F407790

General Info

Members Datasets Scaffolds Average Seq Length
325 168 650 301

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10149243|Ga0111539_101492434
Length 334
Sequence MAGDQRSAISDSLGGACGLPVAQAVVYGSMNDRRTFLKALGTTVAAAAVPVLTPLPATAVSRQGTAPGIRKSTLINMLPRDLSYAQRFAMARDAGFEAIEMQTITRDEEAAEIKEAAAKAGLRIHSVMNMDHWRLPLSSSDPDVVTKSVAGMQTSMKNAALWGADAVLLVPAVVDASTAYRDAYTRSQRVIRERLLPMAKDMKITIAVEEVWNKFLLSPIEFARYVDEFESPFLKAYFDVGNVVLFAFPQDWIRTLGARIVKLHLKDFSLDRRNGTYAWKPIGEGDIDWIEVRRALTDIKYNGYATTEVSGGDAAYLKDVASRVDRFLAGQKPV

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
115 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
150 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 2.46
Rhizosphere 95.69
Stem 0
Stem Tuber 0
Unclassified 13.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10149243 3300009094 Bacteria 2737
2 Ga0065712_10097907 3300005290 Bacteria 2135
3 Ga0065712_10127366 3300005290 Bacteria 1591
4 Ga0065715_10097137 3300005293 Bacteria 3756
5 Ga0065715_10097943 3300005293 Bacteria 3614
6 Ga0070676_10009665 3300005328 Bacteria 5215
7 Ga0070683_100003346 3300005329 Bacteria 12977
8 Ga0070670_100027822 3300005331 Bacteria 4864
9 Ga0070670_100281276 3300005331 Bacteria 1453
10 Ga0068869_100023766 3300005334 Bacteria 4239
11 Ga0070666_10069786 3300005335 Unclassified 2390
12 Ga0070691_10001790 3300005341 Bacteria 9337
13 Ga0070687_100028822 3300005343 Bacteria 2696
14 Ga0070661_100045232 3300005344 Bacteria 3218
15 Ga0070668_100054914 3300005347 Bacteria 3074
16 Ga0070669_100005839 3300005353 Bacteria 8875
17 Ga0070669_100144557 3300005353 Bacteria 1837
18 Ga0070669_100152568 3300005353 Bacteria 1789
19 Ga0070675_100131880 3300005354 Unclassified 2130
20 Ga0070675_100255839 3300005354 Bacteria 1533
21 Ga0070675_100269354 3300005354 Bacteria 1494
22 Ga0070671_100254741 3300005355 Bacteria 1491
23 Ga0070674_100017289 3300005356 Bacteria 4533
24 Ga0070673_100066386 3300005364 Bacteria 2882
25 Ga0070659_100381062 3300005366 Bacteria 1188
26 Ga0070667_100031026 3300005367 Bacteria 4456
27 Ga0070701_10064149 3300005438 Bacteria 1945
28 Ga0070701_10093151 3300005438 Bacteria 1655
29 Ga0070701_10164834 3300005438 Unclassified 1286
30 Ga0070705_100071427 3300005440 Bacteria 2099
31 Ga0070700_100007636 3300005441 Bacteria 5851
32 Ga0070700_100083977 3300005441 Bacteria 2063
33 Ga0070694_100018279 3300005444 Bacteria 4448
34 Ga0070694_100033207 3300005444 Bacteria 3394
35 Ga0070663_100015014 3300005455 Bacteria 4983
36 Ga0070663_100171528 3300005455 Unclassified 1677
37 Ga0070678_100206084 3300005456 Bacteria 1626
38 Ga0070662_100017946 3300005457 Bacteria 4778
39 Ga0070698_100025554 3300005471 Bacteria 6156
40 Ga0070698_100107587 3300005471 Unclassified 2756
41 Ga0070699_100045300 3300005518 Bacteria 3807
42 Ga0070699_100111085 3300005518 Bacteria 2407
43 Ga0070684_100002450 3300005535 Bacteria 13671
44 Ga0070697_100184918 3300005536 Bacteria 1767
45 Ga0068853_100009121 3300005539 Bacteria 7991
46 Ga0070696_100035247 3300005546 Bacteria 3444
47 Ga0070696_100128375 3300005546 Bacteria 1842
48 Ga0070696_100450944 3300005546 Bacteria 1015
49 Ga0070665_100241420 3300005548 Bacteria 1807
50 Ga0070704_100009915 3300005549 Bacteria 5780
51 Ga0070704_100057368 3300005549 Bacteria 2768
52 Ga0070704_100223237 3300005549 Bacteria 1533
53 Ga0070664_100001232 3300005564 Bacteria 20476
54 Ga0070664_100096184 3300005564 Bacteria 2569
55 Ga0070664_100417752 3300005564 Unclassified 1228
56 Ga0068857_100052668 3300005577 Unclassified 3610
57 Ga0068857_100241791 3300005577 Bacteria 1653
58 Ga0068856_100302874 3300005614 Bacteria 1616
59 Ga0070702_100067944 3300005615 Bacteria 2096
60 Ga0068859_100203505 3300005617 Unclassified 2065
61 Ga0068859_100692336 3300005617 Bacteria 1110
62 Ga0068866_10067133 3300005718 Bacteria 1882
63 Ga0068866_10255528 3300005718 Bacteria 1074
64 Ga0068861_100030628 3300005719 Bacteria 3945
65 Ga0068861_100030831 3300005719 Bacteria 3933
66 Ga0068861_100128349 3300005719 Bacteria 2055
67 Ga0068861_100227551 3300005719 Unclassified 1580
68 Ga0068861_100399132 3300005719 Bacteria 1220
69 Ga0068863_100001980 3300005841 Bacteria 20355
70 Ga0068863_100225717 3300005841 Bacteria 1805
71 Ga0068858_100144152 3300005842 Unclassified 2237
72 Ga0068858_100413763 3300005842 Bacteria 1296
73 Ga0068860_100116194 3300005843 Unclassified 2560
74 Ga0068862_100014205 3300005844 Bacteria 6604
75 Ga0068862_100036059 3300005844 Bacteria 4189
76 Ga0068862_100046021 3300005844 Bacteria 3724
77 Ga0068862_100252296 3300005844 Bacteria 1608
78 Ga0081455_10037169 3300005937 Bacteria 4328
79 Ga0081539_10065688 3300005985 Bacteria 1969
80 Ga0075365_10146266 3300006038 Bacteria 1642
81 Ga0075364_10262048 3300006051 Bacteria 1175
82 Ga0068871_100519015 3300006358 Bacteria 1075
83 Ga0075428_100000306 3300006844 Bacteria 48154
84 Ga0075428_100008373 3300006844 Bacteria 11465
85 Ga0075430_100000521 3300006846 Bacteria 28940
86 Ga0075430_100014648 3300006846 Bacteria 6680
87 Ga0075430_100042198 3300006846 Bacteria 3858
88 Ga0075431_100039834 3300006847 Bacteria 4841
89 Ga0075431_100444373 3300006847 Unclassified 1293
90 Ga0075431_100518976 3300006847 Bacteria 1181
91 Ga0075433_10039112 3300006852 Bacteria 4100
92 Ga0075433_10044572 3300006852 Unclassified 3854
93 Ga0075433_10053465 3300006852 Bacteria 3521
94 Ga0075433_10402815 3300006852 Bacteria 1207
95 Ga0075434_100000623 3300006871 Bacteria 27324
96 Ga0075434_100003838 3300006871 Bacteria 13434
97 Ga0075434_100017599 3300006871 Bacteria 6888
98 Ga0075434_100334124 3300006871 Unclassified 1536
99 Ga0075429_100000996 3300006880 Bacteria 22519
100 Ga0075429_100008186 3300006880 Bacteria 9088
101 Ga0075429_100010900 3300006880 Bacteria 7863
102 Ga0075429_100086704 3300006880 Bacteria 2729
103 Ga0075436_100001492 3300006914 Bacteria 15960
104 Ga0075436_100005121 3300006914 Bacteria 9023
105 Ga0075436_100181899 3300006914 Unclassified 1486
106 Ga0097620_100203510 3300006931 Unclassified 2065
107 Ga0097620_100692177 3300006931 Bacteria 1110
108 Ga0075435_100000001 3300007076 Bacteria 207579
109 Ga0075435_100001926 3300007076 Bacteria 13517
110 Ga0075435_100018464 3300007076 Bacteria 5305
111 Ga0075435_100035679 3300007076 Bacteria 3947
112 Ga0075435_100062563 3300007076 Bacteria 3020
113 Ga0105240_10642752 3300009093 Bacteria 1164
114 Ga0111539_10001319 3300009094 Bacteria 33146
115 Ga0111539_10001719 3300009094 Bacteria 29155
116 Ga0111539_10003324 3300009094 Bacteria 21234
117 Ga0111539_10035625 3300009094 Bacteria 6024
118 Ga0111539_10039970 3300009094 Bacteria 5649
119 Ga0111539_10327225 3300009094 Unclassified 1784
120 Ga0111539_10672030 3300009094 Bacteria 1206
121 Ga0114129_10005390 3300009147 Bacteria 18057
122 Ga0114129_10005998 3300009147 Bacteria 17218
123 Ga0114129_10007523 3300009147 Bacteria 15516
124 Ga0114129_10036984 3300009147 Bacteria 6892
125 Ga0114129_10050454 3300009147 Bacteria 5844
126 Ga0114129_10051897 3300009147 Bacteria 5756
127 Ga0114129_10068912 3300009147 Bacteria 4931
128 Ga0114129_10090970 3300009147 Bacteria 4229
129 Ga0114129_10148518 3300009147 Bacteria 3209
130 Ga0114129_10222506 3300009147 Unclassified 2545
131 Ga0114129_10293807 3300009147 Bacteria 2168
132 Ga0114129_10643110 3300009147 Bacteria 1370
133 Ga0114129_10869818 3300009147 Bacteria 1144
134 Ga0105242_10293994 3300009176 Bacteria 1480
135 Ga0105248_10063863 3300009177 Bacteria 4133
136 Ga0105248_10243728 3300009177 Unclassified 2023
137 Ga0105248_10454794 3300009177 Bacteria 1443
138 Ga0105249_10000493 3300009553 Bacteria 36447
139 Ga0105249_10137288 3300009553 Bacteria 2341
140 Ga0105249_10305934 3300009553 Bacteria 1596
141 Ga0163163_10153802 3300014325 Bacteria 2344
142 Ga0157380_10108241 3300014326 Bacteria 2330
143 Ga0157380_10181738 3300014326 Bacteria 1849
144 Ga0157380_10269689 3300014326 Bacteria 1551
145 Ga0157377_10009134 3300014745 Bacteria 4853
146 Ga0157379_10053750 3300014968 Bacteria 3599
147 Ga0157379_10083820 3300014968 Bacteria 2857
148 Ga0157379_10323197 3300014968 Bacteria 1409
149 Ga0213875_10125524 3300021388 Unclassified 1199
150 Ga0207697_10005597 3300025315 Bacteria 5816
151 Ga0207653_10021377 3300025885 Bacteria 2052
152 Ga0207688_10135847 3300025901 Bacteria 1444
153 Ga0207645_10011027 3300025907 Bacteria 6184
154 Ga0207643_10057414 3300025908 Bacteria 2215
155 Ga0207662_10194874 3300025918 Bacteria 1309
156 Ga0207646_10064837 3300025922 Bacteria 3261
157 Ga0207681_10011055 3300025923 Bacteria 5543
158 Ga0207681_10047722 3300025923 Bacteria 2887
159 Ga0207681_10106096 3300025923 Bacteria 2035
160 Ga0207650_10208244 3300025925 Bacteria 1570
161 Ga0207659_10000339 3300025926 Bacteria 28024
162 Ga0207659_10096421 3300025926 Unclassified 2220
163 Ga0207687_10352400 3300025927 Bacteria 1199
164 Ga0207664_10083209 3300025929 Bacteria 2608
165 Ga0207644_10282033 3300025931 Unclassified 1334
166 Ga0207644_10347722 3300025931 Bacteria 1203
167 Ga0207706_10429891 3300025933 Unclassified 1144
168 Ga0207670_10056017 3300025936 Bacteria 2667
169 Ga0207691_10216370 3300025940 Bacteria 1662
170 Ga0207689_10031367 3300025942 Bacteria 4425
171 Ga0207679_10068510 3300025945 Bacteria 2666
172 Ga0207679_10125892 3300025945 Unclassified 2047
173 Ga0207651_10303315 3300025960 Unclassified 1329
174 Ga0207712_10132437 3300025961 Bacteria 1902
175 Ga0207712_10189553 3300025961 Unclassified 1622
176 Ga0207712_10226592 3300025961 Bacteria 1498
177 Ga0207668_10021288 3300025972 Bacteria 4134
178 Ga0207640_10017066 3300025981 Bacteria 4240
179 Ga0207658_10146195 3300025986 Unclassified 1920
180 Ga0207703_10223850 3300026035 Bacteria 1684
181 Ga0207678_10135647 3300026067 Unclassified 2100
182 Ga0207708_10002349 3300026075 Bacteria 13895
183 Ga0207708_10105979 3300026075 Bacteria 2179
184 Ga0207708_10110123 3300026075 Bacteria 2137
185 Ga0207708_10374463 3300026075 Bacteria 1173
186 Ga0207702_10137040 3300026078 Bacteria 2210
187 Ga0207641_10002002 3300026088 Bacteria 19433
188 Ga0207641_10356827 3300026088 Unclassified 1395
189 Ga0207648_10032792 3300026089 Bacteria 4583
190 Ga0207674_10259025 3300026116 Bacteria 1687
191 Ga0207674_10416503 3300026116 Bacteria 1298
192 Ga0207675_100012044 3300026118 Bacteria 8080
193 Ga0207675_100084045 3300026118 Bacteria 2987
194 Ga0207675_100100736 3300026118 Bacteria 2721
195 Ga0207675_100278221 3300026118 Unclassified 1625
196 Ga0207428_10002710 3300027907 Bacteria 17656
197 Ga0207428_10039611 3300027907 Bacteria 3827
198 Ga0207428_10089886 3300027907 Unclassified 2386
199 Ga0268266_10010838 3300028379 Bacteria 7940
200 Ga0268265_10007905 3300028380 Bacteria 7176
201 Ga0268265_10045067 3300028380 Bacteria 3289
202 Ga0268265_10049933 3300028380 Bacteria 3149
203 Ga0268265_10122548 3300028380 Bacteria 2144
204 Ga0268265_10295236 3300028380 Bacteria 1457
205 Ga0268264_10067725 3300028381 Bacteria 3014
206 Ga0268264_10284067 3300028381 Bacteria 1551
207 Ga0307408_100023710 3300031548 Bacteria 4183
208 Ga0307408_100155518 3300031548 Bacteria 1810
209 Ga0307405_10088343 3300031731 Unclassified 2045
210 Ga0307410_10076600 3300031852 Bacteria 2335
211 Ga0307406_10014591 3300031901 Bacteria 4524
212 Ga0307407_10062332 3300031903 Unclassified 2183
213 Ga0307409_100162328 3300031995 Bacteria 1956
214 Ga0307416_100083946 3300032002 Bacteria 2704
215 Ga0307416_100174625 3300032002 Bacteria 2005
216 Ga0307416_100228928 3300032002 Unclassified 1790
217 Ga0307411_10079642 3300032005 Bacteria 2250
218 Ga0307411_10108297 3300032005 Bacteria 1982
219 Ga0307411_10242008 3300032005 Bacteria 1413
220 Ga0307415_100401608 3300032126 Bacteria 1170
221 Ga0373948_0004039 3300034817 Bacteria 2297
222 Ga0373938_0000356 3300034957 Bacteria 7284
223 Ga0373940_0000230 3300035088 Bacteria 7963
224 Ga0373949_0000625 3300035090 Bacteria 11554
225 Ga0373951_0001802 3300035091 Bacteria 5559
226 Ga0373952_0000746 3300035092 Bacteria 5838
227 Ga0373932_0000175 3300035112 Bacteria 18816
228 Ga0373939_0000321 3300035114 Bacteria 12466
229 Ga0373939_0012017 3300035114 Bacteria 2199
230 Ga0373941_0090406 3300035115 Bacteria 1049
231 Ga0373960_0000987 3300035121 Bacteria 6118
232 Ga0373960_0059546 3300035121 Bacteria 1155
233 Ga0373942_0000212 3300035207 Bacteria 15166
234 Ga0373961_0000382 3300035241 Bacteria 18738
235 Ga0373962_0005926 3300035242 Bacteria 2952
236 Ga0373931_0002609 3300035691 Bacteria 8021
237 Ga0436364_1365465 3300037853 Bacteria 2334
238 Ga0436364_1504913 3300037853 Unclassified 4580
239 Ga0439450_005544 3300042008 Bacteria 2227
240 Ga0439464_0003572 3300042439 Bacteria 3934
241 Ga0451577_0013119 3300042876 Bacteria 7767
242 Ga0453684_0138122 3300044712 Unclassified 2915
243 Ga0453684_0625444 3300044712 Bacteria 1177
244 Ga0451576_0013407 3300045051 Bacteria 9171
245 Ga0495598_0108079 3300046537 Bacteria 929
246 Ga0495659_0040446 3300046664 Bacteria 1662
247 Ga0496102_0346043 3300048905 Bacteria 1400
248 Ga0496105_0042388 3300048908 Bacteria 3752
249 Ga0496106_0041521 3300048909 Bacteria 3447
250 Ga0496106_0265708 3300048909 Unclassified 1373
251 Ga0496108_0007522 3300048911 Bacteria 8833
252 Ga0496109_0001987 3300048912 Bacteria 16952
253 Ga0496110_0037963 3300048913 Bacteria 4188
254 Ga0496112_0000728 3300048915 Bacteria 22872
255 Ga0501042_0199726 3300049578 Bacteria 1442
256 Ga0501042_0266940 3300049578 Bacteria 1236
257 Ga0501071_0042668 3300049587 Bacteria 3251
258 Ga0501072_0144069 3300049588 Bacteria 1900
259 Ga0501075_0091986 3300049591 Bacteria 2302
260 Ga0501075_0123948 3300049591 Bacteria 1967
261 Ga0501075_0235349 3300049591 Unclassified 1396
262 Ga0501076_0069940 3300049592 Bacteria 2805
263 Ga0501077_0264054 3300049593 Bacteria 1095
264 Ga0501202_007729 3300049652 Bacteria 1948
265 Ga0501257_024425 3300049686 Bacteria 1436
266 Ga0501079_0043160 3300049741 Bacteria 3481
267 Ga0501081_0114538 3300049743 Bacteria 1916
268 Ga0501081_0122454 3300049743 Bacteria 1854
269 Ga0501045_0086791 3300049824 Bacteria 2310
270 Ga0501045_0104710 3300049824 Bacteria 2096
271 Ga0501045_0291974 3300049824 Bacteria 1213
272 nmdc:mga00v17_246650_c1 3300050491 Bacteria 1158
273 nmdc:mga05p37_316640_c1 3300050507 Bacteria 1848
274 nmdc:mga05p37_32154_c1 3300050507 Bacteria 6416
275 nmdc:mga05p37_35901_c1 3300050507 Bacteria 6082
276 nmdc:mga05p37_41748_c1 3300050507 Bacteria 5633
277 nmdc:mga05p37_43743_c1 3300050507 Bacteria 5154
278 nmdc:mga05p37_47665_c1 3300050507 Bacteria 5269
279 nmdc:mga05p37_5763_c1 3300050507 Bacteria 14572
280 nmdc:mga05p37_69276_c1 3300050507 Bacteria 4339
281 nmdc:mga05p37_7332_c1 3300050507 Bacteria 13012
282 nmdc:mga05p37_814290_c1 3300050507 Bacteria 1020
283 nmdc:mga09592_105028_c1 3300050508 Unclassified 2421
284 nmdc:mga09592_7891_c1 3300050508 Bacteria 8652
285 nmdc:mga0qj67_130481_c1 3300050509 Bacteria 2036
286 nmdc:mga0qj67_42281_c1 3300050509 Bacteria 3587
287 nmdc:mga0qj67_75624_c1 3300050509 Bacteria 2692
288 nmdc:mga0qj67_8170_c1 3300050509 Bacteria 7755
289 nmdc:mga06r32_14149_c1 3300050510 Bacteria 7236
290 nmdc:mga06r32_63305_c1 3300050510 Bacteria 3565
291 nmdc:mga06r32_82172_c1 3300050510 Unclassified 3138
292 nmdc:mga08y16_1082_c1 3300050511 Bacteria 26818
293 nmdc:mga08y16_10901_c1 3300050511 Bacteria 9548
294 nmdc:mga08y16_141299_c1 3300050511 Unclassified 2503
295 nmdc:mga08y16_17765_c1 3300050511 Bacteria 7491
296 nmdc:mga0n895_141527_c1 3300050512 Bacteria 2434
297 nmdc:mga0n895_1691_c1 3300050512 Bacteria 16665
298 nmdc:mga0n895_279670_c1 3300050512 Bacteria 1692
299 nmdc:mga0n895_2962_c1 3300050512 Bacteria 13476
300 nmdc:mga0n895_47383_c1 3300050512 Bacteria 4202
301 nmdc:mga0n895_56350_c1 3300050512 Bacteria 3872
302 nmdc:mga0rr50_11_c1 3300050513 Bacteria 216152
303 nmdc:mga0rr50_229_c1 3300050513 Bacteria 30304
304 nmdc:mga0rr50_33079_c1 3300050513 Bacteria 3691
305 nmdc:mga0rr50_4446_c1 3300050513 Bacteria 8249
306 nmdc:mga08x19_16904_c1 3300050514 Bacteria 4457
307 nmdc:mga08x19_3054_c1 3300050514 Bacteria 10064
308 nmdc:mga0a205_202542_c1 3300050515 Unclassified 1875
309 nmdc:mga0a205_204161_c1 3300050515 Unclassified 1866
310 nmdc:mga0a205_258425_c1 3300050515 Bacteria 1620
311 nmdc:mga0a205_47827_c1 3300050515 Bacteria 4128
312 nmdc:mga0a205_58986_c1 3300050515 Bacteria 3707
313 nmdc:mga0a205_78334_c1 3300050515 Bacteria 3193
314 Ga0501084_0013765 3300054114 Bacteria 6694
315 Ga0501084_0372985 3300054114 Bacteria 1206
316 Ga0590071_000045 3300059421 Bacteria 31970
317 Ga0590071_021856 3300059421 Bacteria 1509
318 Ga0590071_024290 3300059421 Bacteria 1436
319 Ga0590074_000590 3300059423 Bacteria 5470
320 Ga0590074_017297 3300059423 Bacteria 1231
321 Ga0590075_000041 3300059424 Bacteria 33435
322 Ga0590075_001502 3300059424 Bacteria 5811
323 Ga0590075_030032 3300059424 Bacteria 1375
324 Ga0590077_000933 3300059426 Bacteria 7464
325 Ga0590077_002897 3300059426 Bacteria 3600
326 Ga0111539_10149243
327 Ga0065712_10097907
328 Ga0065712_10127366
329 Ga0065715_10097137
330 Ga0065715_10097943
331 Ga0070676_10009665
332 Ga0070683_100003346
333 Ga0070670_100027822
334 Ga0070670_100281276
335 Ga0068869_100023766
336 Ga0070666_10069786
337 Ga0070691_10001790
338 Ga0070687_100028822
339 Ga0070661_100045232
340 Ga0070668_100054914
341 Ga0070669_100005839
342 Ga0070669_100144557
343 Ga0070669_100152568
344 Ga0070675_100131880
345 Ga0070675_100255839
346 Ga0070675_100269354
347 Ga0070671_100254741
348 Ga0070674_100017289
349 Ga0070673_100066386
350 Ga0070659_100381062
351 Ga0070667_100031026
352 Ga0070701_10064149
353 Ga0070701_10093151
354 Ga0070701_10164834
355 Ga0070705_100071427
356 Ga0070700_100007636
357 Ga0070700_100083977
358 Ga0070694_100018279
359 Ga0070694_100033207
360 Ga0070663_100015014
361 Ga0070663_100171528
362 Ga0070678_100206084
363 Ga0070662_100017946
364 Ga0070698_100025554
365 Ga0070698_100107587
366 Ga0070699_100045300
367 Ga0070699_100111085
368 Ga0070684_100002450
369 Ga0070697_100184918
370 Ga0068853_100009121
371 Ga0070696_100035247
372 Ga0070696_100128375
373 Ga0070696_100450944
374 Ga0070665_100241420
375 Ga0070704_100009915
376 Ga0070704_100057368
377 Ga0070704_100223237
378 Ga0070664_100001232
379 Ga0070664_100096184
380 Ga0070664_100417752
381 Ga0068857_100052668
382 Ga0068857_100241791
383 Ga0068856_100302874
384 Ga0070702_100067944
385 Ga0068859_100203505
386 Ga0068859_100692336
387 Ga0068866_10067133
388 Ga0068866_10255528
389 Ga0068861_100030628
390 Ga0068861_100030831
391 Ga0068861_100128349
392 Ga0068861_100227551
393 Ga0068861_100399132
394 Ga0068863_100001980
395 Ga0068863_100225717
396 Ga0068858_100144152
397 Ga0068858_100413763
398 Ga0068860_100116194
399 Ga0068862_100014205
400 Ga0068862_100036059
401 Ga0068862_100046021
402 Ga0068862_100252296
403 Ga0081455_10037169
404 Ga0081539_10065688
405 Ga0075365_10146266
406 Ga0075364_10262048
407 Ga0068871_100519015
408 Ga0075428_100000306
409 Ga0075428_100008373
410 Ga0075430_100000521
411 Ga0075430_100014648
412 Ga0075430_100042198
413 Ga0075431_100039834
414 Ga0075431_100444373
415 Ga0075431_100518976
416 Ga0075433_10039112
417 Ga0075433_10044572
418 Ga0075433_10053465
419 Ga0075433_10402815
420 Ga0075434_100000623
421 Ga0075434_100003838
422 Ga0075434_100017599
423 Ga0075434_100334124
424 Ga0075429_100000996
425 Ga0075429_100008186
426 Ga0075429_100010900
427 Ga0075429_100086704
428 Ga0075436_100001492
429 Ga0075436_100005121
430 Ga0075436_100181899
431 Ga0097620_100203510
432 Ga0097620_100692177
433 Ga0075435_100000001
434 Ga0075435_100001926
435 Ga0075435_100018464
436 Ga0075435_100035679
437 Ga0075435_100062563
438 Ga0105240_10642752
439 Ga0111539_10001319
440 Ga0111539_10001719
441 Ga0111539_10003324
442 Ga0111539_10035625
443 Ga0111539_10039970
444 Ga0111539_10327225
445 Ga0111539_10672030
446 Ga0114129_10005390
447 Ga0114129_10005998
448 Ga0114129_10007523
449 Ga0114129_10036984
450 Ga0114129_10050454
451 Ga0114129_10051897
452 Ga0114129_10068912
453 Ga0114129_10090970
454 Ga0114129_10148518
455 Ga0114129_10222506
456 Ga0114129_10293807
457 Ga0114129_10643110
458 Ga0114129_10869818
459 Ga0105242_10293994
460 Ga0105248_10063863
461 Ga0105248_10243728
462 Ga0105248_10454794
463 Ga0105249_10000493
464 Ga0105249_10137288
465 Ga0105249_10305934
466 Ga0163163_10153802
467 Ga0157380_10108241
468 Ga0157380_10181738
469 Ga0157380_10269689
470 Ga0157377_10009134
471 Ga0157379_10053750
472 Ga0157379_10083820
473 Ga0157379_10323197
474 Ga0213875_10125524
475 Ga0207697_10005597
476 Ga0207653_10021377
477 Ga0207688_10135847
478 Ga0207645_10011027
479 Ga0207643_10057414
480 Ga0207662_10194874
481 Ga0207646_10064837
482 Ga0207681_10011055
483 Ga0207681_10047722
484 Ga0207681_10106096
485 Ga0207650_10208244
486 Ga0207659_10000339
487 Ga0207659_10096421
488 Ga0207687_10352400
489 Ga0207664_10083209
490 Ga0207644_10282033
491 Ga0207644_10347722
492 Ga0207706_10429891
493 Ga0207670_10056017
494 Ga0207691_10216370
495 Ga0207689_10031367
496 Ga0207679_10068510
497 Ga0207679_10125892
498 Ga0207651_10303315
499 Ga0207712_10132437
500 Ga0207712_10189553
501 Ga0207712_10226592
502 Ga0207668_10021288
503 Ga0207640_10017066
504 Ga0207658_10146195
505 Ga0207703_10223850
506 Ga0207678_10135647
507 Ga0207708_10002349
508 Ga0207708_10105979
509 Ga0207708_10110123
510 Ga0207708_10374463
511 Ga0207702_10137040
512 Ga0207641_10002002
513 Ga0207641_10356827
514 Ga0207648_10032792
515 Ga0207674_10259025
516 Ga0207674_10416503
517 Ga0207675_100012044
518 Ga0207675_100084045
519 Ga0207675_100100736
520 Ga0207675_100278221
521 Ga0207428_10002710
522 Ga0207428_10039611
523 Ga0207428_10089886
524 Ga0268266_10010838
525 Ga0268265_10007905
526 Ga0268265_10045067
527 Ga0268265_10049933
528 Ga0268265_10122548
529 Ga0268265_10295236
530 Ga0268264_10067725
531 Ga0268264_10284067
532 Ga0307408_100023710
533 Ga0307408_100155518
534 Ga0307405_10088343
535 Ga0307410_10076600
536 Ga0307406_10014591
537 Ga0307407_10062332
538 Ga0307409_100162328
539 Ga0307416_100083946
540 Ga0307416_100174625
541 Ga0307416_100228928
542 Ga0307411_10079642
543 Ga0307411_10108297
544 Ga0307411_10242008
545 Ga0307415_100401608
546 Ga0373948_0004039
547 Ga0373938_0000356
548 Ga0373940_0000230
549 Ga0373949_0000625
550 Ga0373951_0001802
551 Ga0373952_0000746
552 Ga0373932_0000175
553 Ga0373939_0000321
554 Ga0373939_0012017
555 Ga0373941_0090406
556 Ga0373960_0000987
557 Ga0373960_0059546
558 Ga0373942_0000212
559 Ga0373961_0000382
560 Ga0373962_0005926
561 Ga0373931_0002609
562 Ga0436364_1365465
563 Ga0436364_1504913
564 Ga0439450_005544
565 Ga0439464_0003572
566 Ga0451577_0013119
567 Ga0453684_0138122
568 Ga0453684_0625444
569 Ga0451576_0013407
570 Ga0495598_0108079
571 Ga0495659_0040446
572 Ga0496102_0346043
573 Ga0496105_0042388
574 Ga0496106_0041521
575 Ga0496106_0265708
576 Ga0496108_0007522
577 Ga0496109_0001987
578 Ga0496110_0037963
579 Ga0496112_0000728
580 Ga0501042_0199726
581 Ga0501042_0266940
582 Ga0501071_0042668
583 Ga0501072_0144069
584 Ga0501075_0091986
585 Ga0501075_0123948
586 Ga0501075_0235349
587 Ga0501076_0069940
588 Ga0501077_0264054
589 Ga0501202_007729
590 Ga0501257_024425
591 Ga0501079_0043160
592 Ga0501081_0114538
593 Ga0501081_0122454
594 Ga0501045_0086791
595 Ga0501045_0104710
596 Ga0501045_0291974
597 nmdc:mga00v17_246650_c1
598 nmdc:mga05p37_316640_c1
599 nmdc:mga05p37_32154_c1
600 nmdc:mga05p37_35901_c1
601 nmdc:mga05p37_41748_c1
602 nmdc:mga05p37_43743_c1
603 nmdc:mga05p37_47665_c1
604 nmdc:mga05p37_5763_c1
605 nmdc:mga05p37_69276_c1
606 nmdc:mga05p37_7332_c1
607 nmdc:mga05p37_814290_c1
608 nmdc:mga09592_105028_c1
609 nmdc:mga09592_7891_c1
610 nmdc:mga0qj67_130481_c1
611 nmdc:mga0qj67_42281_c1
612 nmdc:mga0qj67_75624_c1
613 nmdc:mga0qj67_8170_c1
614 nmdc:mga06r32_14149_c1
615 nmdc:mga06r32_63305_c1
616 nmdc:mga06r32_82172_c1
617 nmdc:mga08y16_1082_c1
618 nmdc:mga08y16_10901_c1
619 nmdc:mga08y16_141299_c1
620 nmdc:mga08y16_17765_c1
621 nmdc:mga0n895_141527_c1
622 nmdc:mga0n895_1691_c1
623 nmdc:mga0n895_279670_c1
624 nmdc:mga0n895_2962_c1
625 nmdc:mga0n895_47383_c1
626 nmdc:mga0n895_56350_c1
627 nmdc:mga0rr50_11_c1
628 nmdc:mga0rr50_229_c1
629 nmdc:mga0rr50_33079_c1
630 nmdc:mga0rr50_4446_c1
631 nmdc:mga08x19_16904_c1
632 nmdc:mga08x19_3054_c1
633 nmdc:mga0a205_202542_c1
634 nmdc:mga0a205_204161_c1
635 nmdc:mga0a205_258425_c1
636 nmdc:mga0a205_47827_c1
637 nmdc:mga0a205_58986_c1
638 nmdc:mga0a205_78334_c1
639 Ga0501084_0013765
640 Ga0501084_0372985
641 Ga0590071_000045
642 Ga0590071_021856
643 Ga0590071_024290
644 Ga0590074_000590
645 Ga0590074_017297
646 Ga0590075_000041
647 Ga0590075_001502
648 Ga0590075_030032
649 Ga0590077_000933
650 Ga0590077_002897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

88

326

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqj-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ 0.8596 38 299
3cqk-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with zn2+ and sulfate 0.8568 38 299
3cqi-assembly1.cif.gz_B crystal structure of l-xylulose-5-phosphate 3-epimerase ulae (form b) complex with sulfate 0.8523 38 299
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.8459 38 289
7cj4-assembly1.cif.gz_A crystal structure of homo dimeric d-allulose 3-epimerase from methylomonas sp. 0.8333 36 277
ID Description Score Start End Superfamily
3cqiB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8523 38 299 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8433 38 289 3.20.20.150
3wqoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8373 38 298 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8356 38 298 3.20.20.150
3kwsB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8305 36 298 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V9LB64-F1-model_v4 Xylose isomerase 0.9878 46 208 GO:0016853
AF-A0A2V8TZH8-F1-model_v4 Xylose isomerase 0.9877 46 300 GO:0016853
AF-A0A2V9IH45-F1-model_v4 Xylose isomerase 0.9838 97 304 GO:0016853
AF-A0A2V8TZH8-F1-model_v4 Xylose isomerase 0.9838 46 300 GO:0016853
AF-A0A831TWV8-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9821 168 304 GO:0016853

Map