F407892

General Info

Members Datasets Scaffolds Average Seq Length
325 176 650 100

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_101201574|Ga0307408_1012015741
Length 111
Sequence MDPEIVLPLLIVPMLFIGLPWLIFHYVTKWKVNSSLTGEDEKMLDELYDLARRLDDRMNTIERIMKADNPGWNPVGYDAPPQPRLEKADPADFEPIREVSRSRARTKQERI

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 0
Rhizoplane 1.23
Rhizosphere 92.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_101201574 3300031548 Bacteria 707
2 SwRhRL2b_contig_51293 2162886007 Bacteria 1152
3 JGI24740J21852_10011890 3300001979 Bacteria 3300
4 JGI24739J22299_10053166 3300001989 Bacteria 1300
5 JGI24739J22299_10123760 3300001989 Bacteria 771
6 JGI24737J22298_10003788 3300001990 Bacteria 5319
7 JGI24737J22298_10016268 3300001990 Bacteria 2401
8 JGI24737J22298_10077812 3300001990 Bacteria 988
9 JGI24737J22298_10081454 3300001990 Bacteria 963
10 JGI24743J22301_10004441 3300001991 Bacteria 2287
11 JGI24735J21928_10003655 3300002067 Bacteria 5217
12 JGI24735J21928_10009264 3300002067 Bacteria 3167
13 JGI24735J21928_10024579 3300002067 Bacteria 1821
14 JGI24738J21930_10005348 3300002075 Bacteria 3082
15 JGI24744J21845_10009128 3300002077 Bacteria 2036
16 JGI24742J22300_10024440 3300002244 Bacteria 1042
17 Ga0007409J51694_1090716 3300003575 Bacteria 546
18 Ga0032354_1074644 3300003693 Bacteria 584
19 Ga0032354_1140177 3300003693 Bacteria 813
20 Ga0055542_1001687 3300003762 Bacteria 9752
21 Ga0065707_10263238 3300005295 Bacteria 1091
22 Ga0070658_10008484 3300005327 Bacteria 8262
23 Ga0070658_10103924 3300005327 Bacteria 2350
24 Ga0070658_10821426 3300005327 Bacteria 808
25 Ga0070676_10000539 3300005328 Bacteria 18309
26 Ga0070683_100124568 3300005329 Bacteria 2436
27 Ga0070683_101154158 3300005329 Bacteria 744
28 Ga0070683_101463224 3300005329 Bacteria 657
29 Ga0070690_100365302 3300005330 Bacteria 1051
30 Ga0070690_101631493 3300005330 Bacteria 523
31 Ga0070677_10018061 3300005333 Bacteria 2536
32 Ga0068869_100000897 3300005334 Bacteria 17161
33 Ga0070666_10145818 3300005335 Bacteria 1650
34 Ga0068868_100000016 3300005338 Bacteria 102357
35 Ga0068868_101741796 3300005338 Bacteria 588
36 Ga0070660_100001721 3300005339 Bacteria 14994
37 Ga0070660_100005960 3300005339 Bacteria 8425
38 Ga0070660_100034805 3300005339 Bacteria 3808
39 Ga0070660_100802648 3300005339 Bacteria 791
40 Ga0070660_101432911 3300005339 Bacteria 587
41 Ga0070660_101482737 3300005339 Bacteria 577
42 Ga0070660_101618969 3300005339 Bacteria 551
43 Ga0070660_101643999 3300005339 Bacteria 547
44 Ga0070661_100355681 3300005344 Bacteria 1150
45 Ga0070668_100263170 3300005347 Bacteria 1435
46 Ga0070668_100977317 3300005347 Bacteria 760
47 Ga0070669_100057564 3300005353 Bacteria 2852
48 Ga0070669_100257546 3300005353 Bacteria 1391
49 Ga0070669_100361158 3300005353 Bacteria 1181
50 Ga0070669_100712530 3300005353 Bacteria 848
51 Ga0070669_100960262 3300005353 Bacteria 732
52 Ga0070675_100004924 3300005354 Bacteria 10184
53 Ga0070675_101538684 3300005354 Bacteria 614
54 Ga0070675_102185955 3300005354 Bacteria 510
55 Ga0070671_100015851 3300005355 Bacteria 6088
56 Ga0070671_100030875 3300005355 Bacteria 4423
57 Ga0070671_100138219 3300005355 Bacteria 2055
58 Ga0070671_100182639 3300005355 Bacteria 1776
59 Ga0070671_100407935 3300005355 Bacteria 1163
60 Ga0070671_100433634 3300005355 Bacteria 1126
61 Ga0070674_100050254 3300005356 Bacteria 2870
62 Ga0070674_100476626 3300005356 Bacteria 1035
63 Ga0070673_100000017 3300005364 Bacteria 112829
64 Ga0070673_100040812 3300005364 Bacteria 3563
65 Ga0070673_101028306 3300005364 Bacteria 768
66 Ga0070673_101697577 3300005364 Bacteria 598
67 Ga0070659_100007663 3300005366 Bacteria 7851
68 Ga0070659_100273976 3300005366 Bacteria 1403
69 Ga0070659_100419475 3300005366 Bacteria 1132
70 Ga0070659_101172807 3300005366 Bacteria 679
71 Ga0070663_100000796 3300005455 Bacteria 17138
72 Ga0070663_100106883 3300005455 Bacteria 2097
73 Ga0070678_100005853 3300005456 Bacteria 7152
74 Ga0070678_100737431 3300005456 Bacteria 890
75 Ga0070662_100104271 3300005457 Bacteria 2151
76 Ga0070662_100161499 3300005457 Bacteria 1753
77 Ga0070662_100178350 3300005457 Bacteria 1673
78 Ga0070662_101835249 3300005457 Bacteria 524
79 Ga0068867_100000013 3300005459 Bacteria 112835
80 Ga0068867_102398591 3300005459 Bacteria 502
81 Ga0070684_100323850 3300005535 Bacteria 1416
82 Ga0068853_100185614 3300005539 Bacteria 1888
83 Ga0068853_100333791 3300005539 Bacteria 1407
84 Ga0068853_102153386 3300005539 Bacteria 541
85 Ga0070672_100032495 3300005543 Bacteria 3939
86 Ga0070672_100440136 3300005543 Bacteria 1122
87 Ga0070672_101068057 3300005543 Bacteria 717
88 Ga0070665_100000054 3300005548 Bacteria 244426
89 Ga0070665_100228408 3300005548 Bacteria 1861
90 Ga0068855_100004632 3300005563 Bacteria 16781
91 Ga0068855_100217897 3300005563 Bacteria 2142
92 Ga0068854_100160617 3300005578 Bacteria 1740
93 Ga0068854_100185700 3300005578 Bacteria 1626
94 Ga0068854_100642990 3300005578 Bacteria 910
95 Ga0068852_100095492 3300005616 Bacteria 2670
96 Ga0068866_10300652 3300005718 Bacteria 1002
97 Ga0068861_101104097 3300005719 Bacteria 762
98 Ga0068851_10135111 3300005834 Bacteria 1337
99 Ga0068860_102452408 3300005843 Bacteria 541
100 Ga0068862_101383345 3300005844 Bacteria 707
101 Ga0081539_10160254 3300005985 Bacteria 1073
102 Ga0075368_10000738 3300006042 Bacteria 10023
103 Ga0075363_100004373 3300006048 Bacteria 6169
104 Ga0075367_10000051 3300006178 Bacteria 27695
105 Ga0097621_100007233 3300006237 Bacteria 7924
106 Ga0097621_100558145 3300006237 Bacteria 1043
107 Ga0075370_10013772 3300006353 Bacteria 4303
108 Ga0068871_100004525 3300006358 Bacteria 9688
109 Ga0075434_100082782 3300006871 Bacteria 3206
110 Ga0068865_100000007 3300006881 Bacteria 185316
111 Ga0068865_100706960 3300006881 Bacteria 862
112 Ga0111539_10853181 3300009094 Bacteria 1060
113 Ga0105245_10001117 3300009098 Bacteria 24272
114 Ga0105245_10209524 3300009098 Bacteria 1875
115 Ga0105245_10404444 3300009098 Bacteria 1365
116 Ga0114129_11349601 3300009147 Bacteria 882
117 Ga0105243_10000118 3300009148 Bacteria 91438
118 Ga0105243_11513374 3300009148 Bacteria 695
119 Ga0105241_10028659 3300009174 Bacteria 4149
120 Ga0105242_10000196 3300009176 Bacteria 46996
121 Ga0105242_11221472 3300009176 Bacteria 772
122 Ga0105248_10105445 3300009177 Bacteria 3178
123 Ga0105238_10340107 3300009551 Bacteria 1488
124 Ga0105238_13010309 3300009551 Bacteria 506
125 Ga0105249_10018511 3300009553 Bacteria 6200
126 Ga0105249_11298581 3300009553 Bacteria 799
127 Ga0105249_13385419 3300009553 Bacteria 513
128 Ga0105239_10022629 3300010375 Bacteria 6929
129 Ga0105239_10364645 3300010375 Bacteria 1632
130 Ga0105246_10000313 3300011119 Bacteria 25771
131 Ga0157373_10013174 3300013100 Bacteria 6068
132 Ga0157373_10503093 3300013100 Bacteria 875
133 Ga0157373_10808147 3300013100 Bacteria 692
134 Ga0157371_10089856 3300013102 Bacteria 2176
135 Ga0157370_11014984 3300013104 Bacteria 751
136 Ga0157369_10606236 3300013105 Bacteria 1130
137 Ga0157374_10000189 3300013296 Bacteria 57356
138 Ga0157374_10055716 3300013296 Bacteria 3690
139 Ga0157374_12808233 3300013296 Bacteria 515
140 Ga0157378_10000264 3300013297 Bacteria 51230
141 Ga0163162_10106325 3300013306 Bacteria 2901
142 Ga0163162_10315913 3300013306 Bacteria 1695
143 Ga0157372_10167394 3300013307 Bacteria 2542
144 Ga0157372_10179461 3300013307 Bacteria 2451
145 Ga0157372_10210015 3300013307 Bacteria 2256
146 Ga0157372_10269985 3300013307 Bacteria 1976
147 Ga0157375_10000436 3300013308 Bacteria 37738
148 Ga0157375_12102186 3300013308 Bacteria 672
149 Ga0157375_12259492 3300013308 Bacteria 648
150 Ga0157375_12264628 3300013308 Bacteria 648
151 Ga0157375_12801286 3300013308 Bacteria 583
152 Ga0163163_10337195 3300014325 Bacteria 1563
153 Ga0157380_10009069 3300014326 Bacteria 7108
154 Ga0157380_10209759 3300014326 Bacteria 1735
155 Ga0157380_11647571 3300014326 Bacteria 698
156 Ga0157377_10059136 3300014745 Bacteria 2184
157 Ga0157376_10000081 3300014969 Bacteria 72584
158 Ga0163161_10111939 3300017792 Bacteria 2042
159 Ga0163161_10524857 3300017792 Bacteria 967
160 Ga0163161_11404010 3300017792 Bacteria 610
161 Ga0213876_10000395 3300021384 Bacteria 36646
162 Ga0209148_1000074 3300025254 Bacteria 314356
163 Ga0207697_10181002 3300025315 Bacteria 924
164 Ga0207682_10361735 3300025893 Bacteria 684
165 Ga0207642_10674295 3300025899 Bacteria 649
166 Ga0207688_10026793 3300025901 Bacteria 3171
167 Ga0207680_10026423 3300025903 Bacteria 3219
168 Ga0207647_10325721 3300025904 Bacteria 872
169 Ga0207645_10004550 3300025907 Bacteria 10242
170 Ga0207705_10008276 3300025909 Bacteria 7596
171 Ga0207705_10022603 3300025909 Bacteria 4485
172 Ga0207705_10101177 3300025909 Bacteria 2120
173 Ga0207654_10033486 3300025911 Bacteria 2848
174 Ga0207671_11585948 3300025914 Bacteria 504
175 Ga0207657_10001650 3300025919 Bacteria 24065
176 Ga0207657_10002766 3300025919 Bacteria 18890
177 Ga0207657_10010636 3300025919 Bacteria 9165
178 Ga0207657_10418254 3300025919 Bacteria 1054
179 Ga0207657_10453283 3300025919 Bacteria 1006
180 Ga0207657_10457381 3300025919 Bacteria 1001
181 Ga0207657_10490226 3300025919 Bacteria 963
182 Ga0207649_10552968 3300025920 Bacteria 881
183 Ga0207681_10285371 3300025923 Bacteria 1301
184 Ga0207694_10845437 3300025924 Bacteria 773
185 Ga0207659_10014092 3300025926 Bacteria 5148
186 Ga0207687_10001736 3300025927 Bacteria 15019
187 Ga0207687_10258383 3300025927 Bacteria 1387
188 Ga0207687_10273947 3300025927 Bacteria 1350
189 Ga0207644_10022730 3300025931 Bacteria 4287
190 Ga0207644_10031407 3300025931 Bacteria 3700
191 Ga0207644_10102316 3300025931 Bacteria 2154
192 Ga0207644_10320113 3300025931 Bacteria 1254
193 Ga0207644_10592049 3300025931 Bacteria 920
194 Ga0207644_10635105 3300025931 Bacteria 888
195 Ga0207690_10055917 3300025932 Bacteria 2660
196 Ga0207690_10172209 3300025932 Bacteria 1623
197 Ga0207690_10257958 3300025932 Bacteria 1349
198 Ga0207706_10023424 3300025933 Bacteria 5545
199 Ga0207706_10034827 3300025933 Bacteria 4479
200 Ga0207706_10184239 3300025933 Bacteria 1834
201 Ga0207706_10563671 3300025933 Bacteria 980
202 Ga0207686_10000260 3300025934 Bacteria 39872
203 Ga0207709_10000156 3300025935 Bacteria 93099
204 Ga0207709_10897331 3300025935 Bacteria 720
205 Ga0207669_10054712 3300025937 Bacteria 2412
206 Ga0207669_10940216 3300025937 Bacteria 724
207 Ga0207704_10000017 3300025938 Bacteria 154190
208 Ga0207704_10265723 3300025938 Bacteria 1296
209 Ga0207691_10189471 3300025940 Bacteria 1794
210 Ga0207691_10190213 3300025940 Bacteria 1790
211 Ga0207691_10943163 3300025940 Bacteria 721
212 Ga0207689_10002708 3300025942 Bacteria 16386
213 Ga0207661_10191565 3300025944 Bacteria 1793
214 Ga0207679_11932019 3300025945 Bacteria 538
215 Ga0207667_10000071 3300025949 Bacteria 178355
216 Ga0207667_10305647 3300025949 Bacteria 1625
217 Ga0207651_10000011 3300025960 Bacteria 191950
218 Ga0207651_10048133 3300025960 Bacteria 2880
219 Ga0207712_10059402 3300025961 Bacteria 2706
220 Ga0207668_10072402 3300025972 Bacteria 2466
221 Ga0207668_10277181 3300025972 Bacteria 1373
222 Ga0207640_10000131 3300025981 Bacteria 56277
223 Ga0207640_10058270 3300025981 Bacteria 2544
224 Ga0207640_10116064 3300025981 Bacteria 1908
225 Ga0207640_10170592 3300025981 Bacteria 1621
226 Ga0207677_10000173 3300026023 Bacteria 50916
227 Ga0207639_10011588 3300026041 Bacteria 6126
228 Ga0207639_10013052 3300026041 Bacteria 5800
229 Ga0207639_10023336 3300026041 Bacteria 4467
230 Ga0207639_10821587 3300026041 Bacteria 867
231 Ga0207678_10010633 3300026067 Bacteria 8084
232 Ga0207678_10135892 3300026067 Bacteria 2098
233 Ga0207678_11027497 3300026067 Bacteria 730
234 Ga0207648_10000045 3300026089 Bacteria 111963
235 Ga0207683_10002781 3300026121 Bacteria 15279
236 Ga0207683_10582733 3300026121 Bacteria 1035
237 Ga0207698_10071012 3300026142 Bacteria 2761
238 Ga0209813_10000172 3300027866 Bacteria 21011
239 Ga0268266_10000414 3300028379 Bacteria 65028
240 Ga0268264_11920209 3300028381 Bacteria 602
241 Ga0307408_100051620 3300031548 Bacteria 2963
242 Ga0307408_101117295 3300031548 Bacteria 732
243 Ga0307413_10031246 3300031824 Bacteria 3002
244 Ga0307413_10346689 3300031824 Bacteria 1144
245 Ga0307413_10430855 3300031824 Bacteria 1041
246 Ga0307413_11518641 3300031824 Bacteria 593
247 Ga0307410_10121781 3300031852 Bacteria 1903
248 Ga0307410_11898304 3300031852 Bacteria 530
249 Ga0307406_10571180 3300031901 Bacteria 928
250 Ga0307406_11224022 3300031901 Bacteria 653
251 Ga0307407_10059620 3300031903 Bacteria 2223
252 Ga0307407_10515945 3300031903 Bacteria 878
253 Ga0307412_10399411 3300031911 Bacteria 1118
254 Ga0307412_11325809 3300031911 Bacteria 649
255 Ga0307412_11755925 3300031911 Bacteria 570
256 Ga0307409_100058597 3300031995 Bacteria 2992
257 Ga0307409_100721984 3300031995 Bacteria 998
258 Ga0307409_101563342 3300031995 Bacteria 687
259 Ga0307409_101583950 3300031995 Bacteria 683
260 Ga0307409_101884796 3300031995 Bacteria 627
261 Ga0307416_100897186 3300032002 Bacteria 986
262 Ga0307416_101469257 3300032002 Bacteria 787
263 Ga0307416_101948618 3300032002 Bacteria 690
264 Ga0307416_103156936 3300032002 Bacteria 551
265 Ga0307414_10203166 3300032004 Bacteria 1613
266 Ga0307414_10226149 3300032004 Bacteria 1539
267 Ga0307414_10779059 3300032004 Bacteria 871
268 Ga0307414_10857970 3300032004 Bacteria 831
269 Ga0307414_11428274 3300032004 Bacteria 643
270 Ga0307411_10020705 3300032005 Bacteria 3833
271 Ga0307411_10055105 3300032005 Bacteria 2614
272 Ga0307411_10189754 3300032005 Bacteria 1568
273 Ga0307411_10336607 3300032005 Bacteria 1225
274 Ga0307411_10547000 3300032005 Bacteria 987
275 Ga0307415_100183622 3300032126 Bacteria 1644
276 Ga0307415_100282798 3300032126 Bacteria 1365
277 Ga0307415_100331610 3300032126 Bacteria 1273
278 Ga0307415_100410493 3300032126 Bacteria 1159
279 Ga0395900_0200102 3300037418 Bacteria 2022
280 Ga0395905_0101978 3300037471 Bacteria 2694
281 Ga0395905_0513682 3300037471 Bacteria 1098
282 Ga0395905_0952917 3300037471 Bacteria 761
283 Ga0436365_0487522 3300039437 Bacteria 55925
284 Ga0436363_0832178 3300039450 Bacteria 1289
285 Ga0451795_0686472 3300041456 Bacteria 698
286 Ga0451853_1168434 3300041512 Bacteria 861
287 Ga0439448_0000295 3300042005 Bacteria 10965
288 Ga0439455_0003190 3300042012 Bacteria 3100
289 Ga0466970_0799415 3300044765 Bacteria 552
290 Ga0466967_0186458 3300045976 Bacteria 1959
291 Ga0495583_0296729 3300046506 Bacteria 642
292 Ga0495606_0253405 3300046507 Bacteria 975
293 Ga0495620_0159057 3300046515 Bacteria 878
294 Ga0495663_0034750 3300046525 Bacteria 1511
295 Ga0495663_0234089 3300046525 Bacteria 648
296 Ga0495642_0220759 3300046528 Bacteria 827
297 Ga0495597_0330625 3300046542 Bacteria 587
298 Ga0495669_0052584 3300046684 Bacteria 1830
299 Ga0495670_0014290 3300046691 Bacteria 3905
300 Ga0495683_0293634 3300047323 Bacteria 700
301 Ga0495677_0030228 3300047445 Bacteria 1971
302 Ga0495685_156115 3300047447 Bacteria 740
303 Ga0496106_0752176 3300048909 Bacteria 775
304 Ga0496114_1165812 3300048917 Bacteria 656
305 Ga0496115_0000444 3300048918 Bacteria 33537
306 Ga0496119_0356570 3300048922 Bacteria 707
307 Ga0496121_0039362 3300048924 Bacteria 4169
308 Ga0496121_0492406 3300048924 Bacteria 780
309 Ga0496122_0262325 3300048925 Bacteria 958
310 Ga0501334_14865 3300049550 Bacteria 592
311 Ga0501047_0535895 3300049581 Bacteria 996
312 nmdc:mga03n38_4607_c1 3300050490 Bacteria 4590
313 nmdc:mga06z11_715_c1 3300050494 Bacteria 12079
314 nmdc:mga04h51_259_c1 3300050495 Bacteria 13806
315 nmdc:mga07m45_55882_c1 3300050496 Bacteria 2231
316 Ga0590071_059368 3300059421 Bacteria 933
317 Ga0587084_041860 3300059477 Bacteria 781
318 Ga0587073_0017066 3300059492 Bacteria 1335
319 Ga0587080_104152 3300059503 Bacteria 611
320 Ga0587082_049018 3300059504 Bacteria 800
321 Ga0587086_115859 3300059507 Bacteria 508
322 Ga0587090_046949 3300059510 Bacteria 779
323 Ga0587090_061611 3300059510 Bacteria 713
324 Ga0587091_028492 3300059511 Bacteria 1031
325 Ga0587069_100485 3300059642 Bacteria 590
326 Ga0307408_101201574
327 SwRhRL2b_contig_51293
328 JGI24740J21852_10011890
329 JGI24739J22299_10053166
330 JGI24739J22299_10123760
331 JGI24737J22298_10003788
332 JGI24737J22298_10016268
333 JGI24737J22298_10077812
334 JGI24737J22298_10081454
335 JGI24743J22301_10004441
336 JGI24735J21928_10003655
337 JGI24735J21928_10009264
338 JGI24735J21928_10024579
339 JGI24738J21930_10005348
340 JGI24744J21845_10009128
341 JGI24742J22300_10024440
342 Ga0007409J51694_1090716
343 Ga0032354_1074644
344 Ga0032354_1140177
345 Ga0055542_1001687
346 Ga0065707_10263238
347 Ga0070658_10008484
348 Ga0070658_10103924
349 Ga0070658_10821426
350 Ga0070676_10000539
351 Ga0070683_100124568
352 Ga0070683_101154158
353 Ga0070683_101463224
354 Ga0070690_100365302
355 Ga0070690_101631493
356 Ga0070677_10018061
357 Ga0068869_100000897
358 Ga0070666_10145818
359 Ga0068868_100000016
360 Ga0068868_101741796
361 Ga0070660_100001721
362 Ga0070660_100005960
363 Ga0070660_100034805
364 Ga0070660_100802648
365 Ga0070660_101432911
366 Ga0070660_101482737
367 Ga0070660_101618969
368 Ga0070660_101643999
369 Ga0070661_100355681
370 Ga0070668_100263170
371 Ga0070668_100977317
372 Ga0070669_100057564
373 Ga0070669_100257546
374 Ga0070669_100361158
375 Ga0070669_100712530
376 Ga0070669_100960262
377 Ga0070675_100004924
378 Ga0070675_101538684
379 Ga0070675_102185955
380 Ga0070671_100015851
381 Ga0070671_100030875
382 Ga0070671_100138219
383 Ga0070671_100182639
384 Ga0070671_100407935
385 Ga0070671_100433634
386 Ga0070674_100050254
387 Ga0070674_100476626
388 Ga0070673_100000017
389 Ga0070673_100040812
390 Ga0070673_101028306
391 Ga0070673_101697577
392 Ga0070659_100007663
393 Ga0070659_100273976
394 Ga0070659_100419475
395 Ga0070659_101172807
396 Ga0070663_100000796
397 Ga0070663_100106883
398 Ga0070678_100005853
399 Ga0070678_100737431
400 Ga0070662_100104271
401 Ga0070662_100161499
402 Ga0070662_100178350
403 Ga0070662_101835249
404 Ga0068867_100000013
405 Ga0068867_102398591
406 Ga0070684_100323850
407 Ga0068853_100185614
408 Ga0068853_100333791
409 Ga0068853_102153386
410 Ga0070672_100032495
411 Ga0070672_100440136
412 Ga0070672_101068057
413 Ga0070665_100000054
414 Ga0070665_100228408
415 Ga0068855_100004632
416 Ga0068855_100217897
417 Ga0068854_100160617
418 Ga0068854_100185700
419 Ga0068854_100642990
420 Ga0068852_100095492
421 Ga0068866_10300652
422 Ga0068861_101104097
423 Ga0068851_10135111
424 Ga0068860_102452408
425 Ga0068862_101383345
426 Ga0081539_10160254
427 Ga0075368_10000738
428 Ga0075363_100004373
429 Ga0075367_10000051
430 Ga0097621_100007233
431 Ga0097621_100558145
432 Ga0075370_10013772
433 Ga0068871_100004525
434 Ga0075434_100082782
435 Ga0068865_100000007
436 Ga0068865_100706960
437 Ga0111539_10853181
438 Ga0105245_10001117
439 Ga0105245_10209524
440 Ga0105245_10404444
441 Ga0114129_11349601
442 Ga0105243_10000118
443 Ga0105243_11513374
444 Ga0105241_10028659
445 Ga0105242_10000196
446 Ga0105242_11221472
447 Ga0105248_10105445
448 Ga0105238_10340107
449 Ga0105238_13010309
450 Ga0105249_10018511
451 Ga0105249_11298581
452 Ga0105249_13385419
453 Ga0105239_10022629
454 Ga0105239_10364645
455 Ga0105246_10000313
456 Ga0157373_10013174
457 Ga0157373_10503093
458 Ga0157373_10808147
459 Ga0157371_10089856
460 Ga0157370_11014984
461 Ga0157369_10606236
462 Ga0157374_10000189
463 Ga0157374_10055716
464 Ga0157374_12808233
465 Ga0157378_10000264
466 Ga0163162_10106325
467 Ga0163162_10315913
468 Ga0157372_10167394
469 Ga0157372_10179461
470 Ga0157372_10210015
471 Ga0157372_10269985
472 Ga0157375_10000436
473 Ga0157375_12102186
474 Ga0157375_12259492
475 Ga0157375_12264628
476 Ga0157375_12801286
477 Ga0163163_10337195
478 Ga0157380_10009069
479 Ga0157380_10209759
480 Ga0157380_11647571
481 Ga0157377_10059136
482 Ga0157376_10000081
483 Ga0163161_10111939
484 Ga0163161_10524857
485 Ga0163161_11404010
486 Ga0213876_10000395
487 Ga0209148_1000074
488 Ga0207697_10181002
489 Ga0207682_10361735
490 Ga0207642_10674295
491 Ga0207688_10026793
492 Ga0207680_10026423
493 Ga0207647_10325721
494 Ga0207645_10004550
495 Ga0207705_10008276
496 Ga0207705_10022603
497 Ga0207705_10101177
498 Ga0207654_10033486
499 Ga0207671_11585948
500 Ga0207657_10001650
501 Ga0207657_10002766
502 Ga0207657_10010636
503 Ga0207657_10418254
504 Ga0207657_10453283
505 Ga0207657_10457381
506 Ga0207657_10490226
507 Ga0207649_10552968
508 Ga0207681_10285371
509 Ga0207694_10845437
510 Ga0207659_10014092
511 Ga0207687_10001736
512 Ga0207687_10258383
513 Ga0207687_10273947
514 Ga0207644_10022730
515 Ga0207644_10031407
516 Ga0207644_10102316
517 Ga0207644_10320113
518 Ga0207644_10592049
519 Ga0207644_10635105
520 Ga0207690_10055917
521 Ga0207690_10172209
522 Ga0207690_10257958
523 Ga0207706_10023424
524 Ga0207706_10034827
525 Ga0207706_10184239
526 Ga0207706_10563671
527 Ga0207686_10000260
528 Ga0207709_10000156
529 Ga0207709_10897331
530 Ga0207669_10054712
531 Ga0207669_10940216
532 Ga0207704_10000017
533 Ga0207704_10265723
534 Ga0207691_10189471
535 Ga0207691_10190213
536 Ga0207691_10943163
537 Ga0207689_10002708
538 Ga0207661_10191565
539 Ga0207679_11932019
540 Ga0207667_10000071
541 Ga0207667_10305647
542 Ga0207651_10000011
543 Ga0207651_10048133
544 Ga0207712_10059402
545 Ga0207668_10072402
546 Ga0207668_10277181
547 Ga0207640_10000131
548 Ga0207640_10058270
549 Ga0207640_10116064
550 Ga0207640_10170592
551 Ga0207677_10000173
552 Ga0207639_10011588
553 Ga0207639_10013052
554 Ga0207639_10023336
555 Ga0207639_10821587
556 Ga0207678_10010633
557 Ga0207678_10135892
558 Ga0207678_11027497
559 Ga0207648_10000045
560 Ga0207683_10002781
561 Ga0207683_10582733
562 Ga0207698_10071012
563 Ga0209813_10000172
564 Ga0268266_10000414
565 Ga0268264_11920209
566 Ga0307408_100051620
567 Ga0307408_101117295
568 Ga0307413_10031246
569 Ga0307413_10346689
570 Ga0307413_10430855
571 Ga0307413_11518641
572 Ga0307410_10121781
573 Ga0307410_11898304
574 Ga0307406_10571180
575 Ga0307406_11224022
576 Ga0307407_10059620
577 Ga0307407_10515945
578 Ga0307412_10399411
579 Ga0307412_11325809
580 Ga0307412_11755925
581 Ga0307409_100058597
582 Ga0307409_100721984
583 Ga0307409_101563342
584 Ga0307409_101583950
585 Ga0307409_101884796
586 Ga0307416_100897186
587 Ga0307416_101469257
588 Ga0307416_101948618
589 Ga0307416_103156936
590 Ga0307414_10203166
591 Ga0307414_10226149
592 Ga0307414_10779059
593 Ga0307414_10857970
594 Ga0307414_11428274
595 Ga0307411_10020705
596 Ga0307411_10055105
597 Ga0307411_10189754
598 Ga0307411_10336607
599 Ga0307411_10547000
600 Ga0307415_100183622
601 Ga0307415_100282798
602 Ga0307415_100331610
603 Ga0307415_100410493
604 Ga0395900_0200102
605 Ga0395905_0101978
606 Ga0395905_0513682
607 Ga0395905_0952917
608 Ga0436365_0487522
609 Ga0436363_0832178
610 Ga0451795_0686472
611 Ga0451853_1168434
612 Ga0439448_0000295
613 Ga0439455_0003190
614 Ga0466970_0799415
615 Ga0466967_0186458
616 Ga0495583_0296729
617 Ga0495606_0253405
618 Ga0495620_0159057
619 Ga0495663_0034750
620 Ga0495663_0234089
621 Ga0495642_0220759
622 Ga0495597_0330625
623 Ga0495669_0052584
624 Ga0495670_0014290
625 Ga0495683_0293634
626 Ga0495677_0030228
627 Ga0495685_156115
628 Ga0496106_0752176
629 Ga0496114_1165812
630 Ga0496115_0000444
631 Ga0496119_0356570
632 Ga0496121_0039362
633 Ga0496121_0492406
634 Ga0496122_0262325
635 Ga0501334_14865
636 Ga0501047_0535895
637 nmdc:mga03n38_4607_c1
638 nmdc:mga06z11_715_c1
639 nmdc:mga04h51_259_c1
640 nmdc:mga07m45_55882_c1
641 Ga0590071_059368
642 Ga0587084_041860
643 Ga0587073_0017066
644 Ga0587080_104152
645 Ga0587082_049018
646 Ga0587086_115859
647 Ga0587090_046949
648 Ga0587090_061611
649 Ga0587091_028492
650 Ga0587069_100485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06667

PspB

Phage shock protein B

2

74

0.96

Map