728 Bacteria 4640
174 Ga0316578_10050290 3300031728 Unclassified 2438
175 Ga0316578_10203905 3300031728 Bacteria 1190
176 Ga0316578_10682919 3300031728 Unclassified 598
177 Ga0307405_11235791 3300031731 Bacteria 647
178 Ga0307413_11837535 3300031824 Bacteria 543
179 Ga0307406_10060406 3300031901 Bacteria 2444
180 Ga0307412_10396421 3300031911 Bacteria 1122
181 Ga0307412_10490861 3300031911 Bacteria 1020
182 Ga0307412_11328012 3300031911 Bacteria 648
183 Ga0307409_100563774 3300031995 Bacteria 1120
184 Ga0307416_100128473 3300032002 Bacteria 2275
185 Ga0307416_100973240 3300032002 Bacteria 951
186 Ga0307415_100134544 3300032126 Bacteria 1878
187 Ga0316583_10001405 3300032133 Bacteria 8008
188 Ga0316583_10021280 3300032133 Bacteria 2325
189 Ga0316583_10223052 3300032133 Unclassified 653
190 Ga0316583_10238911 3300032133 Unclassified 629
191 Ga0316585_10000332 3300032137 Bacteria 10691
192 Ga0316585_10004477 3300032137 Bacteria 3893
193 Ga0316585_10049921 3300032137 Unclassified 1342
194 Ga0316580_10002684 3300032139 Unclassified 4946
195 Ga0316580_10012578 3300032139 Unclassified 2579
196 Ga0316580_10019177 3300032139 Unclassified 2105
197 Ga0316580_10040292 3300032139 Bacteria 1443
198 Ga0307510_10435159 3300033180 Bacteria 753
199 Ga0316574_0179894 3300035398 Bacteria 1360
200 Ga0316574_0273580 3300035398 Bacteria 1077
201 Ga0316574_0590311 3300035398 Unclassified 687
202 Ga0316582_0004259 3300036647 Bacteria 7190
203 Ga0316582_0026673 3300036647 Bacteria 3480
204 Ga0316582_0063575 3300036647 Bacteria 2372
205 Ga0316582_0104597 3300036647 Bacteria 1878
206 Ga0316582_0150804 3300036647 Bacteria 1571
207 Ga0316582_0434239 3300036647 Bacteria 905
208 Ga0316582_0656839 3300036647 Bacteria 721
209 Ga0316582_1109008 3300036647 Unclassified 539
210 Ga0316584_0030715 3300036712 Unclassified 3969
211 Ga0316584_0082731 3300036712 Bacteria 2404
212 Ga0316584_0168538 3300036712 Bacteria 1625
213 Ga0316584_0227700 3300036712 Bacteria 1367
214 Ga0316584_0332863 3300036712 Unclassified 1093
215 Ga0395905_0232587 3300037471 Bacteria 1723
216 Ga0400483_076291 3300039062 Bacteria 2557
217 Ga0400483_082841 3300039062 Bacteria 8854
218 Ga0400483_092944 3300039062 Bacteria 39194
219 Ga0400483_185843 3300039062 Bacteria 7962
220 Ga0400483_253344 3300039062 Bacteria 1569
221 Ga0400489_51967 3300039093 Unclassified 2186
222 Ga0451791_1043014 3300041451 Unclassified 874
223 Ga0451793_0796604 3300041452 Bacteria 924
224 Ga0451833_1288020 3300041491 Bacteria 749
225 Ga0451849_1187958 3300041505 Bacteria 589
226 Ga0451853_2384934 3300041512 Bacteria 625
227 Ga0439445_0052833 3300042004 Unclassified 1100
228 Ga0466969_0000010 3300044656 Bacteria 117215
229 Ga0466969_0070232 3300044656 Bacteria 1685
230 Ga0466966_0099294 3300044684 Bacteria 1801
231 Ga0466970_0129358 3300044765 Bacteria 1386
232 Ga0466959_0044414 3300045049 Bacteria 3274
233 Ga0495627_007153 3300046453 Bacteria 4312
234 Ga0495592_0000054 3300046454 Bacteria 107373
235 Ga0495610_0027235 3300046512 Bacteria 3040
236 Ga0495616_0012806 3300046513 Bacteria 4746
237 Ga0495620_0038660 3300046515 Bacteria 2116
238 Ga0495631_0001758 3300046518 Bacteria 12849
239 Ga0495637_0004778 3300046520 Bacteria 6987
240 Ga0495637_0040197 3300046520 Bacteria 2015
241 Ga0495654_0049327 3300046530 Bacteria 2063
242 Ga0495654_0071607 3300046530 Bacteria 1642
243 Ga0495598_0088476 3300046537 Bacteria 1006
244 Ga0495621_0011402 3300046539 Bacteria 2748
245 Ga0495668_0081602 3300046616 Bacteria 1774
246 Ga0495668_0375719 3300046616 Bacteria 780
247 Ga0495625_0021867 3300046660 Bacteria 4912
248 Ga0495635_0152525 3300046663 Bacteria 1573
249 Ga0495661_0069593 3300046665 Bacteria 2062
250 Ga0495588_0031969 3300046674 Bacteria 2651
251 Ga0495588_0102386 3300046674 Bacteria 1505
252 Ga0495658_0311040 3300046683 Bacteria 997
253 Ga0495624_0612901 3300046690 Bacteria 648
254 Ga0495670_0018805 3300046691 Bacteria 3403
255 Ga0495671_0003545 3300046692 Bacteria 9538
256 Ga0495660_0102949 3300046810 Bacteria 1467
257 Ga0495660_0123793 3300046810 Bacteria 1305
258 Ga0495602_0634914 3300048088 Bacteria 731
259 Ga0496116_0047199 3300048919 Bacteria 2900
260 Ga0496117_0018820 3300048920 Bacteria 5700
261 Ga0496117_0038507 3300048920 Bacteria 3543
262 Ga0496121_0282501 3300048924 Bacteria 1134
263 Ga0496121_0445738 3300048924 Bacteria 835
264 Ga0496122_0100580 3300048925 Bacteria 1934
265 Ga0496123_0116093 3300048926 Bacteria 1517
266 Ga0496123_0260410 3300048926 Bacteria 850
267 Ga0496125_0030392 3300048928 Bacteria 4834
268 Ga0496125_0149172 3300048928 Bacteria 1609
269 Ga0496126_0426521 3300048929 Bacteria 1071
270 nmdc:mga03683_391583_c1 3300050489 Bacteria 662
271 nmdc:mga03683_94910_c1 3300050489 Bacteria 1305
272 nmdc:mga00v17_663991_c1 3300050491 Bacteria 670
273 nmdc:mga0k408_266638_c1 3300050493 Bacteria 1022
274 nmdc:mga07m45_13880_c1 3300050496 Bacteria 4282
275 nmdc:mga08y16_819072_c1 3300050511 Bacteria 922
276 nmdc:mga0n895_1610834_c1 3300050512 Unclassified 613
277 nmdc:mga08x19_392107_c1 3300050514 Bacteria 973
278 nmdc:mga0sz30_396866_c1 3300050516 Bacteria 618
279 Ga0500610_0038993 3300053079 Bacteria 2449
280 Ga0500610_0087645 3300053079 Bacteria 1618
281 Ga0500643_014600 3300053087 Bacteria 2723
282 Ga0500646_0001707 3300053090 Bacteria 5791
283 Ga0500647_0056293 3300053091 Bacteria 1891
284 Ga0500583_0127337 3300053092 Bacteria 1262
285 Ga0500651_0000087 3300053093 Bacteria 59423
286 Ga0500566_0174298 3300053094 Bacteria 1109
287 Ga0500566_0235624 3300053094 Bacteria 900
288 Ga0500566_0267737 3300053094 Bacteria 821
289 Ga0500641_0274131 3300053096 Bacteria 701
290 Ga0500650_0082700 3300053098 Bacteria 1502
291 Ga0500560_047882 3300053107 Bacteria 1364
292 Ga0500571_002974 3300053110 Bacteria 8577
293 Ga0500593_004562 3300053117 Bacteria 5381
294 Ga0500594_0015770 3300053118 Bacteria 1827
295 Ga0500595_069129 3300053119 Bacteria 1051
296 Ga0500607_001005 3300053121 Bacteria 26785
297 Ga0500607_063450 3300053121 Bacteria 1927
298 Ga0500608_024285 3300053122 Bacteria 2829
299 Ga0500655_004581 3300053133 Bacteria 2486
300 Ga0500658_0000082 3300053134 Bacteria 43858
301 Ga0500658_0000178 3300053134 Bacteria 30470
302 Ga0500564_045086 3300053138 Bacteria 2023
303 Ga0500568_0008032 3300053139 Bacteria 5121
304 Ga0500574_039681 3300053141 Bacteria 1308
305 Ga0500604_0013719 3300053151 Bacteria 2199
306 Ga0500604_0116381 3300053151 Bacteria 891
307 Ga0500616_0005000 3300053153 Bacteria 9188
308 Ga0500624_067619 3300053157 Bacteria 694
309 Ga0500634_0091639 3300053161 Bacteria 1540
310 Ga0500634_0110186 3300053161 Bacteria 1360
311 Ga0500638_193476 3300053162 Bacteria 867
312 Ga0500637_0243118 3300053178 Unclassified 1008
313 Ga0500625_227348 3300053729 Bacteria 586
314 Ga0500645_001842 3300053730 Bacteria 10159
315 Ga0500645_003213 3300053730 Bacteria 6769
316 Ga0500645_021729 3300053730 Bacteria 1979
317 Ga0500645_070877 3300053730 Bacteria 1000
318 Ga0500596_025179 3300053735 Bacteria 907
319 Ga0501082_0001719 3300060353 Bacteria 19318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100484702 Ga0070698_1004847022 147
2 3300025910 Ga0207684_10004328 Ga0207684_100043283 147
3 3300025922 Ga0207646_10059908 Ga0207646_100599082 147
4 3300037471 Ga0395905_0232587 Ga0395905_0232587_720_1163 147
5 3300009553 Ga0105249_11416788 Ga0105249_114167882 156
6 3300031911 Ga0307412_10396421 Ga0307412_103964212 156
7 iso_pu_bacteria 2945909444 2945910967 159
8 3300005563 Ga0068855_100164520 Ga0068855_1001645202 160
9 3300006028 Ga0070717_10721809 Ga0070717_107218091 160
10 3300009177 Ga0105248_10422693 Ga0105248_104226932 160
11 3300009551 Ga0105238_10111626 Ga0105238_101116262 160
12 3300025924 Ga0207694_10017472 Ga0207694_100174722 160
13 3300025941 Ga0207711_10521900 Ga0207711_105219002 160
14 3300048088 Ga0495602_0634914 Ga0495602_0634914_89_571 160
15 iso_pu_bacteria 2831265667 2831265800 160
16 iso_pu_bacteria 2885198086 2885203391 160
17 iso_pu_bacteria 2885211737 2885217259 160
18 iso_pu_bacteria 2928084124 2928087100 160
19 3300005539 Ga0068853_101054504 Ga0068853_1010545042 161
20 3300005843 Ga0068860_100342904 Ga0068860_1003429041 161
21 3300007265 Ga0099794_10107721 Ga0099794_101077212 161
22 3300009094 Ga0111539_11460175 Ga0111539_114601751 161
23 3300009101 Ga0105247_10280928 Ga0105247_102809281 161
24 3300010375 Ga0105239_10382391 Ga0105239_103823912 161
25 3300014968 Ga0157379_10123157 Ga0157379_101231571 161
26 3300025909 Ga0207705_10219387 Ga0207705_102193872 161
27 3300026041 Ga0207639_10801062 Ga0207639_108010622 161
28 3300028381 Ga0268264_11104689 Ga0268264_111046891 161
29 3300039062 Ga0400483_076291 Ga0400483_076291_1612_2097 161
30 3300041451 Ga0451791_1043014 Ga0451791_1043014_246_746 161
31 3300041452 Ga0451793_0796604 Ga0451793_0796604_255_755 161
32 3300050511 nmdc:mga08y16_819072_c1 nmdc:mga08y16_819072_c1_117_614 161
33 3300060353 Ga0501082_0001719 Ga0501082_0001719_8006_8491 161
34 iso_pu_bacteria 2511231002 2511244905 161
35 3300005844 Ga0068862_100216989 Ga0068862_1002169892 162
36 3300006353 Ga0075370_10064879 Ga0075370_100648793 162
37 3300007788 Ga0099795_10078090 Ga0099795_100780902 162
38 3300031456 Ga0307513_10000011 Ga0307513_1000001136 162
39 3300031548 Ga0307408_101555935 Ga0307408_1015559351 162
40 3300031731 Ga0307405_11235791 Ga0307405_112357911 162
41 3300031824 Ga0307413_11837535 Ga0307413_118375351 162
42 3300031911 Ga0307412_10490861 Ga0307412_104908612 162
43 3300031911 Ga0307412_11328012 Ga0307412_113280121 162
44 3300032126 Ga0307415_100134544 Ga0307415_1001345442 162
45 3300036647 Ga0316582_0063575 Ga0316582_0063575_53_541 162
46 3300041505 Ga0451849_1187958 Ga0451849_1187958_34_522 162
47 3300041512 Ga0451853_2384934 Ga0451853_2384934_25_513 162
48 3300046537 Ga0495598_0088476 Ga0495598_0088476_166_660 162
49 3300050489 nmdc:mga03683_391583_c1 nmdc:mga03683_391583_c1_36_539 162
50 3300053730 Ga0500645_021729 Ga0500645_021729_794_1288 162
51 3300002704 JGI25155J39150_1000086 JGI25155J39150_100008626 163
52 3300002705 JGI25156J39149_1000111 JGI25156J39149_100011127 163
53 3300002738 JGI25154J39366_1000134 JGI25154J39366_100013427 163
54 3300002741 JGI25157J39369_1000152 JGI25157J39369_100015225 163
55 3300002774 JGI25150J39212_1005943 JGI25150J39212_10059433 163
56 3300002774 JGI25150J39212_1012138 JGI25150J39212_10121382 163
57 3300002987 JGI25159J45721_1001476 JGI25159J45721_10014766 163
58 3300002987 JGI25159J45721_1001834 JGI25159J45721_10018349 163
59 3300003187 JGI25151J46595_10006321 JGI25151J46595_100063212 163
60 3300003187 JGI25151J46595_10006979 JGI25151J46595_100069794 163
61 3300003187 JGI25151J46595_10073551 JGI25151J46595_100735512 163
62 3300003354 JGI25160J50197_1002492 JGI25160J50197_10024929 163
63 3300003374 JGI25161J50226_1000109 JGI25161J50226_100010963 163
64 3300003771 Ga0055526_1003708 Ga0055526_10037088 163
65 3300003773 Ga0055537_1000086 Ga0055537_100008627 163
66 3300003775 Ga0055524_1000093 Ga0055524_100009310 163
67 3300003775 Ga0055524_1000194 Ga0055524_100019447 163
68 3300003784 Ga0055534_1000938 Ga0055534_10009389 163
69 3300003784 Ga0055534_1007750 Ga0055534_10077502 163
70 3300003790 Ga0055528_1000961 Ga0055528_100096112 163
71 3300003791 Ga0055530_10000541 Ga0055530_1000054128 163
72 3300003791 Ga0055530_10043510 Ga0055530_100435102 163
73 3300003791 Ga0055530_10043874 Ga0055530_100438742 163
74 3300003791 Ga0055530_10048422 Ga0055530_100484221 163
75 3300003792 Ga0055540_1000089 Ga0055540_100008935 163
76 3300003794 Ga0055531_10013404 Ga0055531_100134042 163
77 3300003794 Ga0055531_10041930 Ga0055531_100419302 163
78 3300004625 Ga0055543_1006769 Ga0055543_10067693 163
79 3300005262 Ga0065165_1015950 Ga0065165_10159503 163
80 3300005262 Ga0065165_1016740 Ga0065165_10167403 163
81 3300005262 Ga0065165_1024279 Ga0065165_10242793 163
82 3300005334 Ga0068869_100061143 Ga0068869_1000611434 163
83 3300005347 Ga0070668_100072322 Ga0070668_1000723224 163
84 3300005438 Ga0070701_10102290 Ga0070701_101022901 163
85 3300005455 Ga0070663_100622677 Ga0070663_1006226772 163
86 3300005459 Ga0068867_100595848 Ga0068867_1005958481 163
87 3300005539 Ga0068853_100024536 Ga0068853_1000245362 163
88 3300005548 Ga0070665_100005322 Ga0070665_10000532214 163
89 3300005548 Ga0070665_100448846 Ga0070665_1004488462 163
90 3300005617 Ga0068859_100109911 Ga0068859_1001099113 163
91 3300005719 Ga0068861_100539975 Ga0068861_1005399752 163
92 3300005834 Ga0068851_10654227 Ga0068851_106542271 163
93 3300005843 Ga0068860_100053466 Ga0068860_1000534665 163
94 3300006048 Ga0075363_100131945 Ga0075363_1001319451 163
95 3300006195 Ga0075366_10218259 Ga0075366_102182592 163
96 3300006931 Ga0097620_100109907 Ga0097620_1001099073 163
97 3300006948 Ga0099826_10171534 Ga0099826_101715342 163
98 3300009148 Ga0105243_10367725 Ga0105243_103677252 163
99 3300013297 Ga0157378_10185209 Ga0157378_101852093 163
100 3300013306 Ga0163162_10187254 Ga0163162_101872543 163
101 3300014969 Ga0157376_10079749 Ga0157376_100797493 163
102 3300025206 Ga0209435_100014 Ga0209435_100014264 163
103 3300025208 Ga0209436_116935 Ga0209436_1169351 163
104 3300025245 Ga0207425_1004810 Ga0207425_10048103 163
105 3300025245 Ga0207425_1013606 Ga0207425_10136063 163
106 3300025246 Ga0209646_1000001 Ga0209646_1000001264 163
107 3300025250 Ga0209026_1000137 Ga0209026_100013726 163
108 3300025256 Ga0209759_1000013 Ga0209759_1000013264 163
109 3300025263 Ga0209565_1000028 Ga0209565_100002842 163
110 3300025263 Ga0209565_1002390 Ga0209565_10023901 163
111 3300025263 Ga0209565_1039210 Ga0209565_10392102 163
112 3300025273 Ga0209673_1000035 Ga0209673_1000035293 163
113 3300025284 Ga0209130_1000052 Ga0209130_1000052212 163
114 3300025284 Ga0209130_1000118 Ga0209130_100011886 163
115 3300025284 Ga0209130_1051747 Ga0209130_10517471 163
116 3300025291 Ga0209675_1000111 Ga0209675_100011150 163
117 3300025291 Ga0209675_1003688 Ga0209675_10036888 163
118 3300025291 Ga0209675_1048608 Ga0209675_10486081 163
119 3300025292 Ga0209676_1000054 Ga0209676_100005436 163
120 3300025292 Ga0209676_1005385 Ga0209676_10053857 163
121 3300025294 Ga0209025_1002317 Ga0209025_10023176 163
122 3300025294 Ga0209025_1003784 Ga0209025_10037849 163
123 3300025295 Ga0209564_1001242 Ga0209564_10012428 163
124 3300025295 Ga0209564_1012755 Ga0209564_10127555 163
125 3300025297 Ga0209758_1015776 Ga0209758_10157763 163
126 3300025298 Ga0209050_1000066 Ga0209050_100006636 163
127 3300025298 Ga0209050_1001192 Ga0209050_10011925 163
128 3300025298 Ga0209050_1056460 Ga0209050_10564602 163
129 3300025299 Ga0209256_1000003 Ga0209256_10000031310 163
130 3300025299 Ga0209256_1012379 Ga0209256_10123793 163
131 3300025302 Ga0207426_1000197 Ga0207426_1000197129 163
132 3300025302 Ga0207426_1002057 Ga0207426_10020579 163
133 3300025303 Ga0209051_1000044 Ga0209051_100004436 163
134 3300025303 Ga0209051_1034718 Ga0209051_10347182 163
135 3300025304 Ga0209257_1000082 Ga0209257_100008236 163
136 3300025304 Ga0209257_1009180 Ga0209257_10091803 163
137 3300025933 Ga0207706_11436152 Ga0207706_114361521 163
138 3300025935 Ga0207709_10379472 Ga0207709_103794722 163
139 3300025942 Ga0207689_10048153 Ga0207689_100481535 163
140 3300025972 Ga0207668_10949447 Ga0207668_109494471 163
141 3300026088 Ga0207641_10177137 Ga0207641_101771372 163
142 3300026089 Ga0207648_10432856 Ga0207648_104328562 163
143 3300026118 Ga0207675_100620364 Ga0207675_1006203642 163
144 3300027666 Ga0209282_1214723 Ga0209282_12147231 163
145 3300028379 Ga0268266_10011811 Ga0268266_100118112 163
146 3300028379 Ga0268266_10392133 Ga0268266_103921332 163
147 3300028380 Ga0268265_10660133 Ga0268265_106601332 163
148 3300028381 Ga0268264_10088050 Ga0268264_100880503 163
149 3300031548 Ga0307408_100004501 Ga0307408_1000045013 163
150 3300031727 Ga0316576_10076599 Ga0316576_100765991 163
151 3300031901 Ga0307406_10060406 Ga0307406_100604064 163
152 3300039062 Ga0400483_082841 Ga0400483_082841_4676_5167 163
153 3300039062 Ga0400483_185843 Ga0400483_185843_3085_3576 163
154 3300039093 Ga0400489_51967 Ga0400489_51967_641_1132 163
155 3300042004 Ga0439445_0052833 Ga0439445_0052833_23_517 163
156 3300044656 Ga0466969_0000010 Ga0466969_0000010_67548_68039 163
157 3300044684 Ga0466966_0099294 Ga0466966_0099294_964_1455 163
158 3300044765 Ga0466970_0129358 Ga0466970_0129358_46_537 163
159 3300045049 Ga0466959_0044414 Ga0466959_0044414_840_1331 163
160 3300046453 Ga0495627_007153 Ga0495627_007153_180_671 163
161 3300046454 Ga0495592_0000054 Ga0495592_0000054_104845_105348 163
162 3300046515 Ga0495620_0038660 Ga0495620_0038660_479_970 163
163 3300046530 Ga0495654_0049327 Ga0495654_0049327_296_787 163
164 3300046616 Ga0495668_0375719 Ga0495668_0375719_47_538 163
165 3300046665 Ga0495661_0069593 Ga0495661_0069593_307_798 163
166 3300046692 Ga0495671_0003545 Ga0495671_0003545_5428_5919 163
167 3300046810 Ga0495660_0123793 Ga0495660_0123793_254_745 163
168 3300050491 nmdc:mga00v17_663991_c1 nmdc:mga00v17_663991_c1_48_545 163
169 3300050493 nmdc:mga0k408_266638_c1 nmdc:mga0k408_266638_c1_425_922 163
170 3300053079 Ga0500610_0038993 Ga0500610_0038993_84_575 163
171 3300053094 Ga0500566_0174298 Ga0500566_0174298_180_683 163
172 3300053094 Ga0500566_0235624 Ga0500566_0235624_177_674 163
173 3300053096 Ga0500641_0274131 Ga0500641_0274131_95_586 163
174 3300053117 Ga0500593_004562 Ga0500593_004562_3528_4019 163
175 3300053121 Ga0500607_001005 Ga0500607_001005_25900_26391 163
176 3300053161 Ga0500634_0110186 Ga0500634_0110186_541_1032 163
177 3300053730 Ga0500645_003213 Ga0500645_003213_6095_6598 163
178 3300053730 Ga0500645_070877 Ga0500645_070877_222_734 163
179 3300000532 CNAas_1004178 CNAas_10041782 164
180 3300001979 JGI24740J21852_10017643 JGI24740J21852_100176434 164
181 3300001989 JGI24739J22299_10088820 JGI24739J22299_100888202 164
182 3300003374 JGI25161J50226_1002903 JGI25161J50226_10029033 164
183 3300003762 Ga0055542_1000109 Ga0055542_100010920 164
184 3300003791 Ga0055530_10041611 Ga0055530_100416112 164
185 3300004625 Ga0055543_1003541 Ga0055543_10035412 164
186 3300005262 Ga0065165_1027754 Ga0065165_10277542 164
187 3300005347 Ga0070668_100317342 Ga0070668_1003173422 164
188 3300005459 Ga0068867_100936144 Ga0068867_1009361441 164
189 3300005539 Ga0068853_100017819 Ga0068853_1000178194 164
190 3300005937 Ga0081455_10276903 Ga0081455_102769032 164
191 3300006038 Ga0075365_10209031 Ga0075365_102090312 164
192 3300006048 Ga0075363_100120609 Ga0075363_1001206092 164
193 3300006186 Ga0075369_10048385 Ga0075369_100483851 164
194 3300006195 Ga0075366_10418330 Ga0075366_104183302 164
195 3300007076 Ga0075435_100397324 Ga0075435_1003973241 164
196 3300009036 Ga0105244_10207488 Ga0105244_102074882 164
197 3300009553 Ga0105249_11495051 Ga0105249_114950511 164
198 3300010375 Ga0105239_10723558 Ga0105239_107235582 164
199 3300014497 Ga0182008_10000163 Ga0182008_1000016330 164
200 3300014968 Ga0157379_10074364 Ga0157379_100743644 164
201 3300015265 Ga0182005_1065627 Ga0182005_10656272 164
202 3300017792 Ga0163161_10050573 Ga0163161_100505734 164
203 3300025228 Ga0209672_100871 Ga0209672_1008714 164
204 3300025229 Ga0209147_104091 Ga0209147_1040912 164
205 3300025242 Ga0209258_100048 Ga0209258_10004820 164
206 3300025254 Ga0209148_1000040 Ga0209148_100004020 164
207 3300025284 Ga0209130_1000769 Ga0209130_100076924 164
208 3300025294 Ga0209025_1009907 Ga0209025_10099074 164
209 3300025294 Ga0209025_1054891 Ga0209025_10548912 164
210 3300025295 Ga0209564_1001181 Ga0209564_100118127 164
211 3300025298 Ga0209050_1005314 Ga0209050_10053142 164
212 3300025299 Ga0209256_1028560 Ga0209256_10285602 164
213 3300025299 Ga0209256_1051024 Ga0209256_10510241 164
214 3300025302 Ga0207426_1000762 Ga0207426_100076211 164
215 3300025933 Ga0207706_10262199 Ga0207706_102621992 164
216 3300025972 Ga0207668_10116304 Ga0207668_101163043 164
217 3300026041 Ga0207639_10020197 Ga0207639_100201976 164
218 3300030521 Ga0307511_10000379 Ga0307511_1000037912 164
219 3300031665 Ga0316575_10020754 Ga0316575_100207543 164
220 3300031665 Ga0316575_10079603 Ga0316575_100796032 164
221 3300031691 Ga0316579_10203855 Ga0316579_102038552 164
222 3300031727 Ga0316576_10046477 Ga0316576_100464773 164
223 3300031727 Ga0316576_10186677 Ga0316576_101866772 164
224 3300031727 Ga0316576_10259201 Ga0316576_102592011 164
225 3300031727 Ga0316576_10263103 Ga0316576_102631032 164
226 3300031728 Ga0316578_10011458 Ga0316578_100114581 164
227 3300031728 Ga0316578_10050290 Ga0316578_100502902 164
228 3300031728 Ga0316578_10203905 Ga0316578_102039052 164
229 3300031728 Ga0316578_10682919 Ga0316578_106829191 164
230 3300031995 Ga0307409_100563774 Ga0307409_1005637742 164
231 3300032002 Ga0307416_100128473 Ga0307416_1001284733 164
232 3300032002 Ga0307416_100973240 Ga0307416_1009732401 164
233 3300032133 Ga0316583_10001405 Ga0316583_100014052 164
234 3300032133 Ga0316583_10021280 Ga0316583_100212802 164
235 3300032133 Ga0316583_10223052 Ga0316583_102230521 164
236 3300032133 Ga0316583_10238911 Ga0316583_102389111 164
237 3300032137 Ga0316585_10000332 Ga0316585_100003326 164
238 3300032137 Ga0316585_10004477 Ga0316585_100044771 164
239 3300032137 Ga0316585_10049921 Ga0316585_100499211 164
240 3300032139 Ga0316580_10002684 Ga0316580_100026844 164
241 3300032139 Ga0316580_10012578 Ga0316580_100125783 164
242 3300032139 Ga0316580_10019177 Ga0316580_100191771 164
243 3300032139 Ga0316580_10040292 Ga0316580_100402921 164
244 3300033180 Ga0307510_10435159 Ga0307510_104351591 164
245 3300035398 Ga0316574_0179894 Ga0316574_0179894_419_913 164
246 3300035398 Ga0316574_0273580 Ga0316574_0273580_290_796 164
247 3300035398 Ga0316574_0590311 Ga0316574_0590311_150_644 164
248 3300036647 Ga0316582_0004259 Ga0316582_0004259_6595_7089 164
249 3300036647 Ga0316582_0026673 Ga0316582_0026673_1670_2164 164
250 3300036647 Ga0316582_0104597 Ga0316582_0104597_251_745 164
251 3300036647 Ga0316582_0150804 Ga0316582_0150804_1047_1541 164
252 3300036647 Ga0316582_0434239 Ga0316582_0434239_177_683 164
253 3300036647 Ga0316582_0656839 Ga0316582_0656839_86_604 164
254 3300036647 Ga0316582_1109008 Ga0316582_1109008_12_506 164
255 3300036712 Ga0316584_0030715 Ga0316584_0030715_2403_2897 164
256 3300036712 Ga0316584_0082731 Ga0316584_0082731_238_732 164
257 3300036712 Ga0316584_0168538 Ga0316584_0168538_375_869 164
258 3300036712 Ga0316584_0227700 Ga0316584_0227700_67_573 164
259 3300036712 Ga0316584_0332863 Ga0316584_0332863_401_895 164
260 3300039062 Ga0400483_092944 Ga0400483_092944_17733_18257 164
261 3300039062 Ga0400483_253344 Ga0400483_253344_707_1291 164
262 3300041491 Ga0451833_1288020 Ga0451833_1288020_160_657 164
263 3300044656 Ga0466969_0070232 Ga0466969_0070232_1135_1650 164
264 3300046512 Ga0495610_0027235 Ga0495610_0027235_68_565 164
265 3300046513 Ga0495616_0012806 Ga0495616_0012806_3597_4094 164
266 3300046518 Ga0495631_0001758 Ga0495631_0001758_11357_11854 164
267 3300046520 Ga0495637_0004778 Ga0495637_0004778_5140_5652 164
268 3300046520 Ga0495637_0040197 Ga0495637_0040197_302_799 164
269 3300046530 Ga0495654_0071607 Ga0495654_0071607_560_1057 164
270 3300046539 Ga0495621_0011402 Ga0495621_0011402_1794_2291 164
271 3300046616 Ga0495668_0081602 Ga0495668_0081602_777_1274 164
272 3300046660 Ga0495625_0021867 Ga0495625_0021867_3555_4052 164
273 3300046663 Ga0495635_0152525 Ga0495635_0152525_804_1301 164
274 3300046674 Ga0495588_0031969 Ga0495588_0031969_1700_2197 164
275 3300046674 Ga0495588_0102386 Ga0495588_0102386_226_741 164
276 3300046683 Ga0495658_0311040 Ga0495658_0311040_267_764 164
277 3300046690 Ga0495624_0612901 Ga0495624_0612901_22_519 164
278 3300046691 Ga0495670_0018805 Ga0495670_0018805_1311_1823 164
279 3300046810 Ga0495660_0102949 Ga0495660_0102949_254_769 164
280 3300048919 Ga0496116_0047199 Ga0496116_0047199_1751_2245 164
281 3300048920 Ga0496117_0018820 Ga0496117_0018820_3189_3686 164
282 3300048920 Ga0496117_0038507 Ga0496117_0038507_353_847 164
283 3300048924 Ga0496121_0282501 Ga0496121_0282501_12_506 164
284 3300048924 Ga0496121_0445738 Ga0496121_0445738_11_508 164
285 3300048925 Ga0496122_0100580 Ga0496122_0100580_207_704 164
286 3300048926 Ga0496123_0116093 Ga0496123_0116093_825_1319 164
287 3300048926 Ga0496123_0260410 Ga0496123_0260410_270_767 164
288 3300048928 Ga0496125_0030392 Ga0496125_0030392_806_1303 164
289 3300048928 Ga0496125_0149172 Ga0496125_0149172_714_1208 164
290 3300048929 Ga0496126_0426521 Ga0496126_0426521_227_724 164
291 3300050489 nmdc:mga03683_94910_c1 nmdc:mga03683_94910_c1_179_673 164
292 3300050496 nmdc:mga07m45_13880_c1 nmdc:mga07m45_13880_c1_1435_1929 164
293 3300050512 nmdc:mga0n895_1610834_c1 nmdc:mga0n895_1610834_c1_98_592 164
294 3300050514 nmdc:mga08x19_392107_c1 nmdc:mga08x19_392107_c1_408_911 164
295 3300050516 nmdc:mga0sz30_396866_c1 nmdc:mga0sz30_396866_c1_97_591 164
296 3300053079 Ga0500610_0087645 Ga0500610_0087645_617_1129 164
297 3300053087 Ga0500643_014600 Ga0500643_014600_131_628 164
298 3300053090 Ga0500646_0001707 Ga0500646_0001707_1911_2426 164
299 3300053091 Ga0500647_0056293 Ga0500647_0056293_595_1089 164
300 3300053092 Ga0500583_0127337 Ga0500583_0127337_261_776 164
301 3300053093 Ga0500651_0000087 Ga0500651_0000087_232_729 164
302 3300053094 Ga0500566_0267737 Ga0500566_0267737_184_681 164
303 3300053098 Ga0500650_0082700 Ga0500650_0082700_977_1492 164
304 3300053107 Ga0500560_047882 Ga0500560_047882_705_1202 164
305 3300053110 Ga0500571_002974 Ga0500571_002974_7594_8091 164
306 3300053118 Ga0500594_0015770 Ga0500594_0015770_323_820 164
307 3300053119 Ga0500595_069129 Ga0500595_069129_288_785 164
308 3300053121 Ga0500607_063450 Ga0500607_063450_363_857 164
309 3300053122 Ga0500608_024285 Ga0500608_024285_357_854 164
310 3300053133 Ga0500655_004581 Ga0500655_004581_267_764 164
311 3300053134 Ga0500658_0000082 Ga0500658_0000082_40915_41412 164
312 3300053134 Ga0500658_0000178 Ga0500658_0000178_29191_29688 164
313 3300053138 Ga0500564_045086 Ga0500564_045086_813_1310 164
314 3300053139 Ga0500568_0008032 Ga0500568_0008032_813_1310 164
315 3300053141 Ga0500574_039681 Ga0500574_039681_770_1267 164
316 3300053151 Ga0500604_0013719 Ga0500604_0013719_1025_1540 164
317 3300053151 Ga0500604_0116381 Ga0500604_0116381_144_641 164
318 3300053153 Ga0500616_0005000 Ga0500616_0005000_8092_8589 164
319 3300053157 Ga0500624_067619 Ga0500624_067619_174_671 164
320 3300053161 Ga0500634_0091639 Ga0500634_0091639_803_1300 164
321 3300053162 Ga0500638_193476 Ga0500638_193476_190_687 164
322 3300053178 Ga0500637_0243118 Ga0500637_0243118_463_972 164
323 3300053729 Ga0500625_227348 Ga0500625_227348_30_524 164
324 3300053730 Ga0500645_001842 Ga0500645_001842_4871_5386 164
325 3300053735 Ga0500596_025179 Ga0500596_025179_94_588 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

49

176

0.82

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

42

165

0.75

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

77

167

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h89-assembly1.cif.gz_A-2 the structure of a gcn5-related n-acetyltransferase from kribbella flavida 0.9476 2 161
4h89-assembly1.cif.gz_A-2 the structure of a gcn5-related n-acetyltransferase from kribbella flavida 0.9197 2 161
4jxr-assembly1.cif.gz_B crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa 0.8903 2 163
1vhs-assembly1.cif.gz_A crystal structure of a putative phosphinothricin n-acetyltransferase 0.8873 1 164
2jlm-assembly1.cif.gz_B structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1 0.8871 1 161
ID Description Score Start End Superfamily
4h89A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9229 2 158 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9176 95 161 3.40.630.30
af_A0A1D8PTE9_19_244_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9061 2 162 3.40.630.30
3ld2D00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8926 3 162 3.40.630.30
1y9kD01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8862 34 139 3.40.630.30
ID Description Score Start End GO Terms
AF-C9P8I6-F1-model_v4 deleted 0.9928 85 164
AF-A0A0P8A3Z5-F1-model_v4 Acetyltransferase 0.9895 1 164 GO:0016747
AF-A0A7Y9IR81-F1-model_v4 GNAT superfamily N-acetyltransferase 0.9894 1 162 GO:0016747
AF-A0A1V3P166-F1-model_v4 GNAT family N-acetyltransferase 0.9884 1 164 GO:0016747
AF-A0A5K1I726-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9878 1 161 GO:0016747

Feature Viewer

pLDDT pTM Quality
96.15 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map