F407886

General Info

Members Datasets Scaffolds Average Seq Length
325 232 650 240

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1022458|Ga0265337_10224582
Length 268
Sequence MADCAAVFRLTTGWGSAHVSNVTDYAMTQNIYDNDEFFAGYSRLGRSVEGLDGAAEWPSLRAMLPEMQGLKVLDLGCGFGWFCRWARAHGAAQVLGVDVSERMLARAQADTPDPAITYTRADLEMLELPPASFDVVYSSLAFHYIAGLDRLMSQLHQSLRPGGRLVFSAEHPIYTAPSEPGWSLDAAGQKSWPVNDYLREGPRSTDWLTRGVIKQHRTLATYINMLLRLRFVLNRIEEWAPTGQQIAARPELADELHRPMFLLVSARR

Samples

Sample ID Description Type Environment
1 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
130 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
198 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
199 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
200 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
201 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
202 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
203 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
204 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
205 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
206 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
207 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
208 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
209 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
210 2643221607 Rhizobium sp. Root73 Isolate Unclassified
211 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
212 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
213 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
214 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
215 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
216 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
217 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
218 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
219 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
220 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
221 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
222 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
223 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
224 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
225 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
226 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
227 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
228 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
229 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
230 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
231 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
232 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.92
Metatranscriptomes 0
Isolates 11.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.92
Nodule 7.69
Rhizoplane 4.31
Rhizosphere 76.92
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265337_1022458 3300028556 Bacteria 1953
2 Ga0070676_10315457 3300005328 Bacteria 1064
3 Ga0070683_100023858 3300005329 Bacteria 5475
4 Ga0070680_100000973 3300005336 Bacteria 20303
5 Ga0070660_100085218 3300005339 Bacteria 2484
6 Ga0070689_100080334 3300005340 Bacteria 2559
7 Ga0070668_100095789 3300005347 Bacteria 2345
8 Ga0070669_100233071 3300005353 Bacteria 1460
9 Ga0070675_100189170 3300005354 Bacteria 1783
10 Ga0070674_100519773 3300005356 Bacteria 994
11 Ga0070688_100189747 3300005365 Bacteria 1431
12 Ga0070709_10010506 3300005434 Bacteria 5131
13 Ga0070709_10174948 3300005434 Bacteria 1503
14 Ga0070714_100106756 3300005435 Bacteria 2474
15 Ga0070714_100160640 3300005435 Bacteria 2033
16 Ga0070714_100337068 3300005435 Bacteria 1413
17 Ga0070713_100115670 3300005436 Bacteria 2344
18 Ga0070710_10003878 3300005437 Bacteria 7079
19 Ga0070711_100020093 3300005439 Bacteria 4298
20 Ga0070711_100180849 3300005439 Bacteria 1614
21 Ga0070708_100192288 3300005445 Bacteria 1909
22 Ga0070678_100077729 3300005456 Bacteria 2505
23 Ga0070681_10002983 3300005458 Bacteria 15701
24 Ga0070681_10062606 3300005458 Bacteria 3694
25 Ga0070681_10579700 3300005458 Bacteria 1036
26 Ga0070706_100020924 3300005467 Bacteria 6023
27 Ga0070707_100042093 3300005468 Bacteria 4372
28 Ga0070707_100053199 3300005468 Bacteria 3881
29 Ga0070698_100038546 3300005471 Bacteria 4924
30 Ga0070698_100522261 3300005471 Bacteria 1126
31 Ga0070699_100008193 3300005518 Bacteria 9067
32 Ga0070699_100842796 3300005518 Bacteria 839
33 Ga0070679_100004292 3300005530 Bacteria 13155
34 Ga0070679_100234132 3300005530 Bacteria 1796
35 Ga0070697_100268544 3300005536 Bacteria 1462
36 Ga0070697_100427526 3300005536 Bacteria 1151
37 Ga0070672_100608982 3300005543 Bacteria 952
38 Ga0070686_100202250 3300005544 Bacteria 1424
39 Ga0070695_100096571 3300005545 Bacteria 1983
40 Ga0070696_100144378 3300005546 Bacteria 1742
41 Ga0070665_100129789 3300005548 Bacteria 2523
42 Ga0068855_100004843 3300005563 Bacteria 16428
43 Ga0070664_100146644 3300005564 Bacteria 2081
44 Ga0070664_100283866 3300005564 Bacteria 1493
45 Ga0068857_100008905 3300005577 Bacteria 8694
46 Ga0068856_100059710 3300005614 Bacteria 3767
47 Ga0068856_100250469 3300005614 Bacteria 1786
48 Ga0068856_100619053 3300005614 Bacteria 1103
49 Ga0068859_100550138 3300005617 Bacteria 1249
50 Ga0068864_100243323 3300005618 Bacteria 1667
51 Ga0068861_100216889 3300005719 Bacteria 1615
52 Ga0081455_10035783 3300005937 Bacteria 4431
53 Ga0070717_10095413 3300006028 Bacteria 2517
54 Ga0070717_10127299 3300006028 Bacteria 2187
55 Ga0075365_10014191 3300006038 Bacteria 4787
56 Ga0075363_100063533 3300006048 Bacteria 1993
57 Ga0070715_10004643 3300006163 Bacteria 4530
58 Ga0070716_100000343 3300006173 Bacteria 18882
59 Ga0070716_100523188 3300006173 Bacteria 879
60 Ga0070712_100040659 3300006175 Bacteria 3189
61 Ga0070712_100040899 3300006175 Bacteria 3180
62 Ga0070712_100470992 3300006175 Bacteria 1049
63 Ga0075362_10004988 3300006177 Bacteria 4814
64 Ga0075370_10000997 3300006353 Bacteria 11693
65 Ga0075370_10283589 3300006353 Bacteria 984
66 Ga0075428_100421623 3300006844 Bacteria 1430
67 Ga0075430_100000577 3300006846 Bacteria 27863
68 Ga0075430_100434792 3300006846 Bacteria 1083
69 Ga0075431_100056108 3300006847 Bacteria 4063
70 Ga0075431_100059037 3300006847 Bacteria 3959
71 Ga0075434_100028589 3300006871 Bacteria 5480
72 Ga0075434_100030541 3300006871 Bacteria 5306
73 Ga0075436_100019644 3300006914 Bacteria 4631
74 Ga0075436_100053720 3300006914 Bacteria 2781
75 Ga0075436_100062769 3300006914 Bacteria 2568
76 Ga0075436_100065678 3300006914 Bacteria 2507
77 Ga0097620_100550121 3300006931 Bacteria 1249
78 Ga0075435_100025250 3300007076 Bacteria 4623
79 Ga0075435_100524752 3300007076 Bacteria 1024
80 Ga0105240_10009483 3300009093 Bacteria 13781
81 Ga0114129_10011336 3300009147 Bacteria 12698
82 Ga0114129_10098199 3300009147 Bacteria 4053
83 Ga0105241_10011448 3300009174 Bacteria 6502
84 Ga0105241_10240532 3300009174 Bacteria 1530
85 Ga0105237_10151440 3300009545 Bacteria 2316
86 Ga0105238_10030585 3300009551 Bacteria 5481
87 Ga0105238_10092490 3300009551 Bacteria 3012
88 Ga0105238_10125199 3300009551 Bacteria 2549
89 Ga0105249_10308820 3300009553 Bacteria 1589
90 Ga0099796_10040424 3300010159 Bacteria 1574
91 Ga0157370_10087133 3300013104 Bacteria 2933
92 Ga0157374_10672771 3300013296 Bacteria 1047
93 Ga0163162_10007962 3300013306 Bacteria 10330
94 Ga0157372_10594128 3300013307 Bacteria 1290
95 Ga0157375_10431257 3300013308 Bacteria 1484
96 Ga0163163_10022069 3300014325 Bacteria 6020
97 Ga0163163_10034677 3300014325 Bacteria 4890
98 Ga0213874_10007199 3300021377 Bacteria 2662
99 Ga0213871_10068412 3300021441 Bacteria 1000
100 Ga0207426_1005914 3300025302 Bacteria 5435
101 Ga0207692_10002573 3300025898 Bacteria 6972
102 Ga0207692_10292783 3300025898 Bacteria 988
103 Ga0207685_10022637 3300025905 Bacteria 2127
104 Ga0207699_10001431 3300025906 Bacteria 11322
105 Ga0207699_10052337 3300025906 Bacteria 2416
106 Ga0207699_10226680 3300025906 Bacteria 1278
107 Ga0207645_10113243 3300025907 Bacteria 1757
108 Ga0207705_10006086 3300025909 Bacteria 8978
109 Ga0207654_10032148 3300025911 Bacteria 2896
110 Ga0207707_10005856 3300025912 Bacteria 10744
111 Ga0207695_10078415 3300025913 Bacteria 3351
112 Ga0207693_10013106 3300025915 Bacteria 6689
113 Ga0207693_10046535 3300025915 Bacteria 3408
114 Ga0207693_10083468 3300025915 Bacteria 2503
115 Ga0207663_10021083 3300025916 Bacteria 3703
116 Ga0207663_10184099 3300025916 Bacteria 1494
117 Ga0207652_10005580 3300025921 Bacteria 10197
118 Ga0207652_10092522 3300025921 Bacteria 2660
119 Ga0207646_10045444 3300025922 Bacteria 3943
120 Ga0207646_10276974 3300025922 Bacteria 1516
121 Ga0207681_10059359 3300025923 Bacteria 2622
122 Ga0207694_10140211 3300025924 Bacteria 1944
123 Ga0207659_10191019 3300025926 Bacteria 1630
124 Ga0207700_10035816 3300025928 Bacteria 3578
125 Ga0207700_10091557 3300025928 Bacteria 2402
126 Ga0207700_10123682 3300025928 Bacteria 2101
127 Ga0207700_10224837 3300025928 Bacteria 1593
128 Ga0207664_10015461 3300025929 Bacteria 5541
129 Ga0207664_10107650 3300025929 Bacteria 2313
130 Ga0207664_10170270 3300025929 Bacteria 1864
131 Ga0207670_10128673 3300025936 Bacteria 1851
132 Ga0207704_10206037 3300025938 Bacteria 1443
133 Ga0207665_10000505 3300025939 Bacteria 26426
134 Ga0207665_10003233 3300025939 Bacteria 10913
135 Ga0207665_10026951 3300025939 Bacteria 3796
136 Ga0207691_10231361 3300025940 Bacteria 1600
137 Ga0207691_10668231 3300025940 Bacteria 877
138 Ga0207679_10144954 3300025945 Bacteria 1925
139 Ga0207667_10006574 3300025949 Bacteria 14066
140 Ga0207667_10174574 3300025949 Bacteria 2208
141 Ga0207712_10846417 3300025961 Bacteria 806
142 Ga0207668_10191167 3300025972 Bacteria 1622
143 Ga0207640_10093225 3300025981 Bacteria 2092
144 Ga0207658_10310894 3300025986 Bacteria 1361
145 Ga0207677_10199886 3300026023 Bacteria 1588
146 Ga0207702_10013733 3300026078 Bacteria 6728
147 Ga0207702_10023566 3300026078 Bacteria 5106
148 Ga0207702_10085818 3300026078 Bacteria 2744
149 Ga0207674_10018622 3300026116 Bacteria 7543
150 Ga0207674_10152745 3300026116 Bacteria 2265
151 Ga0207675_100185224 3300026118 Bacteria 1995
152 Ga0207683_10007813 3300026121 Bacteria 9153
153 Ga0268266_10178093 3300028379 Bacteria 1934
154 Ga0268265_10969027 3300028380 Bacteria 839
155 Ga0307515_10112535 3300028794 Bacteria 3165
156 Ga0265338_10049641 3300028800 Bacteria 3801
157 Ga0265338_10280175 3300028800 Unclassified 1218
158 Ga0265339_10068550 3300031249 Bacteria 1895
159 Ga0307408_100030818 3300031548 Bacteria 3727
160 Ga0265314_10000027 3300031711 Bacteria 278331
161 Ga0307409_100429264 3300031995 Bacteria 1270
162 Ga0307416_100260132 3300032002 Bacteria 1696
163 Ga0307416_100428538 3300032002 Bacteria 1369
164 Ga0373948_0035901 3300034817 Bacteria 1019
165 Ga0373943_0209478 3300035170 Bacteria 1082
166 Ga0373946_0261680 3300035171 Bacteria 847
167 Ga0373931_0005358 3300035691 Bacteria 5920
168 Ga0373927_0059453 3300035695 Bacteria 2472
169 Ga0373947_0294152 3300035725 Bacteria 1082
170 Ga0373947_0354994 3300035725 Bacteria 984
171 Ga0373937_0108587 3300036401 Bacteria 2580
172 Ga0373925_0203308 3300037068 Bacteria 1576
173 Ga0373925_0249633 3300037068 Bacteria 1423
174 Ga0373925_0449213 3300037068 Bacteria 1055
175 Ga0395899_0002903 3300037312 Bacteria 13771
176 Ga0395899_0015534 3300037312 Bacteria 5805
177 Ga0395899_0050058 3300037312 Bacteria 3103
178 Ga0395900_0005679 3300037418 Bacteria 13045
179 Ga0395900_0006761 3300037418 Bacteria 11902
180 Ga0395900_0067254 3300037418 Bacteria 3681
181 Ga0395900_0096740 3300037418 Bacteria 3033
182 Ga0395898_0018449 3300037466 Bacteria 7114
183 Ga0395898_0028072 3300037466 Bacteria 5643
184 Ga0395905_0100349 3300037471 Bacteria 2718
185 Ga0395905_0678913 3300037471 Bacteria 932
186 Ga0395901_0000593 3300038443 Bacteria 42246
187 Ga0395901_0006737 3300038443 Bacteria 11605
188 Ga0395901_0042418 3300038443 Bacteria 4716
189 Ga0436365_1700360 3300039437 Bacteria 1512
190 Ga0436360_0047776 3300039438 Bacteria 920
191 Ga0436360_0437528 3300039438 Bacteria 2321
192 Ga0436360_1094594 3300039438 Bacteria 3694
193 Ga0436361_0950302 3300039447 Bacteria 1600
194 Ga0436363_0263938 3300039450 Bacteria 3189
195 Ga0436362_0044031 3300039453 Bacteria 2608
196 Ga0436362_0873022 3300039453 Bacteria 1989
197 Ga0451855_0261553 3300041511 Bacteria 814
198 Ga0439460_0006157 3300042461 Bacteria 2966
199 Ga0453683_0131862 3300044673 Bacteria 1575
200 Ga0466957_0046952 3300044842 Bacteria 2623
201 Ga0451576_0369500 3300045051 Bacteria 1503
202 Ga0466967_0199228 3300045976 Bacteria 1896
203 Ga0466967_0316821 3300045976 Bacteria 1503
204 Ga0495592_0256203 3300046454 Bacteria 1154
205 Ga0495580_0055712 3300046472 Bacteria 2785
206 Ga0495606_0035875 3300046507 Bacteria 3385
207 Ga0495610_0084588 3300046512 Bacteria 1449
208 Ga0495618_0205132 3300046514 Bacteria 1247
209 Ga0495632_0048289 3300046519 Bacteria 2108
210 Ga0495643_0029508 3300046522 Bacteria 3068
211 Ga0495633_0045101 3300046558 Bacteria 2088
212 Ga0495656_0074098 3300046615 Bacteria 1520
213 Ga0495668_0105253 3300046616 Bacteria 1543
214 Ga0495625_0030975 3300046660 Bacteria 3983
215 Ga0495625_0065928 3300046660 Bacteria 2551
216 Ga0495599_0185766 3300046678 Bacteria 1280
217 Ga0495669_0024468 3300046684 Bacteria 2630
218 Ga0495670_0088570 3300046691 Bacteria 1582
219 Ga0495681_0148715 3300047470 Bacteria 984
220 Ga0495686_0116062 3300047472 Bacteria 1600
221 Ga0495626_0052648 3300048091 Bacteria 1876
222 Ga0496103_0057801 3300048906 Bacteria 2409
223 Ga0496106_0066708 3300048909 Bacteria 2742
224 Ga0496108_0094404 3300048911 Bacteria 2546
225 Ga0496109_0133043 3300048912 Bacteria 2322
226 Ga0496110_0012046 3300048913 Bacteria 7104
227 Ga0496110_0741648 3300048913 Bacteria 885
228 Ga0496111_0232028 3300048914 Bacteria 1371
229 Ga0496112_0002243 3300048915 Bacteria 15440
230 Ga0496112_0034506 3300048915 Bacteria 4924
231 Ga0496112_0257409 3300048915 Bacteria 1695
232 Ga0496113_0083292 3300048916 Bacteria 2454
233 Ga0496113_0139861 3300048916 Bacteria 1904
234 Ga0496114_0066752 3300048917 Bacteria 3017
235 Ga0496115_0027482 3300048918 Bacteria 4451
236 Ga0496116_0101875 3300048919 Bacteria 1713
237 Ga0496119_0131139 3300048922 Bacteria 1365
238 Ga0496120_0103148 3300048923 Bacteria 1503
239 Ga0496121_0299485 3300048924 Bacteria 1092
240 Ga0496122_0001028 3300048925 Bacteria 49218
241 Ga0496123_0000763 3300048926 Bacteria 52065
242 Ga0496124_0231383 3300048927 Bacteria 1382
243 Ga0496124_0258086 3300048927 Bacteria 1284
244 Ga0496126_0055450 3300048929 Bacteria 3586
245 Ga0501033_0268648 3300049570 Bacteria 1206
246 Ga0501034_0012574 3300049571 Bacteria 8737
247 Ga0501034_0118257 3300049571 Bacteria 2637
248 Ga0501034_0144094 3300049571 Bacteria 2360
249 Ga0501034_0237818 3300049571 Bacteria 1768
250 Ga0501034_0564127 3300049571 Bacteria 1047
251 Ga0501036_0093740 3300049572 Bacteria 2537
252 Ga0501037_0166126 3300049573 Bacteria 1571
253 Ga0501038_0212836 3300049574 Bacteria 1545
254 Ga0501039_0071988 3300049575 Bacteria 2686
255 Ga0501046_0365840 3300049580 Bacteria 1045
256 Ga0501048_0279821 3300049582 Bacteria 1186
257 Ga0501068_0004720 3300049584 Bacteria 7411
258 Ga0501083_0131177 3300049744 Bacteria 1643
259 Ga0501035_0165121 3300049822 Bacteria 1915
260 Ga0501044_0120723 3300049823 Bacteria 2622
261 nmdc:mga03683_188640_c1 3300050489 Bacteria 943
262 nmdc:mga03683_43105_c1 3300050489 Bacteria 1860
263 nmdc:mga03n38_138958_c1 3300050490 Bacteria 1212
264 nmdc:mga03n38_173141_c1 3300050490 Bacteria 1101
265 nmdc:mga0yw44_11240_c1 3300050492 Bacteria 4611
266 nmdc:mga0yw44_16154_c1 3300050492 Bacteria 4025
267 nmdc:mga05p37_1007_c1 3300050507 Bacteria 32102
268 nmdc:mga05p37_99382_c1 3300050507 Bacteria 3584
269 nmdc:mga0qj67_2160_c1 3300050509 Bacteria 13976
270 nmdc:mga06r32_143897_c1 3300050510 Bacteria 2361
271 nmdc:mga06r32_26580_c1 3300050510 Bacteria 5399
272 nmdc:mga06r32_493182_c1 3300050510 Bacteria 1202
273 nmdc:mga0n895_21685_c1 3300050512 Bacteria 6011
274 nmdc:mga0n895_7395_c1 3300050512 Bacteria 9424
275 nmdc:mga0rr50_136759_c1 3300050513 Bacteria 1968
276 nmdc:mga0rr50_49625_c1 3300050513 Bacteria 3107
277 nmdc:mga0rr50_92895_c1 3300050513 Bacteria 2353
278 nmdc:mga08x19_115671_c1 3300050514 Bacteria 1793
279 nmdc:mga08x19_21251_c1 3300050514 Bacteria 4004
280 nmdc:mga08x19_254179_c1 3300050514 Bacteria 1214
281 nmdc:mga08x19_288218_c1 3300050514 Bacteria 1139
282 nmdc:mga08x19_404646_c1 3300050514 Bacteria 958
283 nmdc:mga0a205_8224_c1 3300050515 Bacteria 9481
284 Ga0495601_0412071 3300053077 Bacteria 876
285 Ga0500578_0027581 3300053086 Bacteria 3647
286 Ga0500651_0137624 3300053093 Bacteria 1474
287 Ga0500616_0004074 3300053153 Bacteria 10622
288 Ga0500616_0022812 3300053153 Bacteria 3492
289 Ga0501082_0370604 3300060353 Bacteria 1249
290 2513567871 2513237084 Bacteria 7231967
291 2513577051 2513237085 Bacteria 7695351
292 2515638003 2515154113 Bacteria 7807172
293 2515645762 2515154114 Bacteria 7848616
294 2515739587 2515154134 Bacteria 7220242
295 2517077182 2516653085 Bacteria 7346596
296 2517095932 2517093000 Bacteria 7412387
297 2517407507 2517287029 Bacteria 6905599
298 2585274047 2582581307 Bacteria 6597605
299 2585524605 2585427526 Bacteria 7258840
300 2585560498 2585427531 Bacteria 6992870
301 2585903720 2585427609 Bacteria 6667127
302 2587981161 2585428125 Bacteria 6662905
303 2644051107 2643221607 Bacteria 6314006
304 2644205587 2643221636 Bacteria 6583769
305 2644484011 2643221686 Bacteria 6310811
306 2644500210 2643221689 Bacteria 6042950
307 2838686945 2838686498 Bacteria 7807632
308 2838730097 2838729681 Bacteria 7400765
309 2838742888 2838742623 Bacteria 7396178
310 2841852391 2841851746 Bacteria 7532261
311 2842158151 2842156927 Bacteria 6894975
312 2842168689 2842163707 Bacteria 6916235
313 2842181771 2842180545 Bacteria 6888678
314 2842230179 2842229732 Bacteria 7475766
315 2842244067 2842243621 Bacteria 7421798
316 2842257848 2842257432 Bacteria 7401195
317 2842271517 2842271015 Bacteria 7807131
318 2842305148 2842304105 Bacteria 7023636
319 2844458242 2844454524 Bacteria 7952546
320 2857517326 2857516855 Bacteria 7787325
321 2933570955 2933570622 Bacteria 7023390
322 2935901853 2935901341 Bacteria 7341747
323 2937894289 2937891427 Bacteria 6357007
324 8005309496 8005307578 Bacteria 7395396
325 8023683064 8023680758 Bacteria 7729763
326 Ga0265337_1022458
327 Ga0070676_10315457
328 Ga0070683_100023858
329 Ga0070680_100000973
330 Ga0070660_100085218
331 Ga0070689_100080334
332 Ga0070668_100095789
333 Ga0070669_100233071
334 Ga0070675_100189170
335 Ga0070674_100519773
336 Ga0070688_100189747
337 Ga0070709_10010506
338 Ga0070709_10174948
339 Ga0070714_100106756
340 Ga0070714_100160640
341 Ga0070714_100337068
342 Ga0070713_100115670
343 Ga0070710_10003878
344 Ga0070711_100020093
345 Ga0070711_100180849
346 Ga0070708_100192288
347 Ga0070678_100077729
348 Ga0070681_10002983
349 Ga0070681_10062606
350 Ga0070681_10579700
351 Ga0070706_100020924
352 Ga0070707_100042093
353 Ga0070707_100053199
354 Ga0070698_100038546
355 Ga0070698_100522261
356 Ga0070699_100008193
357 Ga0070699_100842796
358 Ga0070679_100004292
359 Ga0070679_100234132
360 Ga0070697_100268544
361 Ga0070697_100427526
362 Ga0070672_100608982
363 Ga0070686_100202250
364 Ga0070695_100096571
365 Ga0070696_100144378
366 Ga0070665_100129789
367 Ga0068855_100004843
368 Ga0070664_100146644
369 Ga0070664_100283866
370 Ga0068857_100008905
371 Ga0068856_100059710
372 Ga0068856_100250469
373 Ga0068856_100619053
374 Ga0068859_100550138
375 Ga0068864_100243323
376 Ga0068861_100216889
377 Ga0081455_10035783
378 Ga0070717_10095413
379 Ga0070717_10127299
380 Ga0075365_10014191
381 Ga0075363_100063533
382 Ga0070715_10004643
383 Ga0070716_100000343
384 Ga0070716_100523188
385 Ga0070712_100040659
386 Ga0070712_100040899
387 Ga0070712_100470992
388 Ga0075362_10004988
389 Ga0075370_10000997
390 Ga0075370_10283589
391 Ga0075428_100421623
392 Ga0075430_100000577
393 Ga0075430_100434792
394 Ga0075431_100056108
395 Ga0075431_100059037
396 Ga0075434_100028589
397 Ga0075434_100030541
398 Ga0075436_100019644
399 Ga0075436_100053720
400 Ga0075436_100062769
401 Ga0075436_100065678
402 Ga0097620_100550121
403 Ga0075435_100025250
404 Ga0075435_100524752
405 Ga0105240_10009483
406 Ga0114129_10011336
407 Ga0114129_10098199
408 Ga0105241_10011448
409 Ga0105241_10240532
410 Ga0105237_10151440
411 Ga0105238_10030585
412 Ga0105238_10092490
413 Ga0105238_10125199
414 Ga0105249_10308820
415 Ga0099796_10040424
416 Ga0157370_10087133
417 Ga0157374_10672771
418 Ga0163162_10007962
419 Ga0157372_10594128
420 Ga0157375_10431257
421 Ga0163163_10022069
422 Ga0163163_10034677
423 Ga0213874_10007199
424 Ga0213871_10068412
425 Ga0207426_1005914
426 Ga0207692_10002573
427 Ga0207692_10292783
428 Ga0207685_10022637
429 Ga0207699_10001431
430 Ga0207699_10052337
431 Ga0207699_10226680
432 Ga0207645_10113243
433 Ga0207705_10006086
434 Ga0207654_10032148
435 Ga0207707_10005856
436 Ga0207695_10078415
437 Ga0207693_10013106
438 Ga0207693_10046535
439 Ga0207693_10083468
440 Ga0207663_10021083
441 Ga0207663_10184099
442 Ga0207652_10005580
443 Ga0207652_10092522
444 Ga0207646_10045444
445 Ga0207646_10276974
446 Ga0207681_10059359
447 Ga0207694_10140211
448 Ga0207659_10191019
449 Ga0207700_10035816
450 Ga0207700_10091557
451 Ga0207700_10123682
452 Ga0207700_10224837
453 Ga0207664_10015461
454 Ga0207664_10107650
455 Ga0207664_10170270
456 Ga0207670_10128673
457 Ga0207704_10206037
458 Ga0207665_10000505
459 Ga0207665_10003233
460 Ga0207665_10026951
461 Ga0207691_10231361
462 Ga0207691_10668231
463 Ga0207679_10144954
464 Ga0207667_10006574
465 Ga0207667_10174574
466 Ga0207712_10846417
467 Ga0207668_10191167
468 Ga0207640_10093225
469 Ga0207658_10310894
470 Ga0207677_10199886
471 Ga0207702_10013733
472 Ga0207702_10023566
473 Ga0207702_10085818
474 Ga0207674_10018622
475 Ga0207674_10152745
476 Ga0207675_100185224
477 Ga0207683_10007813
478 Ga0268266_10178093
479 Ga0268265_10969027
480 Ga0307515_10112535
481 Ga0265338_10049641
482 Ga0265338_10280175
483 Ga0265339_10068550
484 Ga0307408_100030818
485 Ga0265314_10000027
486 Ga0307409_100429264
487 Ga0307416_100260132
488 Ga0307416_100428538
489 Ga0373948_0035901
490 Ga0373943_0209478
491 Ga0373946_0261680
492 Ga0373931_0005358
493 Ga0373927_0059453
494 Ga0373947_0294152
495 Ga0373947_0354994
496 Ga0373937_0108587
497 Ga0373925_0203308
498 Ga0373925_0249633
499 Ga0373925_0449213
500 Ga0395899_0002903
501 Ga0395899_0015534
502 Ga0395899_0050058
503 Ga0395900_0005679
504 Ga0395900_0006761
505 Ga0395900_0067254
506 Ga0395900_0096740
507 Ga0395898_0018449
508 Ga0395898_0028072
509 Ga0395905_0100349
510 Ga0395905_0678913
511 Ga0395901_0000593
512 Ga0395901_0006737
513 Ga0395901_0042418
514 Ga0436365_1700360
515 Ga0436360_0047776
516 Ga0436360_0437528
517 Ga0436360_1094594
518 Ga0436361_0950302
519 Ga0436363_0263938
520 Ga0436362_0044031
521 Ga0436362_0873022
522 Ga0451855_0261553
523 Ga0439460_0006157
524 Ga0453683_0131862
525 Ga0466957_0046952
526 Ga0451576_0369500
527 Ga0466967_0199228
528 Ga0466967_0316821
529 Ga0495592_0256203
530 Ga0495580_0055712
531 Ga0495606_0035875
532 Ga0495610_0084588
533 Ga0495618_0205132
534 Ga0495632_0048289
535 Ga0495643_0029508
536 Ga0495633_0045101
537 Ga0495656_0074098
538 Ga0495668_0105253
539 Ga0495625_0030975
540 Ga0495625_0065928
541 Ga0495599_0185766
542 Ga0495669_0024468
543 Ga0495670_0088570
544 Ga0495681_0148715
545 Ga0495686_0116062
546 Ga0495626_0052648
547 Ga0496103_0057801
548 Ga0496106_0066708
549 Ga0496108_0094404
550 Ga0496109_0133043
551 Ga0496110_0012046
552 Ga0496110_0741648
553 Ga0496111_0232028
554 Ga0496112_0002243
555 Ga0496112_0034506
556 Ga0496112_0257409
557 Ga0496113_0083292
558 Ga0496113_0139861
559 Ga0496114_0066752
560 Ga0496115_0027482
561 Ga0496116_0101875
562 Ga0496119_0131139
563 Ga0496120_0103148
564 Ga0496121_0299485
565 Ga0496122_0001028
566 Ga0496123_0000763
567 Ga0496124_0231383
568 Ga0496124_0258086
569 Ga0496126_0055450
570 Ga0501033_0268648
571 Ga0501034_0012574
572 Ga0501034_0118257
573 Ga0501034_0144094
574 Ga0501034_0237818
575 Ga0501034_0564127
576 Ga0501036_0093740
577 Ga0501037_0166126
578 Ga0501038_0212836
579 Ga0501039_0071988
580 Ga0501046_0365840
581 Ga0501048_0279821
582 Ga0501068_0004720
583 Ga0501083_0131177
584 Ga0501035_0165121
585 Ga0501044_0120723
586 nmdc:mga03683_188640_c1
587 nmdc:mga03683_43105_c1
588 nmdc:mga03n38_138958_c1
589 nmdc:mga03n38_173141_c1
590 nmdc:mga0yw44_11240_c1
591 nmdc:mga0yw44_16154_c1
592 nmdc:mga05p37_1007_c1
593 nmdc:mga05p37_99382_c1
594 nmdc:mga0qj67_2160_c1
595 nmdc:mga06r32_143897_c1
596 nmdc:mga06r32_26580_c1
597 nmdc:mga06r32_493182_c1
598 nmdc:mga0n895_21685_c1
599 nmdc:mga0n895_7395_c1
600 nmdc:mga0rr50_136759_c1
601 nmdc:mga0rr50_49625_c1
602 nmdc:mga0rr50_92895_c1
603 nmdc:mga08x19_115671_c1
604 nmdc:mga08x19_21251_c1
605 nmdc:mga08x19_254179_c1
606 nmdc:mga08x19_288218_c1
607 nmdc:mga08x19_404646_c1
608 nmdc:mga0a205_8224_c1
609 Ga0495601_0412071
610 Ga0500578_0027581
611 Ga0500651_0137624
612 Ga0500616_0004074
613 Ga0500616_0022812
614 Ga0501082_0370604
615 2513567871
616 2513577051
617 2515638003
618 2515645762
619 2515739587
620 2517077182
621 2517095932
622 2517407507
623 2585274047
624 2585524605
625 2585560498
626 2585903720
627 2587981161
628 2644051107
629 2644205587
630 2644484011
631 2644500210
632 2838686945
633 2838730097
634 2838742888
635 2841852391
636 2842158151
637 2842168689
638 2842181771
639 2842230179
640 2842244067
641 2842257848
642 2842271517
643 2842305148
644 2844458242
645 2857517326
646 2933570955
647 2935901853
648 2937894289
649 8005309496
650 8023683064

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

73

167

0.98

PF13649

Methyltransf_25

Methyltransferase domain

72

163

0.95

PF13489

Methyltransf_23

Methyltransferase domain

51

201

0.89

PF13847

Methyltransf_31

Methyltransferase domain

66

186

0.89

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

57

177

0.87

PF08242

Methyltransf_12

Methyltransferase domain

73

165

0.84

PF05175

MTS

Methyltransferase small domain

47

177

0.82

PF08003

Methyltransf_9

Protein of unknown function (DUF1698)

50

171

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bkw-assembly1.cif.gz_B crystal structure of s-adenosylmethionine dependent methyltransferase (np_104914.1) from mesorhizobium loti at 1.60 a resolution 0.9733 24 241
3bkw-assembly1.cif.gz_A crystal structure of s-adenosylmethionine dependent methyltransferase (np_104914.1) from mesorhizobium loti at 1.60 a resolution 0.9702 24 241
3bkw-assembly1.cif.gz_B crystal structure of s-adenosylmethionine dependent methyltransferase (np_104914.1) from mesorhizobium loti at 1.60 a resolution 0.9689 24 241
3bkw-assembly1.cif.gz_A crystal structure of s-adenosylmethionine dependent methyltransferase (np_104914.1) from mesorhizobium loti at 1.60 a resolution 0.9615 24 241
3g5l-assembly1.cif.gz_B crystal structure of putative s-adenosylmethionine dependent methyltransferase from listeria monocytogenes 0.9243 29 242
ID Description Score Start End Superfamily
3bkwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9706 24 241 3.40.50.150
3bkwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9661 24 241 3.40.50.150
af_Q55GB9_27_263_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9621 28 242 3.40.50.150
3g5lB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9243 29 242 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9239 39 98 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A837CE07-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9927 1 134 GO:0008757
AF-A0A485C046-F1-model_v4 Malonyl-CoA O-methyltransferase BioC (EC 2.1.1.197) 0.9882 1 242 GO:0008757
GO:0032259
GO:0102130
AF-A0A485C046-F1-model_v4 Malonyl-CoA O-methyltransferase BioC (EC 2.1.1.197) 0.9841 1 242 GO:0008757
GO:0032259
GO:0102130
AF-A0A7U9I9E2-F1-model_v4 deleted 0.958 1 241
AF-A0A1G8SCC7-F1-model_v4 Methyltransferase domain-containing protein 0.9563 1 242 GO:0008757
GO:0016020
GO:0032259

Map