F407725

General Info

Members Datasets Scaffolds Average Seq Length
325 178 285 158

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100000049|Ga0068855_100000049129
Length 187
Sequence LPQLFLRGKGILQISTMSTFYFIAFLSIFFSILVITAKNPVHSILYLILTFFTFTIHYILMNAQFLAIVNFIVYMGAILVLFLYTLMLINLNKDSEPRKSNLVKIAGFVGGGCFLITVVAALKAFGASPVVVLNNPNLGLVKNLGKILFNEYLLPFEVSSILLLSAMVGAVLLATKDKKLPDGNLNA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543023 Pedobacter sp. OK628 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367663 Pedobacter sp. YR510 Isolate Unclassified
12 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
13 2818991437 Pedobacter terrae 518 Isolate Unclassified
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
16 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
17 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
18 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
19 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
20 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
21 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
22 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
23 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
24 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
25 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
26 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
27 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
28 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
29 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
30 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
31 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
32 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
33 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
34 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
35 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
36 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
37 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
38 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
39 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
40 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
41 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
42 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
43 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
44 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
45 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
46 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
47 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
48 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
49 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
50 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
51 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
52 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
53 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
169 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
170 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
171 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
172 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
176 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
177 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
178 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.08
Metatranscriptomes 0.62
Isolates 12.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.85
Nodule 0
Rhizoplane 0.92
Rhizosphere 79.08
Stem 0
Stem Tuber 0
Unclassified 14.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3565021 2162886007 Bacteria 6250
2 JGI24736J21556_1012150 3300001904 Bacteria 1397
3 JGI24740J21852_10019901 3300001979 Bacteria 2354
4 JGI24737J22298_10004213 3300001990 Bacteria 5029
5 JGI24737J22298_10015866 3300001990 Bacteria 2435
6 JGI24737J22298_10026500 3300001990 Bacteria 1830
7 JGI24735J21928_10057279 3300002067 Bacteria 1121
8 JGI24735J21928_10067252 3300002067 Bacteria 1028
9 JGI24744J21845_10008990 3300002077 Bacteria 2053
10 JGI25162J39368_1000562 3300002737 Bacteria 27227
11 JGI25157J39369_1004898 3300002741 Bacteria 2305
12 JGI25164J39214_1002386 3300002772 Bacteria 2927
13 JGI25165J46597_1002545 3300003214 Bacteria 5692
14 rootH1_10153955 3300003316 Bacteria 1507
15 rootH2_10009361 3300003320 Bacteria 18045
16 rootH2_10079099 3300003320 Bacteria 1361
17 rootH2_10089619 3300003320 Bacteria 1891
18 rootH2_10103344 3300003320 Bacteria 2369
19 rootH1_10012646 3300003323 Bacteria 62371
20 rootH1_10012676 3300003323 Bacteria 3277
21 rootH1_10109882 3300003323 Bacteria 7325
22 rootH1_10295909 3300003323 Bacteria 1728
23 Ga0058863_10008894 3300004799 Bacteria 11745
24 Ga0058861_12051963 3300004800 Bacteria 1232
25 Ga0065165_1001313 3300005262 Bacteria 27754
26 Ga0065714_10003510 3300005288 Bacteria 9251
27 Ga0065714_10065068 3300005288 Bacteria 13285
28 Ga0065714_10066813 3300005288 Bacteria 6259
29 Ga0065714_10079909 3300005288 Bacteria 2480
30 Ga0065704_10000273 3300005289 Bacteria 42739
31 Ga0065704_10012261 3300005289 Bacteria 1919
32 Ga0065704_10088420 3300005289 Bacteria 2936
33 Ga0065704_10197852 3300005289 Bacteria 1160
34 Ga0065704_10246691 3300005289 Bacteria 1000
35 Ga0070658_10533866 3300005327 Bacteria 1015
36 Ga0070676_10000113 3300005328 Bacteria 29666
37 Ga0070683_100196990 3300005329 Bacteria 1913
38 Ga0068869_100545778 3300005334 Bacteria 973
39 Ga0070660_100141445 3300005339 Bacteria 1931
40 Ga0070674_100146792 3300005356 Bacteria 1776
41 Ga0070673_100031160 3300005364 Bacteria 3999
42 Ga0070659_100010145 3300005366 Bacteria 6931
43 Ga0070659_100436553 3300005366 Bacteria 1109
44 Ga0070659_100694112 3300005366 Bacteria 880
45 Ga0070663_100022627 3300005455 Bacteria 4205
46 Ga0070678_100023305 3300005456 Bacteria 4123
47 Ga0070662_100000090 3300005457 Bacteria 49884
48 Ga0070679_100013906 3300005530 Bacteria 7712
49 Ga0070684_100288197 3300005535 Bacteria 1505
50 Ga0068853_100149099 3300005539 Bacteria 2104
51 Ga0068853_100262187 3300005539 Bacteria 1589
52 Ga0070665_100000118 3300005548 Bacteria 149830
53 Ga0068855_100000049 3300005563 Bacteria 145321
54 Ga0068855_100000155 3300005563 Bacteria 86903
55 Ga0068855_100019434 3300005563 Bacteria 8163
56 Ga0068855_100049148 3300005563 Bacteria 4975
57 Ga0068855_100054484 3300005563 Bacteria 4700
58 Ga0068855_100233481 3300005563 Bacteria 2058
59 Ga0068855_100656552 3300005563 Bacteria 1126
60 Ga0068855_101074306 3300005563 Bacteria 842
61 Ga0068857_100801186 3300005577 Bacteria 900
62 Ga0068856_100003614 3300005614 Bacteria 15546
63 Ga0068856_100016616 3300005614 Bacteria 7125
64 Ga0068856_100063782 3300005614 Bacteria 3640
65 Ga0068856_100224769 3300005614 Bacteria 1892
66 Ga0068852_100026093 3300005616 Bacteria 4744
67 Ga0068852_100374176 3300005616 Bacteria 1396
68 Ga0068852_100521449 3300005616 Bacteria 1186
69 Ga0068852_101801203 3300005616 Bacteria 635
70 Ga0068870_10118427 3300005840 Bacteria 1522
71 Ga0068858_100124274 3300005842 Bacteria 2415
72 Ga0070716_100834686 3300006173 Bacteria 716
73 Ga0075366_10000135 3300006195 Bacteria 30916
74 Ga0075366_10060441 3300006195 Bacteria 2251
75 Ga0097621_100000015 3300006237 Bacteria 92182
76 Ga0097621_101013528 3300006237 Bacteria 777
77 Ga0097621_101133266 3300006237 Bacteria 735
78 Ga0075370_10159665 3300006353 Bacteria 1323
79 Ga0068871_100000051 3300006358 Bacteria 64844
80 Ga0068865_100002736 3300006881 Bacteria 10472
81 Ga0105240_10002021 3300009093 Bacteria 33455
82 Ga0105240_10017563 3300009093 Bacteria 9638
83 Ga0105240_10053010 3300009093 Bacteria 5095
84 Ga0105240_10060549 3300009093 Bacteria 4720
85 Ga0105240_10119438 3300009093 Bacteria 3175
86 Ga0105240_10757120 3300009093 Bacteria 1055
87 Ga0105245_10637391 3300009098 Bacteria 1095
88 Ga0105245_11556718 3300009098 Bacteria 712
89 Ga0105243_10000003 3300009148 Bacteria 712931
90 Ga0105243_10177008 3300009148 Bacteria 1852
91 Ga0105241_10000804 3300009174 Bacteria 23826
92 Ga0105241_10005937 3300009174 Bacteria 9003
93 Ga0105241_10037284 3300009174 Bacteria 3661
94 Ga0105241_10503708 3300009174 Bacteria 1080
95 Ga0105241_10928967 3300009174 Unclassified 810
96 Ga0105242_10228729 3300009176 Bacteria 1666
97 Ga0105242_11529690 3300009176 Bacteria 699
98 Ga0105237_10001895 3300009545 Bacteria 26705
99 Ga0105237_10002529 3300009545 Bacteria 22637
100 Ga0105237_10004676 3300009545 Bacteria 15757
101 Ga0105237_10378642 3300009545 Bacteria 1420
102 Ga0105238_10059144 3300009551 Bacteria 3840
103 Ga0105238_10153650 3300009551 Bacteria 2276
104 Ga0105239_10000049 3300010375 Bacteria 177578
105 Ga0105239_10000166 3300010375 Bacteria 94743
106 Ga0105239_10003703 3300010375 Bacteria 18614
107 Ga0105239_10020179 3300010375 Bacteria 7352
108 Ga0105239_10064383 3300010375 Bacteria 4025
109 Ga0105239_10332368 3300010375 Bacteria 1714
110 Ga0157373_10000086 3300013100 Bacteria 80524
111 Ga0157373_10009487 3300013100 Bacteria 7190
112 Ga0157373_10025296 3300013100 Bacteria 4296
113 Ga0157373_10026642 3300013100 Bacteria 4173
114 Ga0157373_10035803 3300013100 Bacteria 3563
115 Ga0157373_10134293 3300013100 Bacteria 1740
116 Ga0157373_10163784 3300013100 Bacteria 1565
117 Ga0157371_10000107 3300013102 Bacteria 126477
118 Ga0157371_10001199 3300013102 Bacteria 27770
119 Ga0157371_10001277 3300013102 Bacteria 26563
120 Ga0157371_10001603 3300013102 Bacteria 23199
121 Ga0157371_10011057 3300013102 Bacteria 6991
122 Ga0157371_10040376 3300013102 Bacteria 3333
123 Ga0157370_10010241 3300013104 Bacteria 9900
124 Ga0157370_10031919 3300013104 Bacteria 5147
125 Ga0157370_10039745 3300013104 Bacteria 4545
126 Ga0157370_10040787 3300013104 Bacteria 4481
127 Ga0157370_10292215 3300013104 Bacteria 1505
128 Ga0157370_10303579 3300013104 Bacteria 1473
129 Ga0157370_10320023 3300013104 Bacteria 1431
130 Ga0157369_10003605 3300013105 Bacteria 18401
131 Ga0157369_10030384 3300013105 Bacteria 5958
132 Ga0157369_10062384 3300013105 Bacteria 4016
133 Ga0157369_10063526 3300013105 Bacteria 3977
134 Ga0157369_11458735 3300013105 Bacteria 696
135 Ga0157369_11864979 3300013105 Bacteria 610
136 Ga0157374_10000301 3300013296 Bacteria 45768
137 Ga0157374_10001665 3300013296 Bacteria 18606
138 Ga0157374_10003138 3300013296 Bacteria 13890
139 Ga0157374_10240993 3300013296 Bacteria 1778
140 Ga0157374_10305191 3300013296 Bacteria 1575
141 Ga0157374_11420384 3300013296 Bacteria 717
142 Ga0157378_10023968 3300013297 Bacteria 5368
143 Ga0157378_10026892 3300013297 Bacteria 5074
144 Ga0163162_10000012 3300013306 Bacteria 292674
145 Ga0163162_10039941 3300013306 Bacteria 4690
146 Ga0157372_10000039 3300013307 Bacteria 165839
147 Ga0157372_10000238 3300013307 Bacteria 60988
148 Ga0157372_10041830 3300013307 Bacteria 5067
149 Ga0157372_10167808 3300013307 Bacteria 2539
150 Ga0157375_10003657 3300013308 Bacteria 13335
151 Ga0157375_10023596 3300013308 Bacteria 5678
152 Ga0157375_10096455 3300013308 Bacteria 3030
153 Ga0182008_10000020 3300014497 Bacteria 228333
154 Ga0182008_10009526 3300014497 Bacteria 5238
155 Ga0182008_10041174 3300014497 Bacteria 2304
156 Ga0182008_10319515 3300014497 Bacteria 817
157 Ga0182006_1002254 3300015261 Bacteria 10653
158 Ga0182006_1032459 3300015261 Bacteria 2098
159 Ga0182007_10012257 3300015262 Bacteria 3304
160 Ga0182007_10024067 3300015262 Bacteria 2135
161 Ga0182007_10068917 3300015262 Bacteria 1159
162 Ga0163161_10014389 3300017792 Bacteria 5508
163 Ga0163161_10123753 3300017792 Bacteria 1945
164 Ga0163161_10402261 3300017792 Bacteria 1098
165 Ga0213872_10030026 3300021361 Bacteria 2492
166 Ga0209563_105500 3300025230 Bacteria 2289
167 Ga0207427_100122 3300025231 Bacteria 99064
168 Ga0209437_100048 3300025233 Bacteria 405107
169 Ga0209026_1001423 3300025250 Bacteria 10617
170 Ga0209026_1002188 3300025250 Bacteria 7571
171 Ga0209026_1005112 3300025250 Bacteria 3630
172 Ga0209026_1017784 3300025250 Bacteria 1132
173 Ga0209026_1026798 3300025250 Bacteria 865
174 Ga0209233_1000029 3300025261 Bacteria 641642
175 Ga0209233_1001271 3300025261 Bacteria 10114
176 Ga0209455_1003330 3300025272 Bacteria 5745
177 Ga0207647_10000018 3300025904 Bacteria 124816
178 Ga0207647_10000071 3300025904 Bacteria 79170
179 Ga0207647_10163731 3300025904 Bacteria 1296
180 Ga0207643_10026760 3300025908 Bacteria 3195
181 Ga0207705_10000026 3300025909 Bacteria 256051
182 Ga0207705_10130697 3300025909 Bacteria 1869
183 Ga0207705_10150944 3300025909 Bacteria 1741
184 Ga0207654_10001026 3300025911 Bacteria 15268
185 Ga0207654_10059333 3300025911 Bacteria 2231
186 Ga0207695_10014909 3300025913 Bacteria 9174
187 Ga0207695_10046838 3300025913 Bacteria 4581
188 Ga0207695_10214854 3300025913 Bacteria 1832
189 Ga0207695_10233484 3300025913 Bacteria 1743
190 Ga0207695_11418905 3300025913 Bacteria 575
191 Ga0207695_11456428 3300025913 Bacteria 565
192 Ga0207671_10001959 3300025914 Bacteria 22712
193 Ga0207671_10007623 3300025914 Bacteria 9357
194 Ga0207671_10022607 3300025914 Bacteria 4751
195 Ga0207671_10057163 3300025914 Bacteria 2891
196 Ga0207671_10278264 3300025914 Bacteria 1319
197 Ga0207652_10012241 3300025921 Bacteria 6930
198 Ga0207644_10012843 3300025931 Bacteria 5571
199 Ga0207690_10001688 3300025932 Bacteria 13606
200 Ga0207690_10128199 3300025932 Bacteria 1853
201 Ga0207690_10790795 3300025932 Bacteria 784
202 Ga0207706_10005255 3300025933 Bacteria 12077
203 Ga0207706_10650587 3300025933 Bacteria 903
204 Ga0207709_10000008 3300025935 Bacteria 713099
205 Ga0207661_10135111 3300025944 Bacteria 2117
206 Ga0207667_10000015 3300025949 Bacteria 417534
207 Ga0207667_10012483 3300025949 Bacteria 9783
208 Ga0207667_10060601 3300025949 Bacteria 3961
209 Ga0207667_10169104 3300025949 Bacteria 2247
210 Ga0207667_10817225 3300025949 Bacteria 928
211 Ga0207667_10961564 3300025949 Bacteria 843
212 Ga0207677_10466088 3300026023 Bacteria 1085
213 Ga0207703_10082239 3300026035 Bacteria 2687
214 Ga0207703_10166877 3300026035 Bacteria 1933
215 Ga0207639_10100873 3300026041 Bacteria 2332
216 Ga0207639_10131419 3300026041 Bacteria 2073
217 Ga0207702_10000163 3300026078 Bacteria 79263
218 Ga0207702_10048496 3300026078 Bacteria 3582
219 Ga0207702_10049475 3300026078 Bacteria 3547
220 Ga0207702_10507643 3300026078 Bacteria 1176
221 Ga0207674_10270760 3300026116 Bacteria 1646
222 Ga0207674_10681290 3300026116 Bacteria 993
223 Ga0207698_10312558 3300026142 Bacteria 1468
224 Ga0268266_10000121 3300028379 Bacteria 154995
225 Ga0307515_10053245 3300028794 Bacteria 5977
226 Ga0307515_10094045 3300028794 Bacteria 3708
227 Ga0265338_10035459 3300028800 Bacteria 4795
228 Ga0316181_1168520 3300030744 Bacteria 680
229 Ga0265327_10228490 3300031251 Bacteria 834
230 Ga0307513_10391768 3300031456 Bacteria 1126
231 Ga0307509_10033604 3300031507 Bacteria 5645
232 Ga0307408_100000464 3300031548 Bacteria 35518
233 Ga0307408_100000560 3300031548 Bacteria 32128
234 Ga0307408_100001326 3300031548 Bacteria 18558
235 Ga0307516_10655181 3300031730 Bacteria 705
236 Ga0307412_10000001 3300031911 Bacteria 822691
237 Ga0307412_10009485 3300031911 Bacteria 5587
238 Ga0307412_10123323 3300031911 Bacteria 1869
239 Ga0307412_10388812 3300031911 Bacteria 1132
240 Ga0307412_10466297 3300031911 Bacteria 1044
241 Ga0307412_10656949 3300031911 Bacteria 895
242 Ga0307414_10000414 3300032004 Bacteria 23018
243 Ga0307414_10000470 3300032004 Bacteria 21107
244 Ga0307414_10061480 3300032004 Bacteria 2661
245 Ga0307414_10072892 3300032004 Bacteria 2482
246 Ga0307414_10123405 3300032004 Bacteria 1996
247 Ga0307414_10281040 3300032004 Bacteria 1398
248 Ga0307414_10603731 3300032004 Bacteria 984
249 Ga0307414_11109077 3300032004 Bacteria 731
250 Ga0307411_10151904 3300032005 Bacteria 1722
251 Ga0307507_10000099 3300033179 Bacteria 139532
252 Ga0373941_0002354 3300035115 Bacteria 4148
253 Ga0395899_0000024 3300037312 Bacteria 357402
254 Ga0451807_1335862 3300041486 Bacteria 1195
255 Ga0439448_0004189 3300042005 Bacteria 4061
256 Ga0439457_005817 3300042014 Bacteria 3061
257 Ga0466969_0047122 3300044656 Bacteria 2135
258 Ga0466966_0038815 3300044684 Bacteria 3066
259 Ga0466959_0051030 3300045049 Bacteria 3036
260 Ga0466958_0004812 3300045836 Bacteria 7184
261 Ga0495606_0024196 3300046507 Bacteria 4383
262 Ga0495609_0021448 3300046538 Bacteria 2980
263 Ga0495687_000570 3300047443 Bacteria 43484
264 Ga0495686_0005442 3300047472 Bacteria 10043
265 Ga0496115_0152277 3300048918 Bacteria 1910
266 Ga0496116_0003271 3300048919 Bacteria 16146
267 Ga0496117_0006620 3300048920 Bacteria 11642
268 Ga0496118_0092131 3300048921 Bacteria 2081
269 Ga0496122_0007262 3300048925 Bacteria 12391
270 Ga0496123_0051104 3300048926 Bacteria 2756
271 Ga0496124_0048362 3300048927 Bacteria 3635
272 Ga0496125_0031801 3300048928 Bacteria 4697
273 Ga0496126_0274625 3300048929 Bacteria 1398
274 Ga0501033_0014934 3300049570 Bacteria 5895
275 Ga0501223_000488 3300049663 Bacteria 9591
276 Ga0501238_024583 3300049671 Bacteria 861
277 Ga0501240_000297 3300049673 Bacteria 3873
278 Ga0501241_003953 3300049758 Bacteria 2788
279 Ga0501269_029905 3300049766 Bacteria 697
280 nmdc:mga0k408_57488_c1 3300050493 Bacteria 2258
281 nmdc:mga07m45_625635_c1 3300050496 Unclassified 621
282 Ga0500635_0004790 3300053080 Bacteria 3505
283 Ga0500635_0010107 3300053080 Bacteria 2640
284 Ga0500651_0000058 3300053093 Bacteria 72493
285 Ga0500618_000016 3300053125 Bacteria 164049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053125 Ga0500618_000016 Ga0500618_000016_17191_17640 132
2 3300001904 JGI24736J21556_1012150 JGI24736J21556_10121502 134
3 3300001990 JGI24737J22298_10026500 JGI24737J22298_100265003 134
4 3300002077 JGI24744J21845_10008990 JGI24744J21845_100089903 134
5 3300005328 Ga0070676_10000113 Ga0070676_1000011329 134
6 3300005334 Ga0068869_100545778 Ga0068869_1005457781 134
7 3300005339 Ga0070660_100141445 Ga0070660_1001414453 134
8 3300005364 Ga0070673_100031160 Ga0070673_1000311603 134
9 3300005366 Ga0070659_100694112 Ga0070659_1006941122 134
10 3300005456 Ga0070678_100023305 Ga0070678_1000233055 134
11 3300005457 Ga0070662_100000090 Ga0070662_10000009034 134
12 3300005539 Ga0068853_100149099 Ga0068853_1001490991 134
13 3300005563 Ga0068855_100656552 Ga0068855_1006565522 134
14 3300005616 Ga0068852_100026093 Ga0068852_1000260934 134
15 3300005616 Ga0068852_101801203 Ga0068852_1018012031 134
16 3300006237 Ga0097621_100000015 Ga0097621_10000001579 134
17 3300006358 Ga0068871_100000051 Ga0068871_10000005162 134
18 3300006881 Ga0068865_100002736 Ga0068865_1000027365 134
19 3300009093 Ga0105240_10053010 Ga0105240_100530103 134
20 3300009098 Ga0105245_11556718 Ga0105245_115567181 134
21 3300009148 Ga0105243_10177008 Ga0105243_101770083 134
22 3300009174 Ga0105241_10000804 Ga0105241_1000080412 134
23 3300009174 Ga0105241_10005937 Ga0105241_100059375 134
24 3300009176 Ga0105242_10228729 Ga0105242_102287293 134
25 3300009545 Ga0105237_10001895 Ga0105237_1000189520 134
26 3300009551 Ga0105238_10059144 Ga0105238_100591443 134
27 3300010375 Ga0105239_10332368 Ga0105239_103323683 134
28 3300013100 Ga0157373_10163784 Ga0157373_101637843 134
29 3300013102 Ga0157371_10040376 Ga0157371_100403763 134
30 3300013105 Ga0157369_10063526 Ga0157369_100635263 134
31 3300013105 Ga0157369_11864979 Ga0157369_118649791 134
32 3300013296 Ga0157374_10000301 Ga0157374_1000030120 134
33 3300013296 Ga0157374_10001665 Ga0157374_1000166513 134
34 3300013297 Ga0157378_10026892 Ga0157378_100268925 134
35 3300013308 Ga0157375_10096455 Ga0157375_100964553 134
36 3300015262 Ga0182007_10024067 Ga0182007_100240673 134
37 3300025904 Ga0207647_10000018 Ga0207647_1000001890 134
38 3300025911 Ga0207654_10001026 Ga0207654_100010268 134
39 3300025932 Ga0207690_10128199 Ga0207690_101281993 134
40 3300025933 Ga0207706_10005255 Ga0207706_100052555 134
41 3300025949 Ga0207667_10961564 Ga0207667_109615642 134
42 3300026023 Ga0207677_10466088 Ga0207677_104660882 134
43 3300026035 Ga0207703_10166877 Ga0207703_101668773 134
44 3300005366 Ga0070659_100436553 Ga0070659_1004365531 135
45 3300005548 Ga0070665_100000118 Ga0070665_100000118114 135
46 3300005563 Ga0068855_100049148 Ga0068855_1000491483 135
47 3300005563 Ga0068855_101074306 Ga0068855_1010743061 135
48 3300005840 Ga0068870_10118427 Ga0068870_101184272 135
49 3300009093 Ga0105240_10017563 Ga0105240_100175635 135
50 3300013306 Ga0163162_10000012 Ga0163162_10000012124 135
51 3300013307 Ga0157372_10167808 Ga0157372_101678082 135
52 3300013308 Ga0157375_10023596 Ga0157375_100235964 135
53 3300021361 Ga0213872_10030026 Ga0213872_100300262 135
54 3300025908 Ga0207643_10026760 Ga0207643_100267603 135
55 3300025913 Ga0207695_10014909 Ga0207695_100149093 135
56 3300025931 Ga0207644_10012843 Ga0207644_100128435 135
57 3300025932 Ga0207690_10790795 Ga0207690_107907951 135
58 3300025933 Ga0207706_10650587 Ga0207706_106505871 135
59 3300025949 Ga0207667_10817225 Ga0207667_108172252 135
60 3300028379 Ga0268266_10000121 Ga0268266_1000012142 135
61 3300042005 Ga0439448_0004189 Ga0439448_0004189_2792_3289 135
62 3300047443 Ga0495687_000570 Ga0495687_000570_23709_24206 135
63 3300013296 Ga0157374_11420384 Ga0157374_114203841 137
64 3300005327 Ga0070658_10533866 Ga0070658_105338662 139
65 3300003316 rootH1_10153955 rootH1_101539552 145
66 iso_pu_bacteria 2599185184 2599481418 145
67 iso_pu_bacteria 2721755487 2722731090 145
68 iso_pu_bacteria 2842903701 2842904792 145
69 iso_pu_bacteria 2852623160 2852627062 145
70 iso_pu_bacteria 2884933994 2884935204 145
71 iso_pu_bacteria 2890737413 2890738864 145
72 iso_pu_bacteria 2895498888 2895501755 145
73 iso_pu_bacteria 2896317667 2896320621 145
74 iso_pu_bacteria 2896344016 2896345422 145
75 iso_pu_bacteria 2898713307 2898714490 145
76 iso_pu_bacteria 2904780799 2904783380 145
77 iso_pu_bacteria 2919177583 2919181246 145
78 iso_pu_bacteria 2919437846 2919443061 145
79 iso_pu_bacteria 2928078545 2928083287 145
80 iso_pu_bacteria 2928147474 2928152749 145
81 iso_pu_bacteria 2932082852 2932088289 145
82 iso_pu_bacteria 2977232053 2977234009 145
83 iso_pu_bacteria 3003233435 3003235840 145
84 iso_pu_bacteria 8055588893 8055592075 145
85 3300005563 Ga0068855_100054484 Ga0068855_1000544844 147
86 3300005616 Ga0068852_100521449 Ga0068852_1005214491 147
87 3300006237 Ga0097621_101013528 Ga0097621_1010135282 147
88 3300010375 Ga0105239_10020179 Ga0105239_100201793 147
89 3300017792 Ga0163161_10123753 Ga0163161_101237533 147
90 3300025913 Ga0207695_10233484 Ga0207695_102334843 147
91 3300025914 Ga0207671_10022607 Ga0207671_100226072 147
92 3300025949 Ga0207667_10060601 Ga0207667_100606012 147
93 iso_pu_bacteria 2585427687 2586206979 147
94 iso_pu_bacteria 2738541283 2738756041 147
95 iso_pu_bacteria 2738541284 2738763335 147
96 iso_pu_bacteria 2738541302 2738854596 147
97 iso_pu_bacteria 2738543023 2739304133 147
98 iso_pu_bacteria 2739367651 2739587107 147
99 iso_pu_bacteria 2739367656 2739615205 147
100 iso_pu_bacteria 2739367663 2739645669 147
101 iso_pu_bacteria 2775506987 2776616060 147
102 iso_pu_bacteria 2818991437 2819547572 147
103 iso_pu_bacteria 2842722452 2842726586 147
104 iso_pu_bacteria 2842909656 2842911430 147
105 iso_pu_bacteria 2849281842 2849284224 147
106 iso_pu_bacteria 2852627209 2852630695 147
107 iso_pu_bacteria 2857627736 2857627829 147
108 iso_pu_bacteria 2902048731 2902050043 147
109 iso_pu_bacteria 2904445276 2904449009 147
110 iso_pu_bacteria 2919186247 2919190652 147
111 iso_pu_bacteria 2939664404 2939669138 147
112 iso_pu_bacteria 2945997725 2946003113 147
113 iso_pu_bacteria 2954016120 2954019971 147
114 3300006173 Ga0070716_100834686 Ga0070716_1008346862 148
115 3300006195 Ga0075366_10000135 Ga0075366_1000013522 148
116 3300006353 Ga0075370_10159665 Ga0075370_101596652 148
117 3300013297 Ga0157378_10023968 Ga0157378_100239683 148
118 3300013308 Ga0157375_10003657 Ga0157375_100036571 148
119 3300014497 Ga0182008_10009526 Ga0182008_100095267 148
120 3300014497 Ga0182008_10041174 Ga0182008_100411744 148
121 3300015262 Ga0182007_10012257 Ga0182007_100122575 148
122 3300015262 Ga0182007_10068917 Ga0182007_100689172 148
123 3300028794 Ga0307515_10053245 Ga0307515_100532455 148
124 3300028794 Ga0307515_10094045 Ga0307515_100940453 148
125 3300031456 Ga0307513_10391768 Ga0307513_103917683 148
126 3300033179 Ga0307507_10000099 Ga0307507_1000009967 148
127 3300048918 Ga0496115_0152277 Ga0496115_0152277_619_1125 148
128 3300049671 Ga0501238_024583 Ga0501238_024583_279_776 148
129 3300001979 JGI24740J21852_10019901 JGI24740J21852_100199012 149
130 3300001990 JGI24737J22298_10004213 JGI24737J22298_100042133 149
131 3300001990 JGI24737J22298_10015866 JGI24737J22298_100158664 149
132 3300002067 JGI24735J21928_10057279 JGI24735J21928_100572792 149
133 3300002067 JGI24735J21928_10067252 JGI24735J21928_100672522 149
134 3300002737 JGI25162J39368_1000562 JGI25162J39368_100056223 149
135 3300002741 JGI25157J39369_1004898 JGI25157J39369_10048983 149
136 3300002772 JGI25164J39214_1002386 JGI25164J39214_10023863 149
137 3300003214 JGI25165J46597_1002545 JGI25165J46597_10025453 149
138 3300003320 rootH2_10009361 rootH2_100093613 149
139 3300003320 rootH2_10079099 rootH2_100790992 149
140 3300003320 rootH2_10089619 rootH2_100896191 149
141 3300003320 rootH2_10103344 rootH2_101033442 149
142 3300003323 rootH1_10012646 rootH1_1001264653 149
143 3300003323 rootH1_10012676 rootH1_100126764 149
144 3300003323 rootH1_10295909 rootH1_102959093 149
145 3300004799 Ga0058863_10008894 Ga0058863_1000889410 149
146 3300004800 Ga0058861_12051963 Ga0058861_120519631 149
147 3300005262 Ga0065165_1001313 Ga0065165_10013138 149
148 3300005288 Ga0065714_10065068 Ga0065714_100650684 149
149 3300005289 Ga0065704_10012261 Ga0065704_100122613 149
150 3300005329 Ga0070683_100196990 Ga0070683_1001969902 149
151 3300005356 Ga0070674_100146792 Ga0070674_1001467922 149
152 3300005366 Ga0070659_100010145 Ga0070659_1000101455 149
153 3300005455 Ga0070663_100022627 Ga0070663_1000226273 149
154 3300005530 Ga0070679_100013906 Ga0070679_1000139065 149
155 3300005535 Ga0070684_100288197 Ga0070684_1002881973 149
156 3300005539 Ga0068853_100262187 Ga0068853_1002621872 149
157 3300005563 Ga0068855_100000049 Ga0068855_100000049129 149
158 3300005563 Ga0068855_100000155 Ga0068855_10000015573 149
159 3300005563 Ga0068855_100019434 Ga0068855_1000194345 149
160 3300005563 Ga0068855_100233481 Ga0068855_1002334811 149
161 3300005577 Ga0068857_100801186 Ga0068857_1008011862 149
162 3300005614 Ga0068856_100003614 Ga0068856_10000361415 149
163 3300005614 Ga0068856_100016616 Ga0068856_1000166165 149
164 3300005614 Ga0068856_100063782 Ga0068856_1000637824 149
165 3300005614 Ga0068856_100224769 Ga0068856_1002247693 149
166 3300005616 Ga0068852_100374176 Ga0068852_1003741763 149
167 3300005842 Ga0068858_100124274 Ga0068858_1001242742 149
168 3300006195 Ga0075366_10060441 Ga0075366_100604413 149
169 3300006237 Ga0097621_101133266 Ga0097621_1011332661 149
170 3300009093 Ga0105240_10002021 Ga0105240_100020219 149
171 3300009093 Ga0105240_10060549 Ga0105240_100605493 149
172 3300009093 Ga0105240_10119438 Ga0105240_101194383 149
173 3300009093 Ga0105240_10757120 Ga0105240_107571202 149
174 3300009098 Ga0105245_10637391 Ga0105245_106373912 149
175 3300009148 Ga0105243_10000003 Ga0105243_1000000362 149
176 3300009174 Ga0105241_10037284 Ga0105241_100372843 149
177 3300009174 Ga0105241_10503708 Ga0105241_105037082 149
178 3300009174 Ga0105241_10928967 Ga0105241_109289672 149
179 3300009176 Ga0105242_11529690 Ga0105242_115296902 149
180 3300009545 Ga0105237_10002529 Ga0105237_100025292 149
181 3300009545 Ga0105237_10004676 Ga0105237_1000467617 149
182 3300009545 Ga0105237_10378642 Ga0105237_103786422 149
183 3300009551 Ga0105238_10153650 Ga0105238_101536503 149
184 3300010375 Ga0105239_10000049 Ga0105239_10000049146 149
185 3300010375 Ga0105239_10000166 Ga0105239_1000016642 149
186 3300010375 Ga0105239_10003703 Ga0105239_1000370316 149
187 3300010375 Ga0105239_10064383 Ga0105239_100643833 149
188 3300013100 Ga0157373_10026642 Ga0157373_100266424 149
189 3300013100 Ga0157373_10035803 Ga0157373_100358031 149
190 3300013102 Ga0157371_10000107 Ga0157371_1000010730 149
191 3300013102 Ga0157371_10011057 Ga0157371_100110578 149
192 3300013104 Ga0157370_10031919 Ga0157370_100319192 149
193 3300013104 Ga0157370_10320023 Ga0157370_103200232 149
194 3300013105 Ga0157369_10003605 Ga0157369_1000360511 149
195 3300013105 Ga0157369_10062384 Ga0157369_100623843 149
196 3300013296 Ga0157374_10003138 Ga0157374_100031383 149
197 3300013296 Ga0157374_10240993 Ga0157374_102409932 149
198 3300013296 Ga0157374_10305191 Ga0157374_103051912 149
199 3300013306 Ga0163162_10039941 Ga0163162_100399416 149
200 3300013307 Ga0157372_10000039 Ga0157372_1000003937 149
201 3300013307 Ga0157372_10000238 Ga0157372_1000023818 149
202 3300013307 Ga0157372_10041830 Ga0157372_100418303 149
203 3300014497 Ga0182008_10319515 Ga0182008_103195152 149
204 3300025230 Ga0209563_105500 Ga0209563_1055003 149
205 3300025231 Ga0207427_100122 Ga0207427_10012235 149
206 3300025233 Ga0209437_100048 Ga0209437_100048261 149
207 3300025250 Ga0209026_1001423 Ga0209026_10014237 149
208 3300025250 Ga0209026_1002188 Ga0209026_10021882 149
209 3300025250 Ga0209026_1005112 Ga0209026_10051122 149
210 3300025250 Ga0209026_1017784 Ga0209026_10177841 149
211 3300025250 Ga0209026_1026798 Ga0209026_10267982 149
212 3300025261 Ga0209233_1000029 Ga0209233_1000029115 149
213 3300025261 Ga0209233_1001271 Ga0209233_10012715 149
214 3300025272 Ga0209455_1003330 Ga0209455_10033305 149
215 3300025904 Ga0207647_10000071 Ga0207647_1000007153 149
216 3300025904 Ga0207647_10163731 Ga0207647_101637312 149
217 3300025909 Ga0207705_10000026 Ga0207705_10000026201 149
218 3300025909 Ga0207705_10130697 Ga0207705_101306972 149
219 3300025909 Ga0207705_10150944 Ga0207705_101509443 149
220 3300025911 Ga0207654_10059333 Ga0207654_100593333 149
221 3300025913 Ga0207695_10046838 Ga0207695_100468383 149
222 3300025913 Ga0207695_10214854 Ga0207695_102148543 149
223 3300025913 Ga0207695_11418905 Ga0207695_114189051 149
224 3300025913 Ga0207695_11456428 Ga0207695_114564281 149
225 3300025914 Ga0207671_10001959 Ga0207671_1000195926 149
226 3300025914 Ga0207671_10007623 Ga0207671_100076235 149
227 3300025914 Ga0207671_10057163 Ga0207671_100571634 149
228 3300025914 Ga0207671_10278264 Ga0207671_102782642 149
229 3300025921 Ga0207652_10012241 Ga0207652_100122415 149
230 3300025932 Ga0207690_10001688 Ga0207690_1000168815 149
231 3300025935 Ga0207709_10000008 Ga0207709_10000008512 149
232 3300025944 Ga0207661_10135111 Ga0207661_101351112 149
233 3300025949 Ga0207667_10000015 Ga0207667_10000015379 149
234 3300025949 Ga0207667_10012483 Ga0207667_100124834 149
235 3300025949 Ga0207667_10169104 Ga0207667_101691041 149
236 3300026035 Ga0207703_10082239 Ga0207703_100822392 149
237 3300026041 Ga0207639_10100873 Ga0207639_101008733 149
238 3300026041 Ga0207639_10131419 Ga0207639_101314193 149
239 3300026078 Ga0207702_10000163 Ga0207702_100001633 149
240 3300026078 Ga0207702_10048496 Ga0207702_100484964 149
241 3300026078 Ga0207702_10049475 Ga0207702_100494752 149
242 3300026078 Ga0207702_10507643 Ga0207702_105076432 149
243 3300026116 Ga0207674_10270760 Ga0207674_102707603 149
244 3300026116 Ga0207674_10681290 Ga0207674_106812902 149
245 3300026142 Ga0207698_10312558 Ga0207698_103125583 149
246 3300028800 Ga0265338_10035459 Ga0265338_100354593 149
247 3300030744 Ga0316181_1168520 Ga0316181_11685202 149
248 3300031251 Ga0265327_10228490 Ga0265327_102284902 149
249 3300031507 Ga0307509_10033604 Ga0307509_100336047 149
250 3300031548 Ga0307408_100000464 Ga0307408_10000046411 149
251 3300031548 Ga0307408_100000560 Ga0307408_1000005603 149
252 3300031548 Ga0307408_100001326 Ga0307408_10000132615 149
253 3300031911 Ga0307412_10009485 Ga0307412_100094855 149
254 3300031911 Ga0307412_10123323 Ga0307412_101233232 149
255 3300032004 Ga0307414_10061480 Ga0307414_100614803 149
256 3300032004 Ga0307414_10123405 Ga0307414_101234052 149
257 3300035115 Ga0373941_0002354 Ga0373941_0002354_1801_2301 149
258 3300037312 Ga0395899_0000024 Ga0395899_0000024_326931_327443 149
259 3300041486 Ga0451807_1335862 Ga0451807_1335862_564_1064 149
260 3300042014 Ga0439457_005817 Ga0439457_005817_377_874 149
261 3300044656 Ga0466969_0047122 Ga0466969_0047122_1386_1898 149
262 3300044684 Ga0466966_0038815 Ga0466966_0038815_1194_1706 149
263 3300045049 Ga0466959_0051030 Ga0466959_0051030_948_1460 149
264 3300045836 Ga0466958_0004812 Ga0466958_0004812_980_1492 149
265 3300046507 Ga0495606_0024196 Ga0495606_0024196_866_1366 149
266 3300047472 Ga0495686_0005442 Ga0495686_0005442_6676_7173 149
267 3300048919 Ga0496116_0003271 Ga0496116_0003271_14244_14741 149
268 3300048920 Ga0496117_0006620 Ga0496117_0006620_2043_2540 149
269 3300048921 Ga0496118_0092131 Ga0496118_0092131_366_863 149
270 3300048925 Ga0496122_0007262 Ga0496122_0007262_533_1030 149
271 3300048926 Ga0496123_0051104 Ga0496123_0051104_519_1016 149
272 3300048927 Ga0496124_0048362 Ga0496124_0048362_2429_2926 149
273 3300048928 Ga0496125_0031801 Ga0496125_0031801_2705_3202 149
274 3300048929 Ga0496126_0274625 Ga0496126_0274625_651_1148 149
275 3300049663 Ga0501223_000488 Ga0501223_000488_3886_4383 149
276 3300049673 Ga0501240_000297 Ga0501240_000297_2138_2656 149
277 3300050493 nmdc:mga0k408_57488_c1 nmdc:mga0k408_57488_c1_1471_1968 149
278 3300050496 nmdc:mga07m45_625635_c1 nmdc:mga07m45_625635_c1_28_531 149
279 3300053080 Ga0500635_0004790 Ga0500635_0004790_322_822 149
280 3300053080 Ga0500635_0010107 Ga0500635_0010107_694_1191 149
281 3300031730 Ga0307516_10655181 Ga0307516_106551812 150
282 3300031911 Ga0307412_10388812 Ga0307412_103888122 150
283 3300032004 Ga0307414_10072892 Ga0307414_100728923 150
284 3300032004 Ga0307414_10281040 Ga0307414_102810402 150
285 3300049570 Ga0501033_0014934 Ga0501033_0014934_1870_2409 150
286 3300049766 Ga0501269_029905 Ga0501269_029905_133_636 150
287 2162886007 SwRhRL2b_contig_3565021 SwRhRL2b_0943.00000930 151
288 3300003323 rootH1_10109882 rootH1_101098823 151
289 3300005288 Ga0065714_10003510 Ga0065714_100035103 151
290 3300005288 Ga0065714_10066813 Ga0065714_100668135 151
291 3300005288 Ga0065714_10079909 Ga0065714_100799092 151
292 3300005289 Ga0065704_10000273 Ga0065704_1000027335 151
293 3300005289 Ga0065704_10088420 Ga0065704_100884203 151
294 3300005289 Ga0065704_10197852 Ga0065704_101978522 151
295 3300005289 Ga0065704_10246691 Ga0065704_102466912 151
296 3300013100 Ga0157373_10000086 Ga0157373_1000008626 151
297 3300013100 Ga0157373_10009487 Ga0157373_100094874 151
298 3300013100 Ga0157373_10025296 Ga0157373_100252963 151
299 3300013100 Ga0157373_10134293 Ga0157373_101342933 151
300 3300013102 Ga0157371_10001199 Ga0157371_1000119927 151
301 3300013102 Ga0157371_10001277 Ga0157371_100012775 151
302 3300013102 Ga0157371_10001603 Ga0157371_1000160326 151
303 3300013104 Ga0157370_10010241 Ga0157370_100102419 151
304 3300013104 Ga0157370_10039745 Ga0157370_100397454 151
305 3300013104 Ga0157370_10040787 Ga0157370_100407874 151
306 3300013104 Ga0157370_10292215 Ga0157370_102922152 151
307 3300013104 Ga0157370_10303579 Ga0157370_103035792 151
308 3300013105 Ga0157369_10030384 Ga0157369_100303843 151
309 3300013105 Ga0157369_11458735 Ga0157369_114587352 151
310 3300014497 Ga0182008_10000020 Ga0182008_10000020108 151
311 3300015261 Ga0182006_1002254 Ga0182006_10022542 151
312 3300015261 Ga0182006_1032459 Ga0182006_10324592 151
313 3300017792 Ga0163161_10014389 Ga0163161_100143894 151
314 3300017792 Ga0163161_10402261 Ga0163161_104022613 151
315 3300031911 Ga0307412_10000001 Ga0307412_10000001292 151
316 3300031911 Ga0307412_10466297 Ga0307412_104662972 151
317 3300031911 Ga0307412_10656949 Ga0307412_106569492 151
318 3300032004 Ga0307414_10000414 Ga0307414_1000041420 151
319 3300032004 Ga0307414_10000470 Ga0307414_1000047012 151
320 3300032004 Ga0307414_10603731 Ga0307414_106037312 151
321 3300032004 Ga0307414_11109077 Ga0307414_111090771 151
322 3300032005 Ga0307411_10151904 Ga0307411_101519042 151
323 3300046538 Ga0495609_0021448 Ga0495609_0021448_1731_2228 151
324 3300049758 Ga0501241_003953 Ga0501241_003953_2010_2507 151
325 3300053093 Ga0500651_0000058 Ga0500651_0000058_38993_39490 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

30

173

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cfw-assembly1.cif.gz_D cryoem structure of a respiratory membrane-bound hydrogenase 0.8374 1 68
6u8y-assembly1.cif.gz_d structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex 0.7882 7 71
6cfw-assembly1.cif.gz_D cryoem structure of a respiratory membrane-bound hydrogenase 0.7261 1 68
6u8y-assembly1.cif.gz_d structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex 0.5871 7 71
7v2f-assembly1.cif.gz_m deactive state complex i from q10-nadh dataset 0.5766 1 100
ID Description Score Start End Superfamily
af_Q57879_1_79_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.925 5 60 1.10.287.3510
af_Q57879_1_79_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6621 5 60 1.10.287.3510
af_O16926_232_363_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.5046 10 108 1.20.58.390
af_P48180_235_346_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.4324 11 126 1.20.58.390
af_P0AFE0_1_159_1.20.120.1200 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);NADH-ubiquinone/plastoquinone oxidoreductase chain 6, subunit NuoJ 0.4209 6 143 1.20.120.1200
ID Description Score Start End GO Terms
AF-A0A521GQQ1-F1-model_v4 YgjV family protein 0.518 2 141 GO:0016020
AF-A0A0J7XKY9-F1-model_v4 YgjV family protein 0.4972 1 149 GO:0016020
AF-S1NYS0-F1-model_v4 Inner membrane protein ygjV 0.4887 2 146 GO:0016020
AF-A0A0J7XKY9-F1-model_v4 YgjV family protein 0.4886 1 149 GO:0016020
AF-A0A521GQQ1-F1-model_v4 YgjV family protein 0.4817 2 141 GO:0016020

Feature Viewer

pLDDT pTM Quality
68.35 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map