F407695

General Info

Members Datasets Scaffolds Average Seq Length
325 210 324 120

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100135116|Ga0070714_1001351162
Length 127
Sequence VKYLLLIYSEEQVWTQEKREHCYAESTQLAHDLNAQGKFLSANPLHPVSTATSVRVRNGKRVVTDGPFAETREQLGGYFLVDATDLDEAIAIASRIPAARVGTVEVRPVIEIPGLPASEPALAARAD

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
140 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
141 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
142 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
207 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.62
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0.31
Rhizoplane 5.54
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_5246994 2162886011 Bacteria 2068
2 Ga0065712_10073926 3300005290 Bacteria 4240
3 Ga0065707_10003560 3300005295 Bacteria 7947
4 Ga0065707_10006580 3300005295 Bacteria 2588
5 Ga0070676_11254062 3300005328 Bacteria 565
6 Ga0070683_100023799 3300005329 Bacteria 5481
7 Ga0070690_100127843 3300005330 Bacteria 1713
8 Ga0070670_100110136 3300005331 Bacteria 2373
9 Ga0070670_100558674 3300005331 Bacteria 1021
10 Ga0070677_10445135 3300005333 Bacteria 692
11 Ga0070666_10000497 3300005335 Bacteria 23673
12 Ga0070680_100504067 3300005336 Bacteria 1036
13 Ga0068868_101110778 3300005338 Bacteria 728
14 Ga0070660_100467962 3300005339 Bacteria 1047
15 Ga0070689_100019969 3300005340 Bacteria 4964
16 Ga0070689_101098535 3300005340 Bacteria 711
17 Ga0070687_100058683 3300005343 Bacteria 2023
18 Ga0070687_101115054 3300005343 Bacteria 578
19 Ga0070668_101426423 3300005347 Bacteria 632
20 Ga0070668_101532453 3300005347 Bacteria 610
21 Ga0070671_101400505 3300005355 Bacteria 618
22 Ga0070671_101659164 3300005355 Bacteria 567
23 Ga0070674_100183861 3300005356 Bacteria 1603
24 Ga0070674_101175832 3300005356 Bacteria 680
25 Ga0070673_100012595 3300005364 Bacteria 5812
26 Ga0070673_100038665 3300005364 Bacteria 3645
27 Ga0070688_100062590 3300005365 Bacteria 2356
28 Ga0070659_100165452 3300005366 Bacteria 1810
29 Ga0070667_100002449 3300005367 Bacteria 16210
30 Ga0070667_100327301 3300005367 Bacteria 1384
31 Ga0070667_100819775 3300005367 Bacteria 864
32 Ga0070714_100135116 3300005435 Bacteria 2208
33 Ga0070714_102396854 3300005435 Bacteria 513
34 Ga0070713_100117309 3300005436 Bacteria 2329
35 Ga0070705_100006629 3300005440 Bacteria 5688
36 Ga0070700_100391755 3300005441 Bacteria 1042
37 Ga0070694_101605805 3300005444 Bacteria 552
38 Ga0070678_100913995 3300005456 Bacteria 803
39 Ga0068867_100133213 3300005459 Bacteria 1934
40 Ga0068867_101119170 3300005459 Bacteria 720
41 Ga0070707_100475400 3300005468 Bacteria 1211
42 Ga0070707_100756618 3300005468 Bacteria 935
43 Ga0070699_100233851 3300005518 Bacteria 1639
44 Ga0070699_101358049 3300005518 Bacteria 652
45 Ga0070684_100009616 3300005535 Bacteria 7621
46 Ga0070684_100351444 3300005535 Bacteria 1356
47 Ga0070697_100048365 3300005536 Bacteria 3448
48 Ga0068853_101443325 3300005539 Bacteria 666
49 Ga0070672_100011039 3300005543 Bacteria 6287
50 Ga0070686_100161173 3300005544 Bacteria 1580
51 Ga0070696_100669754 3300005546 Bacteria 843
52 Ga0070665_100020949 3300005548 Bacteria 6570
53 Ga0070704_100180839 3300005549 Bacteria 1686
54 Ga0068855_100306126 3300005563 Bacteria 1759
55 Ga0070664_100090582 3300005564 Bacteria 2647
56 Ga0068857_100334697 3300005577 Bacteria 1400
57 Ga0068857_100762910 3300005577 Bacteria 922
58 Ga0068856_100020691 3300005614 Bacteria 6391
59 Ga0070702_100005477 3300005615 Bacteria 5920
60 Ga0068852_101165161 3300005616 Bacteria 791
61 Ga0068859_100000713 3300005617 Bacteria 33507
62 Ga0068859_100690184 3300005617 Bacteria 1112
63 Ga0068859_101257532 3300005617 Bacteria 815
64 Ga0068864_100062368 3300005618 Bacteria 3230
65 Ga0068864_100079897 3300005618 Bacteria 2865
66 Ga0068864_100603676 3300005618 Bacteria 1065
67 Ga0068866_10264104 3300005718 Bacteria 1059
68 Ga0068861_101662458 3300005719 Bacteria 631
69 Ga0068863_100272839 3300005841 Bacteria 1637
70 Ga0068863_100894661 3300005841 Bacteria 888
71 Ga0068858_100009921 3300005842 Bacteria 9046
72 Ga0068858_100148123 3300005842 Bacteria 2206
73 Ga0068860_100000203 3300005843 Bacteria 94032
74 Ga0068862_100393347 3300005844 Bacteria 1295
75 Ga0068862_101472752 3300005844 Bacteria 686
76 Ga0068862_101858150 3300005844 Bacteria 612
77 Ga0070717_10666948 3300006028 Bacteria 944
78 Ga0070716_100262731 3300006173 Archaea 1182
79 Ga0075427_10022052 3300006194 Bacteria 1015
80 Ga0097621_100484851 3300006237 Bacteria 1118
81 Ga0068871_100112273 3300006358 Bacteria 2293
82 Ga0075428_100100856 3300006844 Bacteria 3147
83 Ga0075428_101011037 3300006844 Bacteria 880
84 Ga0075430_100039526 3300006846 Bacteria 3994
85 Ga0075430_100050218 3300006846 Bacteria 3519
86 Ga0075430_100065660 3300006846 Bacteria 3048
87 Ga0075430_100396801 3300006846 Bacteria 1139
88 Ga0075431_100122035 3300006847 Bacteria 2688
89 Ga0075431_101102019 3300006847 Bacteria 758
90 Ga0075431_101362340 3300006847 Bacteria 670
91 Ga0075431_101819206 3300006847 Bacteria 565
92 Ga0075433_10825354 3300006852 Bacteria 810
93 Ga0075429_100008267 3300006880 Bacteria 9046
94 Ga0075429_100156356 3300006880 Bacteria 1996
95 Ga0075429_100173845 3300006880 Bacteria 1887
96 Ga0075429_100270313 3300006880 Bacteria 1489
97 Ga0068865_100090609 3300006881 Bacteria 2217
98 Ga0075436_100251470 3300006914 Bacteria 1259
99 Ga0097620_100000713 3300006931 Bacteria 33507
100 Ga0097620_100690167 3300006931 Bacteria 1112
101 Ga0097620_101257505 3300006931 Bacteria 815
102 Ga0075435_100336634 3300007076 Bacteria 1293
103 Ga0111539_10000302 3300009094 Bacteria 59849
104 Ga0111539_10001828 3300009094 Bacteria 28325
105 Ga0111539_10050747 3300009094 Bacteria 4942
106 Ga0105247_10110512 3300009101 Bacteria 1769
107 Ga0105247_10163559 3300009101 Bacteria 1475
108 Ga0105247_11045240 3300009101 Bacteria 641
109 Ga0114129_10020321 3300009147 Bacteria 9447
110 Ga0114129_10066507 3300009147 Bacteria 5028
111 Ga0114129_10432129 3300009147 Bacteria 1730
112 Ga0114129_12055545 3300009147 Bacteria 690
113 Ga0105243_11383610 3300009148 Bacteria 724
114 Ga0105241_10341363 3300009174 Bacteria 1298
115 Ga0105242_12223069 3300009176 Bacteria 594
116 Ga0105242_12480733 3300009176 Bacteria 567
117 Ga0105248_10003714 3300009177 Bacteria 16929
118 Ga0105248_10158693 3300009177 Bacteria 2552
119 Ga0105248_10438633 3300009177 Bacteria 1471
120 Ga0105248_11523596 3300009177 Bacteria 757
121 Ga0105237_11560845 3300009545 Bacteria 667
122 Ga0105238_10303345 3300009551 Bacteria 1581
123 Ga0105249_10043099 3300009553 Bacteria 4105
124 Ga0105249_11926206 3300009553 Bacteria 664
125 Ga0105249_12336183 3300009553 Unclassified 607
126 Ga0105239_11968591 3300010375 Unclassified 678
127 Ga0105246_10011404 3300011119 Bacteria 5516
128 Ga0163162_11205851 3300013306 Bacteria 859
129 Ga0163162_13283905 3300013306 Bacteria 518
130 Ga0157372_10235362 3300013307 Unclassified 2124
131 Ga0157372_13484668 3300013307 Bacteria 500
132 Ga0157375_10022868 3300013308 Bacteria 5760
133 Ga0157375_11330422 3300013308 Bacteria 845
134 Ga0163163_10072531 3300014325 Bacteria 3433
135 Ga0163163_10984546 3300014325 Bacteria 907
136 Ga0157380_12591463 3300014326 Bacteria 573
137 Ga0157379_10009408 3300014968 Bacteria 8515
138 Ga0157379_11337452 3300014968 Bacteria 693
139 Ga0157376_10006284 3300014969 Bacteria 8382
140 Ga0207682_10301847 3300025893 Bacteria 751
141 Ga0207642_10005024 3300025899 Bacteria 4294
142 Ga0207710_10087818 3300025900 Bacteria 1451
143 Ga0207680_10000175 3300025903 Bacteria 31103
144 Ga0207680_10996478 3300025903 Bacteria 600
145 Ga0207645_10609801 3300025907 Bacteria 741
146 Ga0207684_10046665 3300025910 Bacteria 3675
147 Ga0207684_10264644 3300025910 Bacteria 1484
148 Ga0207671_10240420 3300025914 Unclassified 1422
149 Ga0207662_10117158 3300025918 Bacteria 1667
150 Ga0207662_10785527 3300025918 Bacteria 671
151 Ga0207662_10883473 3300025918 Bacteria 632
152 Ga0207681_10242459 3300025923 Bacteria 1404
153 Ga0207681_10667847 3300025923 Bacteria 862
154 Ga0207681_11074802 3300025923 Unclassified 676
155 Ga0207650_10223395 3300025925 Bacteria 1516
156 Ga0207650_10902022 3300025925 Bacteria 750
157 Ga0207650_11555436 3300025925 Bacteria 562
158 Ga0207659_10020489 3300025926 Bacteria 4372
159 Ga0207659_10657699 3300025926 Bacteria 896
160 Ga0207690_10707222 3300025932 Bacteria 829
161 Ga0207706_10586415 3300025933 Bacteria 958
162 Ga0207686_10509070 3300025934 Bacteria 935
163 Ga0207670_10012703 3300025936 Bacteria 4936
164 Ga0207670_10306493 3300025936 Bacteria 1245
165 Ga0207704_10009458 3300025938 Bacteria 4703
166 Ga0207704_11363154 3300025938 Bacteria 607
167 Ga0207665_10110098 3300025939 Bacteria 1934
168 Ga0207691_10005166 3300025940 Bacteria 12603
169 Ga0207691_11163873 3300025940 Bacteria 640
170 Ga0207711_10000362 3300025941 Bacteria 48201
171 Ga0207711_10377804 3300025941 Bacteria 1315
172 Ga0207711_10478393 3300025941 Bacteria 1160
173 Ga0207689_10030965 3300025942 Bacteria 4457
174 Ga0207661_10012044 3300025944 Bacteria 6283
175 Ga0207661_10825592 3300025944 Bacteria 853
176 Ga0207679_10033419 3300025945 Bacteria 3619
177 Ga0207679_12062212 3300025945 Bacteria 519
178 Ga0207651_10152687 3300025960 Bacteria 1800
179 Ga0207651_10554944 3300025960 Bacteria 999
180 Ga0207668_11162435 3300025972 Bacteria 693
181 Ga0207658_10002775 3300025986 Bacteria 12618
182 Ga0207658_10956369 3300025986 Bacteria 781
183 Ga0207677_10317192 3300026023 Bacteria 1294
184 Ga0207703_10019353 3300026035 Bacteria 5319
185 Ga0207703_10205658 3300026035 Bacteria 1752
186 Ga0207703_10683481 3300026035 Bacteria 975
187 Ga0207639_10016890 3300026041 Bacteria 5171
188 Ga0207678_10054546 3300026067 Bacteria 3443
189 Ga0207702_10009626 3300026078 Bacteria 8111
190 Ga0207641_10070568 3300026088 Bacteria 3002
191 Ga0207648_10004273 3300026089 Bacteria 14730
192 Ga0207648_10284078 3300026089 Bacteria 1480
193 Ga0207648_10640932 3300026089 Bacteria 981
194 Ga0207676_10008850 3300026095 Bacteria 7164
195 Ga0207676_10123301 3300026095 Bacteria 2189
196 Ga0207676_10309456 3300026095 Bacteria 1446
197 Ga0207676_10382048 3300026095 Bacteria 1311
198 Ga0207674_10717226 3300026116 Bacteria 965
199 Ga0207675_100774087 3300026118 Bacteria 972
200 Ga0207675_101056386 3300026118 Bacteria 831
201 Ga0207683_10259999 3300026121 Bacteria 1585
202 Ga0209971_1053193 3300027682 Bacteria 979
203 Ga0207428_10000013 3300027907 Bacteria 346742
204 Ga0207428_10001618 3300027907 Bacteria 23381
205 Ga0207428_10060684 3300027907 Bacteria 2996
206 Ga0268266_10212042 3300028379 Bacteria 1776
207 Ga0268265_10371958 3300028380 Bacteria 1312
208 Ga0268265_11523028 3300028380 Bacteria 673
209 Ga0268264_10002845 3300028381 Bacteria 15091
210 Ga0268264_10397371 3300028381 Bacteria 1324
211 Ga0268264_11333968 3300028381 Bacteria 728
212 Ga0265318_10021401 3300028577 Bacteria 2596
213 Ga0265318_10088574 3300028577 Bacteria 1140
214 Ga0265770_1012352 3300030878 Bacteria 1264
215 Ga0265760_10002959 3300031090 Bacteria 4969
216 Ga0265330_10205496 3300031235 Bacteria 832
217 Ga0265320_10039776 3300031240 Bacteria 2349
218 Ga0265325_10031182 3300031241 Bacteria 2855
219 Ga0265316_10950382 3300031344 Bacteria 599
220 Ga0265314_10001851 3300031711 Bacteria 22676
221 Ga0307405_10295466 3300031731 Bacteria 1226
222 Ga0307410_11062791 3300031852 Bacteria 700
223 Ga0307409_101881654 3300031995 Bacteria 628
224 Ga0307416_100253467 3300032002 Bacteria 1715
225 Ga0307416_100611957 3300032002 Bacteria 1170
226 Ga0373930_0043987 3300034816 Bacteria 959
227 Ga0373950_0098419 3300034818 Bacteria 628
228 Ga0373958_0010576 3300034819 Bacteria 1543
229 Ga0373938_0079032 3300034957 Bacteria 798
230 Ga0373929_0181619 3300035085 Bacteria 580
231 Ga0373940_0009228 3300035088 Bacteria 2288
232 Ga0373932_0064344 3300035112 Bacteria 1122
233 Ga0373932_0141667 3300035112 Bacteria 818
234 Ga0373936_0017646 3300035113 Bacteria 2750
235 Ga0373960_0066611 3300035121 Bacteria 1104
236 Ga0373942_0026333 3300035207 Bacteria 1505
237 Ga0373962_0003263 3300035242 Bacteria 3904
238 Ga0373931_0008091 3300035691 Bacteria 4979
239 Ga0373937_1599141 3300036401 Bacteria 599
240 Ga0436365_0556663 3300039437 Unclassified 1146
241 Ga0439439_0045390 3300041406 Bacteria 1146
242 Ga0439456_058224 3300042013 Bacteria 848
243 Ga0439435_0003629 3300042436 Bacteria 3234
244 Ga0439460_0067739 3300042461 Bacteria 1100
245 Ga0451577_0139435 3300042876 Bacteria 2178
246 Ga0439440_0143689 3300042993 Bacteria 679
247 Ga0453683_0669459 3300044673 Bacteria 679
248 Ga0453684_0370675 3300044712 Bacteria 1610
249 Ga0453684_0424768 3300044712 Bacteria 1484
250 Ga0451576_0090693 3300045051 Bacteria 3179
251 Ga0495603_0091180 3300046455 Bacteria 1782
252 Ga0495639_0526260 3300046475 Bacteria 605
253 Ga0495630_0904301 3300046517 Bacteria 672
254 Ga0495645_0006813 3300046543 Bacteria 7939
255 Ga0495656_0115829 3300046615 Bacteria 1259
256 Ga0495588_0424333 3300046674 Bacteria 698
257 Ga0495599_0130735 3300046678 Bacteria 1559
258 Ga0495669_0151929 3300046684 Bacteria 1096
259 Ga0496101_0142552 3300048904 Bacteria 1827
260 Ga0496102_0031940 3300048905 Bacteria 4727
261 Ga0496103_0027035 3300048906 Bacteria 3474
262 Ga0496104_0020466 3300048907 Bacteria 6065
263 Ga0496104_0120569 3300048907 Bacteria 2518
264 Ga0496106_0007342 3300048909 Bacteria 8146
265 Ga0496107_0002966 3300048910 Bacteria 11236
266 Ga0496108_0000432 3300048911 Bacteria 33880
267 Ga0496109_0000770 3300048912 Bacteria 26636
268 Ga0496109_0035761 3300048912 Bacteria 4483
269 Ga0496110_0005270 3300048913 Bacteria 10120
270 Ga0496111_0027885 3300048914 Bacteria 3999
271 Ga0496111_0112845 3300048914 Bacteria 2002
272 Ga0496112_0000221 3300048915 Bacteria 36971
273 Ga0496112_0053928 3300048915 Bacteria 3950
274 Ga0496112_0435789 3300048915 Bacteria 1249
275 Ga0496113_0000493 3300048916 Bacteria 19400
276 Ga0496113_1046373 3300048916 Bacteria 642
277 Ga0501033_1178071 3300049570 Bacteria 508
278 Ga0501036_1044326 3300049572 Bacteria 668
279 Ga0501039_0366313 3300049575 Bacteria 1132
280 Ga0501040_0025226 3300049576 Bacteria 3997
281 Ga0501041_0017747 3300049577 Bacteria 4236
282 Ga0501042_0026441 3300049578 Bacteria 4078
283 Ga0501046_0134400 3300049580 Bacteria 1874
284 Ga0501068_0086505 3300049584 Bacteria 1930
285 Ga0501071_0291875 3300049587 Bacteria 1235
286 Ga0501075_0025651 3300049591 Bacteria 4330
287 Ga0501075_0438610 3300049591 Bacteria 996
288 Ga0501076_0029797 3300049592 Bacteria 4246
289 Ga0501077_0228859 3300049593 Bacteria 1182
290 Ga0501077_1132175 3300049593 Bacteria 504
291 Ga0501079_0718307 3300049741 Bacteria 786
292 Ga0501081_0124635 3300049743 Bacteria 1837
293 Ga0501083_0380187 3300049744 Bacteria 918
294 Ga0501035_0141236 3300049822 Bacteria 2094
295 nmdc:mga05p37_1151683_c1 3300050507 Bacteria 807
296 nmdc:mga05p37_245112_c1 3300050507 Bacteria 2152
297 nmdc:mga05p37_637268_c1 3300050507 Bacteria 1196
298 nmdc:mga05p37_9516_c1 3300050507 Bacteria 11506
299 nmdc:mga09592_1257193_c1 3300050508 Bacteria 610
300 nmdc:mga09592_24668_c1 3300050508 Bacteria 4974
301 nmdc:mga09592_9650_c1 3300050508 Bacteria 7842
302 nmdc:mga0qj67_100432_c1 3300050509 Bacteria 2333
303 nmdc:mga0qj67_1364450_c1 3300050509 Bacteria 548
304 nmdc:mga0qj67_295052_c1 3300050509 Bacteria 1314
305 nmdc:mga0qj67_32205_c1 3300050509 Bacteria 4087
306 nmdc:mga0qj67_382836_c1 3300050509 Bacteria 1136
307 nmdc:mga06r32_1047067_c1 3300050510 Bacteria 767
308 nmdc:mga06r32_166195_c1 3300050510 Bacteria 2190
309 nmdc:mga06r32_32239_c1 3300050510 Bacteria 4928
310 nmdc:mga06r32_72069_c1 3300050510 Bacteria 3345
311 nmdc:mga08y16_135_c1 3300050511 Bacteria 64253
312 nmdc:mga08y16_14898_c1 3300050511 Bacteria 8179
313 nmdc:mga08y16_55878_c1 3300050511 Bacteria 4125
314 nmdc:mga0a205_1144660_c1 3300050515 Bacteria 626
315 nmdc:mga0a205_202323_c1 3300050515 Bacteria 1876
316 nmdc:mga0a205_594137_c1 3300050515 Bacteria 960
317 Ga0495601_0018893 3300053077 Bacteria 4199
318 Ga0495612_0045798 3300053078 Bacteria 1791
319 Ga0500583_0164109 3300053092 Bacteria 1106
320 Ga0500637_0002603 3300053178 Bacteria 8073
321 Ga0501084_0172174 3300054114 Bacteria 1827
322 Ga0501084_0339894 3300054114 Bacteria 1268
323 Ga0530510_0491344 3300061734 Bacteria 930
324 Ga0530510_1290098 3300061734 Bacteria 560

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061734 Ga0530510_1290098 Ga0530510_1290098_232_549 105
2 3300044673 Ga0453683_0669459 Ga0453683_0669459_39_389 111
3 3300006237 Ga0097621_100484851 Ga0097621_1004848512 112
4 3300013306 Ga0163162_13283905 Ga0163162_132839052 112
5 3300031731 Ga0307405_10295466 Ga0307405_102954662 112
6 3300005295 Ga0065707_10003560 Ga0065707_100035603 113
7 3300005330 Ga0070690_100127843 Ga0070690_1001278431 113
8 3300005331 Ga0070670_100110136 Ga0070670_1001101362 113
9 3300005333 Ga0070677_10445135 Ga0070677_104451351 113
10 3300005336 Ga0070680_100504067 Ga0070680_1005040672 113
11 3300005340 Ga0070689_101098535 Ga0070689_1010985352 113
12 3300005343 Ga0070687_100058683 Ga0070687_1000586832 113
13 3300005347 Ga0070668_101426423 Ga0070668_1014264231 113
14 3300005355 Ga0070671_101400505 Ga0070671_1014005051 113
15 3300005364 Ga0070673_100038665 Ga0070673_1000386654 113
16 3300005365 Ga0070688_100062590 Ga0070688_1000625903 113
17 3300005367 Ga0070667_100819775 Ga0070667_1008197752 113
18 3300005456 Ga0070678_100913995 Ga0070678_1009139952 113
19 3300005468 Ga0070707_100756618 Ga0070707_1007566181 113
20 3300005535 Ga0070684_100351444 Ga0070684_1003514442 113
21 3300005544 Ga0070686_100161173 Ga0070686_1001611731 113
22 3300005546 Ga0070696_100669754 Ga0070696_1006697541 113
23 3300005577 Ga0068857_100334697 Ga0068857_1003346974 113
24 3300005577 Ga0068857_100762910 Ga0068857_1007629102 113
25 3300005618 Ga0068864_100603676 Ga0068864_1006036762 113
26 3300005844 Ga0068862_101472752 Ga0068862_1014727522 113
27 3300006844 Ga0075428_100100856 Ga0075428_1001008563 113
28 3300006844 Ga0075428_101011037 Ga0075428_1010110371 113
29 3300006846 Ga0075430_100039526 Ga0075430_1000395263 113
30 3300006846 Ga0075430_100050218 Ga0075430_1000502182 113
31 3300006846 Ga0075430_100396801 Ga0075430_1003968011 113
32 3300006847 Ga0075431_100122035 Ga0075431_1001220352 113
33 3300006847 Ga0075431_101102019 Ga0075431_1011020192 113
34 3300006847 Ga0075431_101362340 Ga0075431_1013623402 113
35 3300006880 Ga0075429_100008267 Ga0075429_1000082675 113
36 3300006880 Ga0075429_100173845 Ga0075429_1001738452 113
37 3300006880 Ga0075429_100270313 Ga0075429_1002703132 113
38 3300006914 Ga0075436_100251470 Ga0075436_1002514702 113
39 3300009094 Ga0111539_10000302 Ga0111539_1000030243 113
40 3300009094 Ga0111539_10050747 Ga0111539_100507475 113
41 3300009101 Ga0105247_10163559 Ga0105247_101635591 113
42 3300009147 Ga0114129_10020321 Ga0114129_100203216 113
43 3300009148 Ga0105243_11383610 Ga0105243_113836102 113
44 3300009174 Ga0105241_10341363 Ga0105241_103413633 113
45 3300009176 Ga0105242_12480733 Ga0105242_124807331 113
46 3300009177 Ga0105248_10003714 Ga0105248_1000371415 113
47 3300009551 Ga0105238_10303345 Ga0105238_103033452 113
48 3300013308 Ga0157375_10022868 Ga0157375_100228688 113
49 3300014325 Ga0163163_10072531 Ga0163163_100725313 113
50 3300014968 Ga0157379_10009408 Ga0157379_1000940810 113
51 3300014969 Ga0157376_10006284 Ga0157376_1000628411 113
52 3300025893 Ga0207682_10301847 Ga0207682_103018471 113
53 3300025918 Ga0207662_10117158 Ga0207662_101171582 113
54 3300025918 Ga0207662_10883473 Ga0207662_108834731 113
55 3300025923 Ga0207681_10667847 Ga0207681_106678472 113
56 3300025925 Ga0207650_10902022 Ga0207650_109020222 113
57 3300025926 Ga0207659_10020489 Ga0207659_100204893 113
58 3300025926 Ga0207659_10657699 Ga0207659_106576991 113
59 3300025933 Ga0207706_10586415 Ga0207706_105864152 113
60 3300025960 Ga0207651_10554944 Ga0207651_105549442 113
61 3300025972 Ga0207668_11162435 Ga0207668_111624351 113
62 3300026088 Ga0207641_10070568 Ga0207641_100705682 113
63 3300026089 Ga0207648_10640932 Ga0207648_106409322 113
64 3300026095 Ga0207676_10309456 Ga0207676_103094562 113
65 3300026116 Ga0207674_10717226 Ga0207674_107172262 113
66 3300026121 Ga0207683_10259999 Ga0207683_102599992 113
67 3300027682 Ga0209971_1053193 Ga0209971_10531932 113
68 3300027907 Ga0207428_10001618 Ga0207428_1000161811 113
69 3300027907 Ga0207428_10060684 Ga0207428_100606843 113
70 3300028381 Ga0268264_10397371 Ga0268264_103973712 113
71 3300032002 Ga0307416_100253467 Ga0307416_1002534672 113
72 3300041406 Ga0439439_0045390 Ga0439439_0045390_313_663 113
73 3300042013 Ga0439456_058224 Ga0439456_058224_368_718 113
74 3300042436 Ga0439435_0003629 Ga0439435_0003629_2195_2545 113
75 3300042993 Ga0439440_0143689 Ga0439440_0143689_212_562 113
76 3300046615 Ga0495656_0115829 Ga0495656_0115829_580_930 113
77 3300046684 Ga0495669_0151929 Ga0495669_0151929_529_879 113
78 3300048904 Ga0496101_0142552 Ga0496101_0142552_34_414 113
79 3300048905 Ga0496102_0031940 Ga0496102_0031940_4247_4627 113
80 3300048906 Ga0496103_0027035 Ga0496103_0027035_1184_1564 113
81 3300048907 Ga0496104_0120569 Ga0496104_0120569_2128_2508 113
82 3300048909 Ga0496106_0007342 Ga0496106_0007342_6780_7160 113
83 3300048910 Ga0496107_0002966 Ga0496107_0002966_9811_10191 113
84 3300048912 Ga0496109_0035761 Ga0496109_0035761_1128_1508 113
85 3300048914 Ga0496111_0027885 Ga0496111_0027885_2413_2793 113
86 3300048915 Ga0496112_0435789 Ga0496112_0435789_215_595 113
87 3300049570 Ga0501033_1178071 Ga0501033_1178071_101_451 113
88 3300049575 Ga0501039_0366313 Ga0501039_0366313_570_920 113
89 3300049576 Ga0501040_0025226 Ga0501040_0025226_1805_2155 113
90 3300049577 Ga0501041_0017747 Ga0501041_0017747_518_868 113
91 3300049578 Ga0501042_0026441 Ga0501042_0026441_209_559 113
92 3300049580 Ga0501046_0134400 Ga0501046_0134400_208_558 113
93 3300049584 Ga0501068_0086505 Ga0501068_0086505_355_705 113
94 3300049587 Ga0501071_0291875 Ga0501071_0291875_616_966 113
95 3300049591 Ga0501075_0025651 Ga0501075_0025651_1057_1407 113
96 3300049591 Ga0501075_0438610 Ga0501075_0438610_490_840 113
97 3300049592 Ga0501076_0029797 Ga0501076_0029797_1632_1982 113
98 3300049593 Ga0501077_0228859 Ga0501077_0228859_365_715 113
99 3300049741 Ga0501079_0718307 Ga0501079_0718307_224_646 113
100 3300049743 Ga0501081_0124635 Ga0501081_0124635_486_836 113
101 3300049822 Ga0501035_0141236 Ga0501035_0141236_754_1104 113
102 3300050507 nmdc:mga05p37_245112_c1 nmdc:mga05p37_245112_c1_1417_1767 113
103 3300050508 nmdc:mga09592_1257193_c1 nmdc:mga09592_1257193_c1_144_494 113
104 3300050508 nmdc:mga09592_24668_c1 nmdc:mga09592_24668_c1_975_1325 113
105 3300050508 nmdc:mga09592_9650_c1 nmdc:mga09592_9650_c1_7149_7499 113
106 3300050509 nmdc:mga0qj67_1364450_c1 nmdc:mga0qj67_1364450_c1_71_421 113
107 3300050509 nmdc:mga0qj67_295052_c1 nmdc:mga0qj67_295052_c1_201_551 113
108 3300050509 nmdc:mga0qj67_32205_c1 nmdc:mga0qj67_32205_c1_1757_2107 113
109 3300050509 nmdc:mga0qj67_382836_c1 nmdc:mga0qj67_382836_c1_382_732 113
110 3300050510 nmdc:mga06r32_1047067_c1 nmdc:mga06r32_1047067_c1_245_595 113
111 3300050510 nmdc:mga06r32_32239_c1 nmdc:mga06r32_32239_c1_3567_3917 113
112 3300050510 nmdc:mga06r32_72069_c1 nmdc:mga06r32_72069_c1_2078_2428 113
113 3300050511 nmdc:mga08y16_135_c1 nmdc:mga08y16_135_c1_12925_13275 113
114 3300050511 nmdc:mga08y16_55878_c1 nmdc:mga08y16_55878_c1_3549_3899 113
115 3300054114 Ga0501084_0172174 Ga0501084_0172174_278_628 113
116 3300061734 Ga0530510_0491344 Ga0530510_0491344_218_568 113
117 iso_pu_bacteria 8016539877 8016541648 113
118 3300005329 Ga0070683_100023799 Ga0070683_1000237995 114
119 3300005331 Ga0070670_100558674 Ga0070670_1005586742 114
120 3300005366 Ga0070659_100165452 Ga0070659_1001654522 114
121 3300005535 Ga0070684_100009616 Ga0070684_1000096163 114
122 3300005539 Ga0068853_101443325 Ga0068853_1014433251 114
123 3300005617 Ga0068859_101257532 Ga0068859_1012575323 114
124 3300006931 Ga0097620_101257505 Ga0097620_1012575053 114
125 3300009553 Ga0105249_11926206 Ga0105249_119262061 114
126 3300009553 Ga0105249_12336183 Ga0105249_123361832 114
127 3300013306 Ga0163162_11205851 Ga0163162_112058511 114
128 3300025910 Ga0207684_10264644 Ga0207684_102646442 114
129 3300025923 Ga0207681_10242459 Ga0207681_102424592 114
130 3300025932 Ga0207690_10707222 Ga0207690_107072221 114
131 3300025944 Ga0207661_10012044 Ga0207661_100120443 114
132 3300026118 Ga0207675_100774087 Ga0207675_1007740873 114
133 3300031995 Ga0307409_101881654 Ga0307409_1018816542 114
134 3300042461 Ga0439460_0067739 Ga0439460_0067739_233_586 114
135 3300005347 Ga0070668_101532453 Ga0070668_1015324531 115
136 3300005356 Ga0070674_101175832 Ga0070674_1011758322 115
137 3300005444 Ga0070694_101605805 Ga0070694_1016058051 115
138 3300005459 Ga0068867_101119170 Ga0068867_1011191701 115
139 3300005617 Ga0068859_100690184 Ga0068859_1006901843 115
140 3300005719 Ga0068861_101662458 Ga0068861_1016624581 115
141 3300005844 Ga0068862_101858150 Ga0068862_1018581501 115
142 3300006194 Ga0075427_10022052 Ga0075427_100220522 115
143 3300006846 Ga0075430_100065660 Ga0075430_1000656605 115
144 3300006880 Ga0075429_100156356 Ga0075429_1001563564 115
145 3300006931 Ga0097620_100690167 Ga0097620_1006901673 115
146 3300009094 Ga0111539_10001828 Ga0111539_1000182826 115
147 3300009101 Ga0105247_10110512 Ga0105247_101105122 115
148 3300009147 Ga0114129_10066507 Ga0114129_100665075 115
149 3300009176 Ga0105242_12223069 Ga0105242_122230691 115
150 3300009177 Ga0105248_10438633 Ga0105248_104386332 115
151 3300014326 Ga0157380_12591463 Ga0157380_125914631 115
152 3300025900 Ga0207710_10087818 Ga0207710_100878182 115
153 3300025903 Ga0207680_10996478 Ga0207680_109964781 115
154 3300025936 Ga0207670_10306493 Ga0207670_103064931 115
155 3300025938 Ga0207704_11363154 Ga0207704_113631541 115
156 3300025940 Ga0207691_11163873 Ga0207691_111638731 115
157 3300025941 Ga0207711_10478393 Ga0207711_104783931 115
158 3300025945 Ga0207679_12062212 Ga0207679_120622121 115
159 3300026035 Ga0207703_10205658 Ga0207703_102056582 115
160 3300026089 Ga0207648_10284078 Ga0207648_102840781 115
161 3300027907 Ga0207428_10000013 Ga0207428_10000013273 115
162 3300028380 Ga0268265_11523028 Ga0268265_115230281 115
163 3300028577 Ga0265318_10088574 Ga0265318_100885741 115
164 3300031240 Ga0265320_10039776 Ga0265320_100397762 115
165 3300034819 Ga0373958_0010576 Ga0373958_0010576_676_1044 115
166 3300034957 Ga0373938_0079032 Ga0373938_0079032_44_412 115
167 3300035085 Ga0373929_0181619 Ga0373929_0181619_89_457 115
168 3300035088 Ga0373940_0009228 Ga0373940_0009228_871_1239 115
169 3300035112 Ga0373932_0064344 Ga0373932_0064344_332_700 115
170 3300035121 Ga0373960_0066611 Ga0373960_0066611_218_586 115
171 3300035207 Ga0373942_0026333 Ga0373942_0026333_778_1146 115
172 3300035242 Ga0373962_0003263 Ga0373962_0003263_1386_1754 115
173 3300035691 Ga0373931_0008091 Ga0373931_0008091_1111_1479 115
174 3300050507 nmdc:mga05p37_1151683_c1 nmdc:mga05p37_1151683_c1_246_614 115
175 3300050509 nmdc:mga0qj67_100432_c1 nmdc:mga0qj67_100432_c1_744_1112 115
176 3300050510 nmdc:mga06r32_166195_c1 nmdc:mga06r32_166195_c1_1467_1835 115
177 3300050511 nmdc:mga08y16_14898_c1 nmdc:mga08y16_14898_c1_4146_4514 115
178 3300050515 nmdc:mga0a205_202323_c1 nmdc:mga0a205_202323_c1_680_1048 115
179 3300005295 Ga0065707_10006580 Ga0065707_100065802 116
180 3300005328 Ga0070676_11254062 Ga0070676_112540621 116
181 3300005335 Ga0070666_10000497 Ga0070666_100004977 116
182 3300005338 Ga0068868_101110778 Ga0068868_1011107782 116
183 3300005340 Ga0070689_100019969 Ga0070689_1000199692 116
184 3300005343 Ga0070687_101115054 Ga0070687_1011150541 116
185 3300005355 Ga0070671_101659164 Ga0070671_1016591641 116
186 3300005356 Ga0070674_100183861 Ga0070674_1001838612 116
187 3300005364 Ga0070673_100012595 Ga0070673_1000125958 116
188 3300005367 Ga0070667_100002449 Ga0070667_10000244915 116
189 3300005435 Ga0070714_102396854 Ga0070714_1023968541 116
190 3300005440 Ga0070705_100006629 Ga0070705_1000066297 116
191 3300005459 Ga0068867_100133213 Ga0068867_1001332132 116
192 3300005518 Ga0070699_100233851 Ga0070699_1002338511 116
193 3300005543 Ga0070672_100011039 Ga0070672_1000110396 116
194 3300005548 Ga0070665_100020949 Ga0070665_1000209498 116
195 3300005549 Ga0070704_100180839 Ga0070704_1001808392 116
196 3300005564 Ga0070664_100090582 Ga0070664_1000905822 116
197 3300005614 Ga0068856_100020691 Ga0068856_1000206918 116
198 3300005615 Ga0070702_100005477 Ga0070702_1000054772 116
199 3300005617 Ga0068859_100000713 Ga0068859_10000071311 116
200 3300005618 Ga0068864_100062368 Ga0068864_1000623686 116
201 3300005618 Ga0068864_100079897 Ga0068864_1000798973 116
202 3300005718 Ga0068866_10264104 Ga0068866_102641042 116
203 3300005841 Ga0068863_100272839 Ga0068863_1002728395 116
204 3300005841 Ga0068863_100894661 Ga0068863_1008946611 116
205 3300005842 Ga0068858_100009921 Ga0068858_1000099212 116
206 3300005842 Ga0068858_100148123 Ga0068858_1001481232 116
207 3300005843 Ga0068860_100000203 Ga0068860_1000002037 116
208 3300006358 Ga0068871_100112273 Ga0068871_1001122731 116
209 3300006847 Ga0075431_101819206 Ga0075431_1018192061 116
210 3300006852 Ga0075433_10825354 Ga0075433_108253542 116
211 3300006881 Ga0068865_100090609 Ga0068865_1000906092 116
212 3300006931 Ga0097620_100000713 Ga0097620_10000071311 116
213 3300007076 Ga0075435_100336634 Ga0075435_1003366342 116
214 3300009147 Ga0114129_10432129 Ga0114129_104321292 116
215 3300009147 Ga0114129_12055545 Ga0114129_120555452 116
216 3300009177 Ga0105248_11523596 Ga0105248_115235962 116
217 3300010375 Ga0105239_11968591 Ga0105239_119685911 116
218 3300011119 Ga0105246_10011404 Ga0105246_100114044 116
219 3300013307 Ga0157372_10235362 Ga0157372_102353622 116
220 3300013308 Ga0157375_11330422 Ga0157375_113304221 116
221 3300014325 Ga0163163_10984546 Ga0163163_109845462 116
222 3300014968 Ga0157379_11337452 Ga0157379_113374521 116
223 3300025899 Ga0207642_10005024 Ga0207642_100050243 116
224 3300025903 Ga0207680_10000175 Ga0207680_100001756 116
225 3300025907 Ga0207645_10609801 Ga0207645_106098011 116
226 3300025914 Ga0207671_10240420 Ga0207671_102404202 116
227 3300025918 Ga0207662_10785527 Ga0207662_107855271 116
228 3300025925 Ga0207650_10223395 Ga0207650_102233952 116
229 3300025925 Ga0207650_11555436 Ga0207650_115554362 116
230 3300025934 Ga0207686_10509070 Ga0207686_105090702 116
231 3300025936 Ga0207670_10012703 Ga0207670_100127036 116
232 3300025938 Ga0207704_10009458 Ga0207704_100094585 116
233 3300025940 Ga0207691_10005166 Ga0207691_100051668 116
234 3300025941 Ga0207711_10000362 Ga0207711_1000036219 116
235 3300025942 Ga0207689_10030965 Ga0207689_100309654 116
236 3300025944 Ga0207661_10825592 Ga0207661_108255922 116
237 3300025945 Ga0207679_10033419 Ga0207679_100334195 116
238 3300025960 Ga0207651_10152687 Ga0207651_101526873 116
239 3300025986 Ga0207658_10002775 Ga0207658_1000277512 116
240 3300025986 Ga0207658_10956369 Ga0207658_109563692 116
241 3300026023 Ga0207677_10317192 Ga0207677_103171922 116
242 3300026035 Ga0207703_10019353 Ga0207703_100193532 116
243 3300026035 Ga0207703_10683481 Ga0207703_106834812 116
244 3300026067 Ga0207678_10054546 Ga0207678_100545463 116
245 3300026078 Ga0207702_10009626 Ga0207702_1000962610 116
246 3300026089 Ga0207648_10004273 Ga0207648_1000427316 116
247 3300026095 Ga0207676_10008850 Ga0207676_100088501 116
248 3300026095 Ga0207676_10123301 Ga0207676_101233012 116
249 3300026095 Ga0207676_10382048 Ga0207676_103820482 116
250 3300028379 Ga0268266_10212042 Ga0268266_102120423 116
251 3300028381 Ga0268264_10002845 Ga0268264_100028456 116
252 3300028381 Ga0268264_11333968 Ga0268264_113339682 116
253 3300032002 Ga0307416_100611957 Ga0307416_1006119572 116
254 3300034816 Ga0373930_0043987 Ga0373930_0043987_555_914 116
255 3300034818 Ga0373950_0098419 Ga0373950_0098419_19_378 116
256 3300035112 Ga0373932_0141667 Ga0373932_0141667_62_421 116
257 3300035113 Ga0373936_0017646 Ga0373936_0017646_1407_1769 116
258 3300039437 Ga0436365_0556663 Ga0436365_0556663_444_842 116
259 3300044712 Ga0453684_0424768 Ga0453684_0424768_79_444 116
260 3300046455 Ga0495603_0091180 Ga0495603_0091180_1316_1690 116
261 3300046475 Ga0495639_0526260 Ga0495639_0526260_120_485 116
262 3300046517 Ga0495630_0904301 Ga0495630_0904301_58_453 116
263 3300046543 Ga0495645_0006813 Ga0495645_0006813_3326_3721 116
264 3300046674 Ga0495588_0424333 Ga0495588_0424333_98_472 116
265 3300046678 Ga0495599_0130735 Ga0495599_0130735_683_1078 116
266 3300048907 Ga0496104_0020466 Ga0496104_0020466_1765_2124 116
267 3300048911 Ga0496108_0000432 Ga0496108_0000432_32974_33333 116
268 3300048912 Ga0496109_0000770 Ga0496109_0000770_15417_15776 116
269 3300048913 Ga0496110_0005270 Ga0496110_0005270_2287_2646 116
270 3300048914 Ga0496111_0112845 Ga0496111_0112845_1622_1981 116
271 3300048915 Ga0496112_0000221 Ga0496112_0000221_11028_11387 116
272 3300048916 Ga0496113_0000493 Ga0496113_0000493_17807_18166 116
273 3300048916 Ga0496113_1046373 Ga0496113_1046373_14_385 116
274 3300049593 Ga0501077_1132175 Ga0501077_1132175_50_436 116
275 3300050507 nmdc:mga05p37_637268_c1 nmdc:mga05p37_637268_c1_701_1060 116
276 3300050507 nmdc:mga05p37_9516_c1 nmdc:mga05p37_9516_c1_98_478 116
277 3300050515 nmdc:mga0a205_1144660_c1 nmdc:mga0a205_1144660_c1_229_609 116
278 3300050515 nmdc:mga0a205_594137_c1 nmdc:mga0a205_594137_c1_538_897 116
279 3300053077 Ga0495601_0018893 Ga0495601_0018893_1131_1526 116
280 3300053078 Ga0495612_0045798 Ga0495612_0045798_194_589 116
281 3300053092 Ga0500583_0164109 Ga0500583_0164109_317_688 116
282 3300053178 Ga0500637_0002603 Ga0500637_0002603_2390_2749 116
283 3300054114 Ga0501084_0339894 Ga0501084_0339894_832_1218 116
284 3300030878 Ga0265770_1012352 Ga0265770_10123522 117
285 3300042876 Ga0451577_0139435 Ga0451577_0139435_1698_2051 117
286 3300044712 Ga0453684_0370675 Ga0453684_0370675_170_523 117
287 3300045051 Ga0451576_0090693 Ga0451576_0090693_373_726 117
288 3300049572 Ga0501036_1044326 Ga0501036_1044326_104_466 117
289 3300005468 Ga0070707_100475400 Ga0070707_1004754002 118
290 3300005518 Ga0070699_101358049 Ga0070699_1013580492 118
291 3300005536 Ga0070697_100048365 Ga0070697_1000483653 118
292 3300005563 Ga0068855_100306126 Ga0068855_1003061261 118
293 3300006173 Ga0070716_100262731 Ga0070716_1002627312 118
294 3300009101 Ga0105247_11045240 Ga0105247_110452401 118
295 3300009545 Ga0105237_11560845 Ga0105237_115608451 118
296 3300013307 Ga0157372_13484668 Ga0157372_134846681 118
297 3300025910 Ga0207684_10046665 Ga0207684_100466656 118
298 3300025939 Ga0207665_10110098 Ga0207665_101100982 118
299 3300031711 Ga0265314_10001851 Ga0265314_1000185119 118
300 3300048915 Ga0496112_0053928 Ga0496112_0053928_1648_2004 118
301 3300049744 Ga0501083_0380187 Ga0501083_0380187_148_504 118
302 2162886011 MRS1b_contig_5246994 MRS1b_0200.00003070 119
303 3300005290 Ga0065712_10073926 Ga0065712_100739265 119
304 3300005339 Ga0070660_100467962 Ga0070660_1004679622 119
305 3300005367 Ga0070667_100327301 Ga0070667_1003273012 119
306 3300005435 Ga0070714_100135116 Ga0070714_1001351162 119
307 3300005436 Ga0070713_100117309 Ga0070713_1001173094 119
308 3300005441 Ga0070700_100391755 Ga0070700_1003917552 119
309 3300005616 Ga0068852_101165161 Ga0068852_1011651612 119
310 3300005844 Ga0068862_100393347 Ga0068862_1003933472 119
311 3300006028 Ga0070717_10666948 Ga0070717_106669482 119
312 3300009177 Ga0105248_10158693 Ga0105248_101586932 119
313 3300009553 Ga0105249_10043099 Ga0105249_100430996 119
314 3300025923 Ga0207681_11074802 Ga0207681_110748021 119
315 3300025941 Ga0207711_10377804 Ga0207711_103778043 119
316 3300026041 Ga0207639_10016890 Ga0207639_100168905 119
317 3300026118 Ga0207675_101056386 Ga0207675_1010563862 119
318 3300028380 Ga0268265_10371958 Ga0268265_103719582 119
319 3300028577 Ga0265318_10021401 Ga0265318_100214013 119
320 3300031090 Ga0265760_10002959 Ga0265760_100029592 119
321 3300031235 Ga0265330_10205496 Ga0265330_102054962 119
322 3300031241 Ga0265325_10031182 Ga0265325_100311824 119
323 3300031344 Ga0265316_10950382 Ga0265316_109503821 119
324 3300031852 Ga0307410_11062791 Ga0307410_110627911 119
325 3300036401 Ga0373937_1599141 Ga0373937_1599141_75_437 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.953 1 111
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8839 1 111
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.7502 1 112
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.7234 1 112
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.7106 1 110
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.953 1 111 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8839 1 111 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7399 1 112 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7374 1 116 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7266 1 112 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A432MIB2-F1-model_v4 YciI family protein 1.002 1 115
AF-A0A2T1D8K4-F1-model_v4 YciI family protein 0.9994 1 116
AF-A0A3A0D6U6-F1-model_v4 YCII-related domain-containing protein 0.9992 1 116
AF-A0A3S1AJQ6-F1-model_v4 YCII-related domain-containing protein 0.9984 1 116
AF-A0A812N0Z2-F1-model_v4 YCII-related domain-containing protein 0.9931 1 112

Feature Viewer

pLDDT pTM Quality
93.1 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map