F407799

General Info

Members Datasets Scaffolds Average Seq Length
325 147 650 142

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10622630|Ga0105243_106226302
Length 160
Sequence MHKSVIALVAASSLAGCHARAEESAGATVSKNYSVGNFSAIEVAGPYDVEVRTGSNPSVSGSGGEKLLERTVVEVRGDKLVIRPEANHSFFHWGWRHHGKAHFLVTVPQLSGATIAGSGDIQVDKVAGQNFAGDVAGSGSSGRRSGRTRRAEPTESEDLK

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 1.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.46
Rhizosphere 93.54
Stem 0
Stem Tuber 0
Unclassified 14.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10622630 3300009148 Unclassified 1042
2 JGI24746J21847_1003872 3300001977 Bacteria 2362
3 JGI24740J21852_10014288 3300001979 Bacteria 2933
4 JGI24739J22299_10017744 3300001989 Bacteria 2565
5 JGI24739J22299_10052684 3300001989 Bacteria 1308
6 JGI24737J22298_10051035 3300001990 Bacteria 1256
7 JGI24743J22301_10004628 3300001991 Bacteria 2253
8 JGI24738J21930_10014834 3300002075 Bacteria 1667
9 Ga0070658_10015011 3300005327 Bacteria 6200
10 Ga0070658_10052329 3300005327 Bacteria 3311
11 Ga0070658_10331932 3300005327 Bacteria 1300
12 Ga0070676_10213516 3300005328 Bacteria 1271
13 Ga0070676_10357831 3300005328 Unclassified 1005
14 Ga0070683_100006411 3300005329 Bacteria 9866
15 Ga0070690_100002246 3300005330 Bacteria 10357
16 Ga0070690_100147358 3300005330 Bacteria 1603
17 Ga0070670_100017351 3300005331 Bacteria 6174
18 Ga0070670_100047441 3300005331 Bacteria 3696
19 Ga0070670_100543888 3300005331 Bacteria 1036
20 Ga0070670_100692318 3300005331 Unclassified 916
21 Ga0070677_10026597 3300005333 Bacteria 2171
22 Ga0070677_10066667 3300005333 Bacteria 1502
23 Ga0070666_10007248 3300005335 Bacteria 6837
24 Ga0070680_100008676 3300005336 Bacteria 7792
25 Ga0068868_100078790 3300005338 Bacteria 2638
26 Ga0068868_100535492 3300005338 Bacteria 1030
27 Ga0070660_100002898 3300005339 Bacteria 11809
28 Ga0070660_100027033 3300005339 Bacteria 4279
29 Ga0070660_100033421 3300005339 Bacteria 3877
30 Ga0070660_100079268 3300005339 Bacteria 2576
31 Ga0070660_100219386 3300005339 Unclassified 1545
32 Ga0070689_100045692 3300005340 Bacteria 3373
33 Ga0070661_100019187 3300005344 Bacteria 4870
34 Ga0070661_100042014 3300005344 Bacteria 3336
35 Ga0070661_100152254 3300005344 Bacteria 1749
36 Ga0070661_100434411 3300005344 Bacteria 1042
37 Ga0070668_100037910 3300005347 Bacteria 3683
38 Ga0070675_100038504 3300005354 Bacteria 3897
39 Ga0070675_100362301 3300005354 Bacteria 1287
40 Ga0070671_100031476 3300005355 Bacteria 4383
41 Ga0070671_100045532 3300005355 Bacteria 3647
42 Ga0070671_100045618 3300005355 Bacteria 3644
43 Ga0070671_100096173 3300005355 Bacteria 2483
44 Ga0070671_100101379 3300005355 Bacteria 2415
45 Ga0070671_100204807 3300005355 Bacteria 1673
46 Ga0070671_100221861 3300005355 Bacteria 1603
47 Ga0070674_100004625 3300005356 Bacteria 7863
48 Ga0070674_100094604 3300005356 Bacteria 2164
49 Ga0070674_100379166 3300005356 Unclassified 1150
50 Ga0070673_100011040 3300005364 Bacteria 6152
51 Ga0070673_100013091 3300005364 Bacteria 5725
52 Ga0070659_100041629 3300005366 Bacteria 3592
53 Ga0070659_100051784 3300005366 Bacteria 3228
54 Ga0070667_100001244 3300005367 Bacteria 23122
55 Ga0070667_100119529 3300005367 Bacteria 2291
56 Ga0070667_100323543 3300005367 Bacteria 1392
57 Ga0070709_10033623 3300005434 Bacteria 3103
58 Ga0070713_100072212 3300005436 Bacteria 2918
59 Ga0070711_100224542 3300005439 Unclassified 1462
60 Ga0070663_100026521 3300005455 Bacteria 3926
61 Ga0070663_100057098 3300005455 Bacteria 2799
62 Ga0070678_100002750 3300005456 Bacteria 9717
63 Ga0070678_100064446 3300005456 Bacteria 2716
64 Ga0070678_100098093 3300005456 Bacteria 2265
65 Ga0070662_100015985 3300005457 Bacteria 5034
66 Ga0070662_100094850 3300005457 Bacteria 2247
67 Ga0070662_100200464 3300005457 Unclassified 1583
68 Ga0070662_100315597 3300005457 Bacteria 1273
69 Ga0070662_100584173 3300005457 Unclassified 938
70 Ga0070681_10285304 3300005458 Unclassified 1562
71 Ga0068867_100138158 3300005459 Bacteria 1902
72 Ga0068867_100199191 3300005459 Unclassified 1602
73 Ga0070679_100011120 3300005530 Bacteria 8568
74 Ga0070684_100034981 3300005535 Bacteria 4297
75 Ga0068853_100161884 3300005539 Unclassified 2020
76 Ga0068853_100227937 3300005539 Bacteria 1703
77 Ga0070672_100070910 3300005543 Bacteria 2770
78 Ga0070672_100098235 3300005543 Bacteria 2371
79 Ga0070672_100108938 3300005543 Unclassified 2255
80 Ga0070672_100135795 3300005543 Bacteria 2026
81 Ga0070672_100727180 3300005543 Unclassified 870
82 Ga0070665_100043473 3300005548 Bacteria 4515
83 Ga0070665_100118512 3300005548 Bacteria 2649
84 Ga0068855_100086532 3300005563 Bacteria 3624
85 Ga0068855_100546309 3300005563 Unclassified 1254
86 Ga0070664_100008985 3300005564 Bacteria 8103
87 Ga0070664_100016921 3300005564 Bacteria 5982
88 Ga0070664_100077111 3300005564 Bacteria 2865
89 Ga0070664_100943199 3300005564 Bacteria 810
90 Ga0068854_100057913 3300005578 Bacteria 2795
91 Ga0068854_100102388 3300005578 Bacteria 2148
92 Ga0068852_100072467 3300005616 Bacteria 3028
93 Ga0068852_100094511 3300005616 Bacteria 2682
94 Ga0068852_100147554 3300005616 Bacteria 2183
95 Ga0068852_100437375 3300005616 Bacteria 1293
96 Ga0068859_100304799 3300005617 Unclassified 1686
97 Ga0068864_100018569 3300005618 Bacteria 5812
98 Ga0068864_100034310 3300005618 Bacteria 4315
99 Ga0068864_100079525 3300005618 Bacteria 2871
100 Ga0068864_100236848 3300005618 Bacteria 1690
101 Ga0068864_100239456 3300005618 Unclassified 1681
102 Ga0068866_10106775 3300005718 Bacteria 1554
103 Ga0068851_10313477 3300005834 Bacteria 905
104 Ga0068863_100198990 3300005841 Bacteria 1927
105 Ga0068863_100621288 3300005841 Bacteria 1070
106 Ga0068858_100061299 3300005842 Bacteria 3477
107 Ga0068860_100149327 3300005843 Bacteria 2250
108 Ga0070717_10661061 3300006028 Unclassified 949
109 Ga0070716_100232722 3300006173 Unclassified 1245
110 Ga0097621_100119088 3300006237 Bacteria 2238
111 Ga0097621_100207282 3300006237 Unclassified 1704
112 Ga0097621_100560454 3300006237 Bacteria 1041
113 Ga0068865_100056172 3300006881 Bacteria 2742
114 Ga0097620_100304792 3300006931 Unclassified 1686
115 Ga0105248_10005852 3300009177 Bacteria 13514
116 Ga0105248_10114694 3300009177 Bacteria 3039
117 Ga0105248_10118762 3300009177 Bacteria 2982
118 Ga0105248_10252609 3300009177 Bacteria 1984
119 Ga0105248_10481166 3300009177 Unclassified 1399
120 Ga0105238_10872575 3300009551 Unclassified 917
121 Ga0157371_10118484 3300013102 Bacteria 1882
122 Ga0157370_10029290 3300013104 Bacteria 5406
123 Ga0157370_10097476 3300013104 Bacteria 2758
124 Ga0157370_10195046 3300013104 Unclassified 1880
125 Ga0157374_10014286 3300013296 Bacteria 6947
126 Ga0157374_10567556 3300013296 Unclassified 1143
127 Ga0157378_10185790 3300013297 Bacteria 1958
128 Ga0163162_10111866 3300013306 Bacteria 2829
129 Ga0157372_10129559 3300013307 Bacteria 2902
130 Ga0157372_10499499 3300013307 Bacteria 1418
131 Ga0157375_10566302 3300013308 Unclassified 1297
132 Ga0163161_10033235 3300017792 Bacteria 3686
133 Ga0206355_1198440 3300020076 Bacteria 1675
134 Ga0206353_11668938 3300020082 Bacteria 1382
135 Ga0207697_10024078 3300025315 Bacteria 2494
136 Ga0207656_10025351 3300025321 Bacteria 2407
137 Ga0207682_10017321 3300025893 Bacteria 2814
138 Ga0207682_10059366 3300025893 Bacteria 1598
139 Ga0207642_10118920 3300025899 Bacteria 1359
140 Ga0207688_10311765 3300025901 Unclassified 964
141 Ga0207680_10021777 3300025903 Bacteria 3474
142 Ga0207680_10119845 3300025903 Bacteria 1719
143 Ga0207647_10003752 3300025904 Bacteria 11357
144 Ga0207647_10015770 3300025904 Bacteria 5171
145 Ga0207647_10030440 3300025904 Bacteria 3482
146 Ga0207647_10275613 3300025904 Bacteria 961
147 Ga0207643_10066186 3300025908 Bacteria 2072
148 Ga0207705_10007023 3300025909 Bacteria 8305
149 Ga0207705_10007151 3300025909 Bacteria 8227
150 Ga0207705_10531294 3300025909 Bacteria 914
151 Ga0207707_10315173 3300025912 Unclassified 1351
152 Ga0207707_10315878 3300025912 Bacteria 1349
153 Ga0207693_10007875 3300025915 Bacteria 8751
154 Ga0207662_10094400 3300025918 Bacteria 1845
155 Ga0207657_10014227 3300025919 Bacteria 7777
156 Ga0207657_10046126 3300025919 Bacteria 3818
157 Ga0207657_10056745 3300025919 Bacteria 3377
158 Ga0207657_10069837 3300025919 Bacteria 2979
159 Ga0207657_10113368 3300025919 Unclassified 2237
160 Ga0207657_10151438 3300025919 Bacteria 1889
161 Ga0207657_10179806 3300025919 Unclassified 1710
162 Ga0207649_10067020 3300025920 Unclassified 2278
163 Ga0207649_10141454 3300025920 Unclassified 1647
164 Ga0207649_10162464 3300025920 Bacteria 1549
165 Ga0207649_10480511 3300025920 Bacteria 942
166 Ga0207652_10020470 3300025921 Bacteria 5447
167 Ga0207652_10060093 3300025921 Bacteria 3278
168 Ga0207652_10193863 3300025921 Unclassified 1828
169 Ga0207650_10037389 3300025925 Bacteria 3537
170 Ga0207650_10165955 3300025925 Bacteria 1752
171 Ga0207650_10440359 3300025925 Bacteria 1083
172 Ga0207687_10289480 3300025927 Bacteria 1316
173 Ga0207664_10314464 3300025929 Bacteria 1381
174 Ga0207644_10000810 3300025931 Bacteria 19859
175 Ga0207644_10000892 3300025931 Bacteria 18859
176 Ga0207644_10011659 3300025931 Bacteria 5821
177 Ga0207644_10023487 3300025931 Bacteria 4224
178 Ga0207644_10032958 3300025931 Bacteria 3617
179 Ga0207644_10079931 3300025931 Bacteria 2413
180 Ga0207644_10145376 3300025931 Bacteria 1830
181 Ga0207706_10037047 3300025933 Bacteria 4331
182 Ga0207706_10075695 3300025933 Bacteria 2960
183 Ga0207706_10120557 3300025933 Bacteria 2306
184 Ga0207706_10171214 3300025933 Bacteria 1908
185 Ga0207669_10006657 3300025937 Bacteria 5296
186 Ga0207669_10071001 3300025937 Bacteria 2186
187 Ga0207669_10103772 3300025937 Bacteria 1886
188 Ga0207665_10034213 3300025939 Unclassified 3372
189 Ga0207691_10051279 3300025940 Bacteria 3774
190 Ga0207691_10113484 3300025940 Bacteria 2408
191 Ga0207691_10114327 3300025940 Bacteria 2398
192 Ga0207691_10198294 3300025940 Bacteria 1748
193 Ga0207711_10000760 3300025941 Bacteria 31645
194 Ga0207711_10185686 3300025941 Unclassified 1892
195 Ga0207711_10499058 3300025941 Bacteria 1134
196 Ga0207689_10336813 3300025942 Bacteria 1253
197 Ga0207661_10036102 3300025944 Bacteria 3856
198 Ga0207679_10004012 3300025945 Bacteria 9140
199 Ga0207679_10019544 3300025945 Bacteria 4553
200 Ga0207679_10045927 3300025945 Bacteria 3163
201 Ga0207679_10096292 3300025945 Bacteria 2302
202 Ga0207679_10127012 3300025945 Bacteria 2039
203 Ga0207679_10756639 3300025945 Bacteria 884
204 Ga0207651_10070762 3300025960 Bacteria 2469
205 Ga0207651_10134402 3300025960 Bacteria 1899
206 Ga0207651_10201455 3300025960 Unclassified 1595
207 Ga0207668_10149050 3300025972 Unclassified 1809
208 Ga0207640_10021784 3300025981 Bacteria 3825
209 Ga0207640_10135263 3300025981 Bacteria 1788
210 Ga0207658_10028754 3300025986 Bacteria 3918
211 Ga0207658_10293598 3300025986 Bacteria 1398
212 Ga0207677_10033408 3300026023 Bacteria 3319
213 Ga0207677_10052621 3300026023 Bacteria 2767
214 Ga0207703_10003782 3300026035 Bacteria 12580
215 Ga0207639_10590684 3300026041 Bacteria 1023
216 Ga0207678_10003440 3300026067 Bacteria 14260
217 Ga0207678_10024054 3300026067 Bacteria 5322
218 Ga0207678_10039899 3300026067 Bacteria 4073
219 Ga0207678_10051738 3300026067 Bacteria 3545
220 Ga0207678_10110397 3300026067 Bacteria 2346
221 Ga0207678_10208506 3300026067 Bacteria 1672
222 Ga0207641_10052622 3300026088 Bacteria 3449
223 Ga0207641_10102538 3300026088 Bacteria 2523
224 Ga0207641_10518765 3300026088 Unclassified 1159
225 Ga0207648_10039101 3300026089 Bacteria 4171
226 Ga0207648_10079189 3300026089 Bacteria 2866
227 Ga0207648_10164743 3300026089 Bacteria 1959
228 Ga0207648_10240189 3300026089 Unclassified 1613
229 Ga0207676_10240312 3300026095 Bacteria 1624
230 Ga0207676_10510730 3300026095 Bacteria 1142
231 Ga0207676_10586149 3300026095 Bacteria 1069
232 Ga0207674_10066059 3300026116 Bacteria 3644
233 Ga0207675_101076654 3300026118 Bacteria 823
234 Ga0207683_10008762 3300026121 Bacteria 8637
235 Ga0207683_10083492 3300026121 Bacteria 2839
236 Ga0207683_10135141 3300026121 Bacteria 2220
237 Ga0207698_10026433 3300026142 Bacteria 4106
238 Ga0207698_10198446 3300026142 Bacteria 1794
239 Ga0268266_10051764 3300028379 Bacteria 3525
240 Ga0268266_10081531 3300028379 Bacteria 2821
241 Ga0268264_10075164 3300028381 Bacteria 2872
242 Ga0307406_10118196 3300031901 Bacteria 1838
243 Ga0307416_100296288 3300032002 Bacteria 1605
244 Ga0307414_10202946 3300032004 Bacteria 1614
245 Ga0373935_0040517 3300035692 Bacteria 2924
246 Ga0395899_0011172 3300037312 Bacteria 6880
247 Ga0395899_0011726 3300037312 Bacteria 6709
248 Ga0395899_0082793 3300037312 Bacteria 2333
249 Ga0395899_0095545 3300037312 Bacteria 2150
250 Ga0395899_0319407 3300037312 Bacteria 1046
251 Ga0395900_0015134 3300037418 Bacteria 7864
252 Ga0395900_0032640 3300037418 Bacteria 5355
253 Ga0395900_0066571 3300037418 Bacteria 3701
254 Ga0395900_0153366 3300037418 Bacteria 2353
255 Ga0395900_0232013 3300037418 Unclassified 1855
256 Ga0395900_0356496 3300037418 Bacteria 1435
257 Ga0395900_0426619 3300037418 Bacteria 1286
258 Ga0395900_0460560 3300037418 Bacteria 1226
259 Ga0395900_0865605 3300037418 Unclassified 828
260 Ga0395898_0007043 3300037466 Bacteria 11950
261 Ga0395898_0038360 3300037466 Bacteria 4749
262 Ga0395898_0081162 3300037466 Bacteria 3127
263 Ga0395898_0084272 3300037466 Bacteria 3064
264 Ga0395898_0111541 3300037466 Bacteria 2621
265 Ga0395905_0000187 3300037471 Bacteria 98895
266 Ga0395905_0011414 3300037471 Bacteria 8584
267 Ga0395905_0019955 3300037471 Bacteria 6351
268 Ga0395905_0056308 3300037471 Bacteria 3678
269 Ga0395905_0071753 3300037471 Bacteria 3246
270 Ga0395905_0077585 3300037471 Bacteria 3113
271 Ga0395905_0092901 3300037471 Bacteria 2829
272 Ga0395905_0139455 3300037471 Bacteria 2281
273 Ga0395905_0147078 3300037471 Bacteria 2217
274 Ga0395905_0637420 3300037471 Unclassified 967
275 Ga0395905_0743125 3300037471 Bacteria 883
276 Ga0395901_0006129 3300038443 Bacteria 12182
277 Ga0395901_0025501 3300038443 Bacteria 6069
278 Ga0395901_0074140 3300038443 Bacteria 3550
279 Ga0395901_0177090 3300038443 Bacteria 2236
280 Ga0395901_0296485 3300038443 Unclassified 1677
281 Ga0395901_0301797 3300038443 Bacteria 1660
282 Ga0395901_0481576 3300038443 Bacteria 1265
283 Ga0395901_0930715 3300038443 Bacteria 849
284 Ga0466968_0087576 3300044735 Bacteria 1376
285 Ga0466970_0173063 3300044765 Bacteria 1197
286 Ga0466957_0025203 3300044842 Bacteria 3524
287 Ga0466960_0030270 3300044901 Bacteria 2490
288 Ga0466967_0033597 3300045976 Bacteria 4344
289 Ga0466967_0041146 3300045976 Bacteria 3982
290 Ga0466967_0179080 3300045976 Unclassified 1998
291 Ga0466967_0879178 3300045976 Bacteria 891
292 Ga0466967_0946965 3300045976 Bacteria 857
293 Ga0495642_0048702 3300046528 Bacteria 1739
294 Ga0495598_0000224 3300046537 Bacteria 10030
295 Ga0495621_0000064 3300046539 Bacteria 20546
296 Ga0495633_0014381 3300046558 Bacteria 4141
297 Ga0495669_0005363 3300046684 Bacteria 5346
298 Ga0495669_0027620 3300046684 Bacteria 2483
299 Ga0495669_0246972 3300046684 Unclassified 857
300 Ga0495670_0000346 3300046691 Bacteria 22049
301 Ga0495677_0007609 3300047445 Bacteria 4042
302 Ga0496100_0066903 3300048903 Bacteria 2385
303 Ga0496101_0052531 3300048904 Bacteria 2939
304 Ga0496102_0300415 3300048905 Bacteria 1513
305 Ga0496104_0285777 3300048907 Bacteria 1562
306 Ga0496106_0254144 3300048909 Bacteria 1406
307 Ga0496108_0021112 3300048911 Bacteria 5350
308 Ga0496109_0039709 3300048912 Bacteria 4261
309 Ga0496109_0080642 3300048912 Unclassified 2998
310 Ga0496109_0139964 3300048912 Bacteria 2262
311 Ga0496110_0268857 3300048913 Bacteria 1552
312 Ga0496112_0038539 3300048915 Bacteria 4667
313 Ga0496112_0096563 3300048915 Bacteria 2925
314 Ga0496112_0250232 3300048915 Bacteria 1723
315 Ga0496112_0292675 3300048915 Bacteria 1574
316 Ga0496112_0385006 3300048915 Bacteria 1343
317 Ga0496113_0020969 3300048916 Bacteria 4604
318 Ga0496113_0117646 3300048916 Bacteria 2075
319 Ga0496114_0000029 3300048917 Bacteria 175132
320 Ga0496114_0119242 3300048917 Bacteria 2268
321 Ga0496114_0540764 3300048917 Bacteria 1030
322 Ga0496115_0001950 3300048918 Bacteria 14718
323 Ga0587073_0206677 3300059492 Unclassified 592
324 Ga0587069_063103 3300059642 Unclassified 687
325 Ga0466962_0291203 3300061719 Unclassified 807
326 Ga0105243_10622630
327 JGI24746J21847_1003872
328 JGI24740J21852_10014288
329 JGI24739J22299_10017744
330 JGI24739J22299_10052684
331 JGI24737J22298_10051035
332 JGI24743J22301_10004628
333 JGI24738J21930_10014834
334 Ga0070658_10015011
335 Ga0070658_10052329
336 Ga0070658_10331932
337 Ga0070676_10213516
338 Ga0070676_10357831
339 Ga0070683_100006411
340 Ga0070690_100002246
341 Ga0070690_100147358
342 Ga0070670_100017351
343 Ga0070670_100047441
344 Ga0070670_100543888
345 Ga0070670_100692318
346 Ga0070677_10026597
347 Ga0070677_10066667
348 Ga0070666_10007248
349 Ga0070680_100008676
350 Ga0068868_100078790
351 Ga0068868_100535492
352 Ga0070660_100002898
353 Ga0070660_100027033
354 Ga0070660_100033421
355 Ga0070660_100079268
356 Ga0070660_100219386
357 Ga0070689_100045692
358 Ga0070661_100019187
359 Ga0070661_100042014
360 Ga0070661_100152254
361 Ga0070661_100434411
362 Ga0070668_100037910
363 Ga0070675_100038504
364 Ga0070675_100362301
365 Ga0070671_100031476
366 Ga0070671_100045532
367 Ga0070671_100045618
368 Ga0070671_100096173
369 Ga0070671_100101379
370 Ga0070671_100204807
371 Ga0070671_100221861
372 Ga0070674_100004625
373 Ga0070674_100094604
374 Ga0070674_100379166
375 Ga0070673_100011040
376 Ga0070673_100013091
377 Ga0070659_100041629
378 Ga0070659_100051784
379 Ga0070667_100001244
380 Ga0070667_100119529
381 Ga0070667_100323543
382 Ga0070709_10033623
383 Ga0070713_100072212
384 Ga0070711_100224542
385 Ga0070663_100026521
386 Ga0070663_100057098
387 Ga0070678_100002750
388 Ga0070678_100064446
389 Ga0070678_100098093
390 Ga0070662_100015985
391 Ga0070662_100094850
392 Ga0070662_100200464
393 Ga0070662_100315597
394 Ga0070662_100584173
395 Ga0070681_10285304
396 Ga0068867_100138158
397 Ga0068867_100199191
398 Ga0070679_100011120
399 Ga0070684_100034981
400 Ga0068853_100161884
401 Ga0068853_100227937
402 Ga0070672_100070910
403 Ga0070672_100098235
404 Ga0070672_100108938
405 Ga0070672_100135795
406 Ga0070672_100727180
407 Ga0070665_100043473
408 Ga0070665_100118512
409 Ga0068855_100086532
410 Ga0068855_100546309
411 Ga0070664_100008985
412 Ga0070664_100016921
413 Ga0070664_100077111
414 Ga0070664_100943199
415 Ga0068854_100057913
416 Ga0068854_100102388
417 Ga0068852_100072467
418 Ga0068852_100094511
419 Ga0068852_100147554
420 Ga0068852_100437375
421 Ga0068859_100304799
422 Ga0068864_100018569
423 Ga0068864_100034310
424 Ga0068864_100079525
425 Ga0068864_100236848
426 Ga0068864_100239456
427 Ga0068866_10106775
428 Ga0068851_10313477
429 Ga0068863_100198990
430 Ga0068863_100621288
431 Ga0068858_100061299
432 Ga0068860_100149327
433 Ga0070717_10661061
434 Ga0070716_100232722
435 Ga0097621_100119088
436 Ga0097621_100207282
437 Ga0097621_100560454
438 Ga0068865_100056172
439 Ga0097620_100304792
440 Ga0105248_10005852
441 Ga0105248_10114694
442 Ga0105248_10118762
443 Ga0105248_10252609
444 Ga0105248_10481166
445 Ga0105238_10872575
446 Ga0157371_10118484
447 Ga0157370_10029290
448 Ga0157370_10097476
449 Ga0157370_10195046
450 Ga0157374_10014286
451 Ga0157374_10567556
452 Ga0157378_10185790
453 Ga0163162_10111866
454 Ga0157372_10129559
455 Ga0157372_10499499
456 Ga0157375_10566302
457 Ga0163161_10033235
458 Ga0206355_1198440
459 Ga0206353_11668938
460 Ga0207697_10024078
461 Ga0207656_10025351
462 Ga0207682_10017321
463 Ga0207682_10059366
464 Ga0207642_10118920
465 Ga0207688_10311765
466 Ga0207680_10021777
467 Ga0207680_10119845
468 Ga0207647_10003752
469 Ga0207647_10015770
470 Ga0207647_10030440
471 Ga0207647_10275613
472 Ga0207643_10066186
473 Ga0207705_10007023
474 Ga0207705_10007151
475 Ga0207705_10531294
476 Ga0207707_10315173
477 Ga0207707_10315878
478 Ga0207693_10007875
479 Ga0207662_10094400
480 Ga0207657_10014227
481 Ga0207657_10046126
482 Ga0207657_10056745
483 Ga0207657_10069837
484 Ga0207657_10113368
485 Ga0207657_10151438
486 Ga0207657_10179806
487 Ga0207649_10067020
488 Ga0207649_10141454
489 Ga0207649_10162464
490 Ga0207649_10480511
491 Ga0207652_10020470
492 Ga0207652_10060093
493 Ga0207652_10193863
494 Ga0207650_10037389
495 Ga0207650_10165955
496 Ga0207650_10440359
497 Ga0207687_10289480
498 Ga0207664_10314464
499 Ga0207644_10000810
500 Ga0207644_10000892
501 Ga0207644_10011659
502 Ga0207644_10023487
503 Ga0207644_10032958
504 Ga0207644_10079931
505 Ga0207644_10145376
506 Ga0207706_10037047
507 Ga0207706_10075695
508 Ga0207706_10120557
509 Ga0207706_10171214
510 Ga0207669_10006657
511 Ga0207669_10071001
512 Ga0207669_10103772
513 Ga0207665_10034213
514 Ga0207691_10051279
515 Ga0207691_10113484
516 Ga0207691_10114327
517 Ga0207691_10198294
518 Ga0207711_10000760
519 Ga0207711_10185686
520 Ga0207711_10499058
521 Ga0207689_10336813
522 Ga0207661_10036102
523 Ga0207679_10004012
524 Ga0207679_10019544
525 Ga0207679_10045927
526 Ga0207679_10096292
527 Ga0207679_10127012
528 Ga0207679_10756639
529 Ga0207651_10070762
530 Ga0207651_10134402
531 Ga0207651_10201455
532 Ga0207668_10149050
533 Ga0207640_10021784
534 Ga0207640_10135263
535 Ga0207658_10028754
536 Ga0207658_10293598
537 Ga0207677_10033408
538 Ga0207677_10052621
539 Ga0207703_10003782
540 Ga0207639_10590684
541 Ga0207678_10003440
542 Ga0207678_10024054
543 Ga0207678_10039899
544 Ga0207678_10051738
545 Ga0207678_10110397
546 Ga0207678_10208506
547 Ga0207641_10052622
548 Ga0207641_10102538
549 Ga0207641_10518765
550 Ga0207648_10039101
551 Ga0207648_10079189
552 Ga0207648_10164743
553 Ga0207648_10240189
554 Ga0207676_10240312
555 Ga0207676_10510730
556 Ga0207676_10586149
557 Ga0207674_10066059
558 Ga0207675_101076654
559 Ga0207683_10008762
560 Ga0207683_10083492
561 Ga0207683_10135141
562 Ga0207698_10026433
563 Ga0207698_10198446
564 Ga0268266_10051764
565 Ga0268266_10081531
566 Ga0268264_10075164
567 Ga0307406_10118196
568 Ga0307416_100296288
569 Ga0307414_10202946
570 Ga0373935_0040517
571 Ga0395899_0011172
572 Ga0395899_0011726
573 Ga0395899_0082793
574 Ga0395899_0095545
575 Ga0395899_0319407
576 Ga0395900_0015134
577 Ga0395900_0032640
578 Ga0395900_0066571
579 Ga0395900_0153366
580 Ga0395900_0232013
581 Ga0395900_0356496
582 Ga0395900_0426619
583 Ga0395900_0460560
584 Ga0395900_0865605
585 Ga0395898_0007043
586 Ga0395898_0038360
587 Ga0395898_0081162
588 Ga0395898_0084272
589 Ga0395898_0111541
590 Ga0395905_0000187
591 Ga0395905_0011414
592 Ga0395905_0019955
593 Ga0395905_0056308
594 Ga0395905_0071753
595 Ga0395905_0077585
596 Ga0395905_0092901
597 Ga0395905_0139455
598 Ga0395905_0147078
599 Ga0395905_0637420
600 Ga0395905_0743125
601 Ga0395901_0006129
602 Ga0395901_0025501
603 Ga0395901_0074140
604 Ga0395901_0177090
605 Ga0395901_0296485
606 Ga0395901_0301797
607 Ga0395901_0481576
608 Ga0395901_0930715
609 Ga0466968_0087576
610 Ga0466970_0173063
611 Ga0466957_0025203
612 Ga0466960_0030270
613 Ga0466967_0033597
614 Ga0466967_0041146
615 Ga0466967_0179080
616 Ga0466967_0879178
617 Ga0466967_0946965
618 Ga0495642_0048702
619 Ga0495598_0000224
620 Ga0495621_0000064
621 Ga0495633_0014381
622 Ga0495669_0005363
623 Ga0495669_0027620
624 Ga0495669_0246972
625 Ga0495670_0000346
626 Ga0495677_0007609
627 Ga0496100_0066903
628 Ga0496101_0052531
629 Ga0496102_0300415
630 Ga0496104_0285777
631 Ga0496106_0254144
632 Ga0496108_0021112
633 Ga0496109_0039709
634 Ga0496109_0080642
635 Ga0496109_0139964
636 Ga0496110_0268857
637 Ga0496112_0038539
638 Ga0496112_0096563
639 Ga0496112_0250232
640 Ga0496112_0292675
641 Ga0496112_0385006
642 Ga0496113_0020969
643 Ga0496113_0117646
644 Ga0496114_0000029
645 Ga0496114_0119242
646 Ga0496114_0540764
647 Ga0496115_0001950
648 Ga0587073_0206677
649 Ga0587069_063103
650 Ga0466962_0291203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10988

DUF2807

Putative auto-transporter adhesin, head GIN domain

37

142

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ygu-assembly1.cif.gz_A crystal structure of a putative adhesin (bacegg_01763) from bacteroides eggerthii dsm 20697 at 2.20 a resolution 0.954 31 125
4ygu-assembly3.cif.gz_C crystal structure of a putative adhesin (bacegg_01763) from bacteroides eggerthii dsm 20697 at 2.20 a resolution 0.9417 29 125
4ygu-assembly2.cif.gz_B crystal structure of a putative adhesin (bacegg_01763) from bacteroides eggerthii dsm 20697 at 2.20 a resolution 0.9208 31 125
4ygu-assembly4.cif.gz_D crystal structure of a putative adhesin (bacegg_01763) from bacteroides eggerthii dsm 20697 at 2.20 a resolution 0.9134 29 125
7muc-assembly1.cif.gz_AM legionella pneumophila dot/icm t4ss c1 reconstruction 0.8523 28 123
ID Description Score Start End Superfamily
3petB00 Mainly Beta;3 Solenoid;Pectate Lyase C-like; 0.8838 25 124 2.160.20.120
3jx8B00 Mainly Beta;3 Solenoid;Pectate Lyase C-like; 0.8269 28 123 2.160.20.120
3lycP00 Mainly Beta;3 Solenoid;Pectate Lyase C-like; 0.8065 28 124 2.160.20.120
3ljyB00 Mainly Beta;3 Solenoid;Pectate Lyase C-like; 0.7776 26 123 2.160.20.120
2l4wA01 Alpha Beta;3-Layer(bab) Sandwich;Phage tail protein beta-alpha-beta fold; 0.6627 68 84 3.55.50.70
ID Description Score Start End GO Terms
AF-A0A1I5WU62-F1-model_v4 Putative auto-transporter adhesin, head GIN domain 0.9345 25 125
AF-A0A536UFD1-F1-model_v4 DUF2807 domain-containing protein 0.9307 28 123
AF-U5Q5M7-F1-model_v4 Putative auto-transporter adhesin head GIN domain-containing protein 0.927 25 123
AF-A0A836SFU7-F1-model_v4 Putative auto-transporter adhesin head GIN domain-containing protein 0.9269 25 126
AF-A0A2N2YQS9-F1-model_v4 Putative auto-transporter adhesin head GIN domain-containing protein 0.9255 28 126

Map