F407695
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 210 | 324 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100135116|Ga0070714_1001351162 |
| Length | 127 |
| Sequence | VKYLLLIYSEEQVWTQEKREHCYAESTQLAHDLNAQGKFLSANPLHPVSTATSVRVRNGKRVVTDGPFAETREQLGGYFLVDATDLDEAIAIASRIPAARVGTVEVRPVIEIPGLPASEPALAARAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 132 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 133 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 134 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 140 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 141 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 142 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 143 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 144 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 150 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 153 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 154 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 155 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 156 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 157 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 158 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 159 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 160 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 161 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 162 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 173 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 176 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 179 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 180 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 181 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 182 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 207 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 208 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 210 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.08 |
| Metatranscriptomes | 0.62 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.62 |
| Nodule | 0.31 |
| Rhizoplane | 5.54 |
| Rhizosphere | 93.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_5246994 | 2162886011 | Bacteria | 2068 |
| 2 | Ga0065712_10073926 | 3300005290 | Bacteria | 4240 |
| 3 | Ga0065707_10003560 | 3300005295 | Bacteria | 7947 |
| 4 | Ga0065707_10006580 | 3300005295 | Bacteria | 2588 |
| 5 | Ga0070676_11254062 | 3300005328 | Bacteria | 565 |
| 6 | Ga0070683_100023799 | 3300005329 | Bacteria | 5481 |
| 7 | Ga0070690_100127843 | 3300005330 | Bacteria | 1713 |
| 8 | Ga0070670_100110136 | 3300005331 | Bacteria | 2373 |
| 9 | Ga0070670_100558674 | 3300005331 | Bacteria | 1021 |
| 10 | Ga0070677_10445135 | 3300005333 | Bacteria | 692 |
| 11 | Ga0070666_10000497 | 3300005335 | Bacteria | 23673 |
| 12 | Ga0070680_100504067 | 3300005336 | Bacteria | 1036 |
| 13 | Ga0068868_101110778 | 3300005338 | Bacteria | 728 |
| 14 | Ga0070660_100467962 | 3300005339 | Bacteria | 1047 |
| 15 | Ga0070689_100019969 | 3300005340 | Bacteria | 4964 |
| 16 | Ga0070689_101098535 | 3300005340 | Bacteria | 711 |
| 17 | Ga0070687_100058683 | 3300005343 | Bacteria | 2023 |
| 18 | Ga0070687_101115054 | 3300005343 | Bacteria | 578 |
| 19 | Ga0070668_101426423 | 3300005347 | Bacteria | 632 |
| 20 | Ga0070668_101532453 | 3300005347 | Bacteria | 610 |
| 21 | Ga0070671_101400505 | 3300005355 | Bacteria | 618 |
| 22 | Ga0070671_101659164 | 3300005355 | Bacteria | 567 |
| 23 | Ga0070674_100183861 | 3300005356 | Bacteria | 1603 |
| 24 | Ga0070674_101175832 | 3300005356 | Bacteria | 680 |
| 25 | Ga0070673_100012595 | 3300005364 | Bacteria | 5812 |
| 26 | Ga0070673_100038665 | 3300005364 | Bacteria | 3645 |
| 27 | Ga0070688_100062590 | 3300005365 | Bacteria | 2356 |
| 28 | Ga0070659_100165452 | 3300005366 | Bacteria | 1810 |
| 29 | Ga0070667_100002449 | 3300005367 | Bacteria | 16210 |
| 30 | Ga0070667_100327301 | 3300005367 | Bacteria | 1384 |
| 31 | Ga0070667_100819775 | 3300005367 | Bacteria | 864 |
| 32 | Ga0070714_100135116 | 3300005435 | Bacteria | 2208 |
| 33 | Ga0070714_102396854 | 3300005435 | Bacteria | 513 |
| 34 | Ga0070713_100117309 | 3300005436 | Bacteria | 2329 |
| 35 | Ga0070705_100006629 | 3300005440 | Bacteria | 5688 |
| 36 | Ga0070700_100391755 | 3300005441 | Bacteria | 1042 |
| 37 | Ga0070694_101605805 | 3300005444 | Bacteria | 552 |
| 38 | Ga0070678_100913995 | 3300005456 | Bacteria | 803 |
| 39 | Ga0068867_100133213 | 3300005459 | Bacteria | 1934 |
| 40 | Ga0068867_101119170 | 3300005459 | Bacteria | 720 |
| 41 | Ga0070707_100475400 | 3300005468 | Bacteria | 1211 |
| 42 | Ga0070707_100756618 | 3300005468 | Bacteria | 935 |
| 43 | Ga0070699_100233851 | 3300005518 | Bacteria | 1639 |
| 44 | Ga0070699_101358049 | 3300005518 | Bacteria | 652 |
| 45 | Ga0070684_100009616 | 3300005535 | Bacteria | 7621 |
| 46 | Ga0070684_100351444 | 3300005535 | Bacteria | 1356 |
| 47 | Ga0070697_100048365 | 3300005536 | Bacteria | 3448 |
| 48 | Ga0068853_101443325 | 3300005539 | Bacteria | 666 |
| 49 | Ga0070672_100011039 | 3300005543 | Bacteria | 6287 |
| 50 | Ga0070686_100161173 | 3300005544 | Bacteria | 1580 |
| 51 | Ga0070696_100669754 | 3300005546 | Bacteria | 843 |
| 52 | Ga0070665_100020949 | 3300005548 | Bacteria | 6570 |
| 53 | Ga0070704_100180839 | 3300005549 | Bacteria | 1686 |
| 54 | Ga0068855_100306126 | 3300005563 | Bacteria | 1759 |
| 55 | Ga0070664_100090582 | 3300005564 | Bacteria | 2647 |
| 56 | Ga0068857_100334697 | 3300005577 | Bacteria | 1400 |
| 57 | Ga0068857_100762910 | 3300005577 | Bacteria | 922 |
| 58 | Ga0068856_100020691 | 3300005614 | Bacteria | 6391 |
| 59 | Ga0070702_100005477 | 3300005615 | Bacteria | 5920 |
| 60 | Ga0068852_101165161 | 3300005616 | Bacteria | 791 |
| 61 | Ga0068859_100000713 | 3300005617 | Bacteria | 33507 |
| 62 | Ga0068859_100690184 | 3300005617 | Bacteria | 1112 |
| 63 | Ga0068859_101257532 | 3300005617 | Bacteria | 815 |
| 64 | Ga0068864_100062368 | 3300005618 | Bacteria | 3230 |
| 65 | Ga0068864_100079897 | 3300005618 | Bacteria | 2865 |
| 66 | Ga0068864_100603676 | 3300005618 | Bacteria | 1065 |
| 67 | Ga0068866_10264104 | 3300005718 | Bacteria | 1059 |
| 68 | Ga0068861_101662458 | 3300005719 | Bacteria | 631 |
| 69 | Ga0068863_100272839 | 3300005841 | Bacteria | 1637 |
| 70 | Ga0068863_100894661 | 3300005841 | Bacteria | 888 |
| 71 | Ga0068858_100009921 | 3300005842 | Bacteria | 9046 |
| 72 | Ga0068858_100148123 | 3300005842 | Bacteria | 2206 |
| 73 | Ga0068860_100000203 | 3300005843 | Bacteria | 94032 |
| 74 | Ga0068862_100393347 | 3300005844 | Bacteria | 1295 |
| 75 | Ga0068862_101472752 | 3300005844 | Bacteria | 686 |
| 76 | Ga0068862_101858150 | 3300005844 | Bacteria | 612 |
| 77 | Ga0070717_10666948 | 3300006028 | Bacteria | 944 |
| 78 | Ga0070716_100262731 | 3300006173 | Archaea | 1182 |
| 79 | Ga0075427_10022052 | 3300006194 | Bacteria | 1015 |
| 80 | Ga0097621_100484851 | 3300006237 | Bacteria | 1118 |
| 81 | Ga0068871_100112273 | 3300006358 | Bacteria | 2293 |
| 82 | Ga0075428_100100856 | 3300006844 | Bacteria | 3147 |
| 83 | Ga0075428_101011037 | 3300006844 | Bacteria | 880 |
| 84 | Ga0075430_100039526 | 3300006846 | Bacteria | 3994 |
| 85 | Ga0075430_100050218 | 3300006846 | Bacteria | 3519 |
| 86 | Ga0075430_100065660 | 3300006846 | Bacteria | 3048 |
| 87 | Ga0075430_100396801 | 3300006846 | Bacteria | 1139 |
| 88 | Ga0075431_100122035 | 3300006847 | Bacteria | 2688 |
| 89 | Ga0075431_101102019 | 3300006847 | Bacteria | 758 |
| 90 | Ga0075431_101362340 | 3300006847 | Bacteria | 670 |
| 91 | Ga0075431_101819206 | 3300006847 | Bacteria | 565 |
| 92 | Ga0075433_10825354 | 3300006852 | Bacteria | 810 |
| 93 | Ga0075429_100008267 | 3300006880 | Bacteria | 9046 |
| 94 | Ga0075429_100156356 | 3300006880 | Bacteria | 1996 |
| 95 | Ga0075429_100173845 | 3300006880 | Bacteria | 1887 |
| 96 | Ga0075429_100270313 | 3300006880 | Bacteria | 1489 |
| 97 | Ga0068865_100090609 | 3300006881 | Bacteria | 2217 |
| 98 | Ga0075436_100251470 | 3300006914 | Bacteria | 1259 |
| 99 | Ga0097620_100000713 | 3300006931 | Bacteria | 33507 |
| 100 | Ga0097620_100690167 | 3300006931 | Bacteria | 1112 |
| 101 | Ga0097620_101257505 | 3300006931 | Bacteria | 815 |
| 102 | Ga0075435_100336634 | 3300007076 | Bacteria | 1293 |
| 103 | Ga0111539_10000302 | 3300009094 | Bacteria | 59849 |
| 104 | Ga0111539_10001828 | 3300009094 | Bacteria | 28325 |
| 105 | Ga0111539_10050747 | 3300009094 | Bacteria | 4942 |
| 106 | Ga0105247_10110512 | 3300009101 | Bacteria | 1769 |
| 107 | Ga0105247_10163559 | 3300009101 | Bacteria | 1475 |
| 108 | Ga0105247_11045240 | 3300009101 | Bacteria | 641 |
| 109 | Ga0114129_10020321 | 3300009147 | Bacteria | 9447 |
| 110 | Ga0114129_10066507 | 3300009147 | Bacteria | 5028 |
| 111 | Ga0114129_10432129 | 3300009147 | Bacteria | 1730 |
| 112 | Ga0114129_12055545 | 3300009147 | Bacteria | 690 |
| 113 | Ga0105243_11383610 | 3300009148 | Bacteria | 724 |
| 114 | Ga0105241_10341363 | 3300009174 | Bacteria | 1298 |
| 115 | Ga0105242_12223069 | 3300009176 | Bacteria | 594 |
| 116 | Ga0105242_12480733 | 3300009176 | Bacteria | 567 |
| 117 | Ga0105248_10003714 | 3300009177 | Bacteria | 16929 |
| 118 | Ga0105248_10158693 | 3300009177 | Bacteria | 2552 |
| 119 | Ga0105248_10438633 | 3300009177 | Bacteria | 1471 |
| 120 | Ga0105248_11523596 | 3300009177 | Bacteria | 757 |
| 121 | Ga0105237_11560845 | 3300009545 | Bacteria | 667 |
| 122 | Ga0105238_10303345 | 3300009551 | Bacteria | 1581 |
| 123 | Ga0105249_10043099 | 3300009553 | Bacteria | 4105 |
| 124 | Ga0105249_11926206 | 3300009553 | Bacteria | 664 |
| 125 | Ga0105249_12336183 | 3300009553 | Unclassified | 607 |
| 126 | Ga0105239_11968591 | 3300010375 | Unclassified | 678 |
| 127 | Ga0105246_10011404 | 3300011119 | Bacteria | 5516 |
| 128 | Ga0163162_11205851 | 3300013306 | Bacteria | 859 |
| 129 | Ga0163162_13283905 | 3300013306 | Bacteria | 518 |
| 130 | Ga0157372_10235362 | 3300013307 | Unclassified | 2124 |
| 131 | Ga0157372_13484668 | 3300013307 | Bacteria | 500 |
| 132 | Ga0157375_10022868 | 3300013308 | Bacteria | 5760 |
| 133 | Ga0157375_11330422 | 3300013308 | Bacteria | 845 |
| 134 | Ga0163163_10072531 | 3300014325 | Bacteria | 3433 |
| 135 | Ga0163163_10984546 | 3300014325 | Bacteria | 907 |
| 136 | Ga0157380_12591463 | 3300014326 | Bacteria | 573 |
| 137 | Ga0157379_10009408 | 3300014968 | Bacteria | 8515 |
| 138 | Ga0157379_11337452 | 3300014968 | Bacteria | 693 |
| 139 | Ga0157376_10006284 | 3300014969 | Bacteria | 8382 |
| 140 | Ga0207682_10301847 | 3300025893 | Bacteria | 751 |
| 141 | Ga0207642_10005024 | 3300025899 | Bacteria | 4294 |
| 142 | Ga0207710_10087818 | 3300025900 | Bacteria | 1451 |
| 143 | Ga0207680_10000175 | 3300025903 | Bacteria | 31103 |
| 144 | Ga0207680_10996478 | 3300025903 | Bacteria | 600 |
| 145 | Ga0207645_10609801 | 3300025907 | Bacteria | 741 |
| 146 | Ga0207684_10046665 | 3300025910 | Bacteria | 3675 |
| 147 | Ga0207684_10264644 | 3300025910 | Bacteria | 1484 |
| 148 | Ga0207671_10240420 | 3300025914 | Unclassified | 1422 |
| 149 | Ga0207662_10117158 | 3300025918 | Bacteria | 1667 |
| 150 | Ga0207662_10785527 | 3300025918 | Bacteria | 671 |
| 151 | Ga0207662_10883473 | 3300025918 | Bacteria | 632 |
| 152 | Ga0207681_10242459 | 3300025923 | Bacteria | 1404 |
| 153 | Ga0207681_10667847 | 3300025923 | Bacteria | 862 |
| 154 | Ga0207681_11074802 | 3300025923 | Unclassified | 676 |
| 155 | Ga0207650_10223395 | 3300025925 | Bacteria | 1516 |
| 156 | Ga0207650_10902022 | 3300025925 | Bacteria | 750 |
| 157 | Ga0207650_11555436 | 3300025925 | Bacteria | 562 |
| 158 | Ga0207659_10020489 | 3300025926 | Bacteria | 4372 |
| 159 | Ga0207659_10657699 | 3300025926 | Bacteria | 896 |
| 160 | Ga0207690_10707222 | 3300025932 | Bacteria | 829 |
| 161 | Ga0207706_10586415 | 3300025933 | Bacteria | 958 |
| 162 | Ga0207686_10509070 | 3300025934 | Bacteria | 935 |
| 163 | Ga0207670_10012703 | 3300025936 | Bacteria | 4936 |
| 164 | Ga0207670_10306493 | 3300025936 | Bacteria | 1245 |
| 165 | Ga0207704_10009458 | 3300025938 | Bacteria | 4703 |
| 166 | Ga0207704_11363154 | 3300025938 | Bacteria | 607 |
| 167 | Ga0207665_10110098 | 3300025939 | Bacteria | 1934 |
| 168 | Ga0207691_10005166 | 3300025940 | Bacteria | 12603 |
| 169 | Ga0207691_11163873 | 3300025940 | Bacteria | 640 |
| 170 | Ga0207711_10000362 | 3300025941 | Bacteria | 48201 |
| 171 | Ga0207711_10377804 | 3300025941 | Bacteria | 1315 |
| 172 | Ga0207711_10478393 | 3300025941 | Bacteria | 1160 |
| 173 | Ga0207689_10030965 | 3300025942 | Bacteria | 4457 |
| 174 | Ga0207661_10012044 | 3300025944 | Bacteria | 6283 |
| 175 | Ga0207661_10825592 | 3300025944 | Bacteria | 853 |
| 176 | Ga0207679_10033419 | 3300025945 | Bacteria | 3619 |
| 177 | Ga0207679_12062212 | 3300025945 | Bacteria | 519 |
| 178 | Ga0207651_10152687 | 3300025960 | Bacteria | 1800 |
| 179 | Ga0207651_10554944 | 3300025960 | Bacteria | 999 |
| 180 | Ga0207668_11162435 | 3300025972 | Bacteria | 693 |
| 181 | Ga0207658_10002775 | 3300025986 | Bacteria | 12618 |
| 182 | Ga0207658_10956369 | 3300025986 | Bacteria | 781 |
| 183 | Ga0207677_10317192 | 3300026023 | Bacteria | 1294 |
| 184 | Ga0207703_10019353 | 3300026035 | Bacteria | 5319 |
| 185 | Ga0207703_10205658 | 3300026035 | Bacteria | 1752 |
| 186 | Ga0207703_10683481 | 3300026035 | Bacteria | 975 |
| 187 | Ga0207639_10016890 | 3300026041 | Bacteria | 5171 |
| 188 | Ga0207678_10054546 | 3300026067 | Bacteria | 3443 |
| 189 | Ga0207702_10009626 | 3300026078 | Bacteria | 8111 |
| 190 | Ga0207641_10070568 | 3300026088 | Bacteria | 3002 |
| 191 | Ga0207648_10004273 | 3300026089 | Bacteria | 14730 |
| 192 | Ga0207648_10284078 | 3300026089 | Bacteria | 1480 |
| 193 | Ga0207648_10640932 | 3300026089 | Bacteria | 981 |
| 194 | Ga0207676_10008850 | 3300026095 | Bacteria | 7164 |
| 195 | Ga0207676_10123301 | 3300026095 | Bacteria | 2189 |
| 196 | Ga0207676_10309456 | 3300026095 | Bacteria | 1446 |
| 197 | Ga0207676_10382048 | 3300026095 | Bacteria | 1311 |
| 198 | Ga0207674_10717226 | 3300026116 | Bacteria | 965 |
| 199 | Ga0207675_100774087 | 3300026118 | Bacteria | 972 |
| 200 | Ga0207675_101056386 | 3300026118 | Bacteria | 831 |
| 201 | Ga0207683_10259999 | 3300026121 | Bacteria | 1585 |
| 202 | Ga0209971_1053193 | 3300027682 | Bacteria | 979 |
| 203 | Ga0207428_10000013 | 3300027907 | Bacteria | 346742 |
| 204 | Ga0207428_10001618 | 3300027907 | Bacteria | 23381 |
| 205 | Ga0207428_10060684 | 3300027907 | Bacteria | 2996 |
| 206 | Ga0268266_10212042 | 3300028379 | Bacteria | 1776 |
| 207 | Ga0268265_10371958 | 3300028380 | Bacteria | 1312 |
| 208 | Ga0268265_11523028 | 3300028380 | Bacteria | 673 |
| 209 | Ga0268264_10002845 | 3300028381 | Bacteria | 15091 |
| 210 | Ga0268264_10397371 | 3300028381 | Bacteria | 1324 |
| 211 | Ga0268264_11333968 | 3300028381 | Bacteria | 728 |
| 212 | Ga0265318_10021401 | 3300028577 | Bacteria | 2596 |
| 213 | Ga0265318_10088574 | 3300028577 | Bacteria | 1140 |
| 214 | Ga0265770_1012352 | 3300030878 | Bacteria | 1264 |
| 215 | Ga0265760_10002959 | 3300031090 | Bacteria | 4969 |
| 216 | Ga0265330_10205496 | 3300031235 | Bacteria | 832 |
| 217 | Ga0265320_10039776 | 3300031240 | Bacteria | 2349 |
| 218 | Ga0265325_10031182 | 3300031241 | Bacteria | 2855 |
| 219 | Ga0265316_10950382 | 3300031344 | Bacteria | 599 |
| 220 | Ga0265314_10001851 | 3300031711 | Bacteria | 22676 |
| 221 | Ga0307405_10295466 | 3300031731 | Bacteria | 1226 |
| 222 | Ga0307410_11062791 | 3300031852 | Bacteria | 700 |
| 223 | Ga0307409_101881654 | 3300031995 | Bacteria | 628 |
| 224 | Ga0307416_100253467 | 3300032002 | Bacteria | 1715 |
| 225 | Ga0307416_100611957 | 3300032002 | Bacteria | 1170 |
| 226 | Ga0373930_0043987 | 3300034816 | Bacteria | 959 |
| 227 | Ga0373950_0098419 | 3300034818 | Bacteria | 628 |
| 228 | Ga0373958_0010576 | 3300034819 | Bacteria | 1543 |
| 229 | Ga0373938_0079032 | 3300034957 | Bacteria | 798 |
| 230 | Ga0373929_0181619 | 3300035085 | Bacteria | 580 |
| 231 | Ga0373940_0009228 | 3300035088 | Bacteria | 2288 |
| 232 | Ga0373932_0064344 | 3300035112 | Bacteria | 1122 |
| 233 | Ga0373932_0141667 | 3300035112 | Bacteria | 818 |
| 234 | Ga0373936_0017646 | 3300035113 | Bacteria | 2750 |
| 235 | Ga0373960_0066611 | 3300035121 | Bacteria | 1104 |
| 236 | Ga0373942_0026333 | 3300035207 | Bacteria | 1505 |
| 237 | Ga0373962_0003263 | 3300035242 | Bacteria | 3904 |
| 238 | Ga0373931_0008091 | 3300035691 | Bacteria | 4979 |
| 239 | Ga0373937_1599141 | 3300036401 | Bacteria | 599 |
| 240 | Ga0436365_0556663 | 3300039437 | Unclassified | 1146 |
| 241 | Ga0439439_0045390 | 3300041406 | Bacteria | 1146 |
| 242 | Ga0439456_058224 | 3300042013 | Bacteria | 848 |
| 243 | Ga0439435_0003629 | 3300042436 | Bacteria | 3234 |
| 244 | Ga0439460_0067739 | 3300042461 | Bacteria | 1100 |
| 245 | Ga0451577_0139435 | 3300042876 | Bacteria | 2178 |
| 246 | Ga0439440_0143689 | 3300042993 | Bacteria | 679 |
| 247 | Ga0453683_0669459 | 3300044673 | Bacteria | 679 |
| 248 | Ga0453684_0370675 | 3300044712 | Bacteria | 1610 |
| 249 | Ga0453684_0424768 | 3300044712 | Bacteria | 1484 |
| 250 | Ga0451576_0090693 | 3300045051 | Bacteria | 3179 |
| 251 | Ga0495603_0091180 | 3300046455 | Bacteria | 1782 |
| 252 | Ga0495639_0526260 | 3300046475 | Bacteria | 605 |
| 253 | Ga0495630_0904301 | 3300046517 | Bacteria | 672 |
| 254 | Ga0495645_0006813 | 3300046543 | Bacteria | 7939 |
| 255 | Ga0495656_0115829 | 3300046615 | Bacteria | 1259 |
| 256 | Ga0495588_0424333 | 3300046674 | Bacteria | 698 |
| 257 | Ga0495599_0130735 | 3300046678 | Bacteria | 1559 |
| 258 | Ga0495669_0151929 | 3300046684 | Bacteria | 1096 |
| 259 | Ga0496101_0142552 | 3300048904 | Bacteria | 1827 |
| 260 | Ga0496102_0031940 | 3300048905 | Bacteria | 4727 |
| 261 | Ga0496103_0027035 | 3300048906 | Bacteria | 3474 |
| 262 | Ga0496104_0020466 | 3300048907 | Bacteria | 6065 |
| 263 | Ga0496104_0120569 | 3300048907 | Bacteria | 2518 |
| 264 | Ga0496106_0007342 | 3300048909 | Bacteria | 8146 |
| 265 | Ga0496107_0002966 | 3300048910 | Bacteria | 11236 |
| 266 | Ga0496108_0000432 | 3300048911 | Bacteria | 33880 |
| 267 | Ga0496109_0000770 | 3300048912 | Bacteria | 26636 |
| 268 | Ga0496109_0035761 | 3300048912 | Bacteria | 4483 |
| 269 | Ga0496110_0005270 | 3300048913 | Bacteria | 10120 |
| 270 | Ga0496111_0027885 | 3300048914 | Bacteria | 3999 |
| 271 | Ga0496111_0112845 | 3300048914 | Bacteria | 2002 |
| 272 | Ga0496112_0000221 | 3300048915 | Bacteria | 36971 |
| 273 | Ga0496112_0053928 | 3300048915 | Bacteria | 3950 |
| 274 | Ga0496112_0435789 | 3300048915 | Bacteria | 1249 |
| 275 | Ga0496113_0000493 | 3300048916 | Bacteria | 19400 |
| 276 | Ga0496113_1046373 | 3300048916 | Bacteria | 642 |
| 277 | Ga0501033_1178071 | 3300049570 | Bacteria | 508 |
| 278 | Ga0501036_1044326 | 3300049572 | Bacteria | 668 |
| 279 | Ga0501039_0366313 | 3300049575 | Bacteria | 1132 |
| 280 | Ga0501040_0025226 | 3300049576 | Bacteria | 3997 |
| 281 | Ga0501041_0017747 | 3300049577 | Bacteria | 4236 |
| 282 | Ga0501042_0026441 | 3300049578 | Bacteria | 4078 |
| 283 | Ga0501046_0134400 | 3300049580 | Bacteria | 1874 |
| 284 | Ga0501068_0086505 | 3300049584 | Bacteria | 1930 |
| 285 | Ga0501071_0291875 | 3300049587 | Bacteria | 1235 |
| 286 | Ga0501075_0025651 | 3300049591 | Bacteria | 4330 |
| 287 | Ga0501075_0438610 | 3300049591 | Bacteria | 996 |
| 288 | Ga0501076_0029797 | 3300049592 | Bacteria | 4246 |
| 289 | Ga0501077_0228859 | 3300049593 | Bacteria | 1182 |
| 290 | Ga0501077_1132175 | 3300049593 | Bacteria | 504 |
| 291 | Ga0501079_0718307 | 3300049741 | Bacteria | 786 |
| 292 | Ga0501081_0124635 | 3300049743 | Bacteria | 1837 |
| 293 | Ga0501083_0380187 | 3300049744 | Bacteria | 918 |
| 294 | Ga0501035_0141236 | 3300049822 | Bacteria | 2094 |
| 295 | nmdc:mga05p37_1151683_c1 | 3300050507 | Bacteria | 807 |
| 296 | nmdc:mga05p37_245112_c1 | 3300050507 | Bacteria | 2152 |
| 297 | nmdc:mga05p37_637268_c1 | 3300050507 | Bacteria | 1196 |
| 298 | nmdc:mga05p37_9516_c1 | 3300050507 | Bacteria | 11506 |
| 299 | nmdc:mga09592_1257193_c1 | 3300050508 | Bacteria | 610 |
| 300 | nmdc:mga09592_24668_c1 | 3300050508 | Bacteria | 4974 |
| 301 | nmdc:mga09592_9650_c1 | 3300050508 | Bacteria | 7842 |
| 302 | nmdc:mga0qj67_100432_c1 | 3300050509 | Bacteria | 2333 |
| 303 | nmdc:mga0qj67_1364450_c1 | 3300050509 | Bacteria | 548 |
| 304 | nmdc:mga0qj67_295052_c1 | 3300050509 | Bacteria | 1314 |
| 305 | nmdc:mga0qj67_32205_c1 | 3300050509 | Bacteria | 4087 |
| 306 | nmdc:mga0qj67_382836_c1 | 3300050509 | Bacteria | 1136 |
| 307 | nmdc:mga06r32_1047067_c1 | 3300050510 | Bacteria | 767 |
| 308 | nmdc:mga06r32_166195_c1 | 3300050510 | Bacteria | 2190 |
| 309 | nmdc:mga06r32_32239_c1 | 3300050510 | Bacteria | 4928 |
| 310 | nmdc:mga06r32_72069_c1 | 3300050510 | Bacteria | 3345 |
| 311 | nmdc:mga08y16_135_c1 | 3300050511 | Bacteria | 64253 |
| 312 | nmdc:mga08y16_14898_c1 | 3300050511 | Bacteria | 8179 |
| 313 | nmdc:mga08y16_55878_c1 | 3300050511 | Bacteria | 4125 |
| 314 | nmdc:mga0a205_1144660_c1 | 3300050515 | Bacteria | 626 |
| 315 | nmdc:mga0a205_202323_c1 | 3300050515 | Bacteria | 1876 |
| 316 | nmdc:mga0a205_594137_c1 | 3300050515 | Bacteria | 960 |
| 317 | Ga0495601_0018893 | 3300053077 | Bacteria | 4199 |
| 318 | Ga0495612_0045798 | 3300053078 | Bacteria | 1791 |
| 319 | Ga0500583_0164109 | 3300053092 | Bacteria | 1106 |
| 320 | Ga0500637_0002603 | 3300053178 | Bacteria | 8073 |
| 321 | Ga0501084_0172174 | 3300054114 | Bacteria | 1827 |
| 322 | Ga0501084_0339894 | 3300054114 | Bacteria | 1268 |
| 323 | Ga0530510_0491344 | 3300061734 | Bacteria | 930 |
| 324 | Ga0530510_1290098 | 3300061734 | Bacteria | 560 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300061734 | Ga0530510_1290098 | Ga0530510_1290098_232_549 | 105 |
| 2 | 3300044673 | Ga0453683_0669459 | Ga0453683_0669459_39_389 | 111 |
| 3 | 3300006237 | Ga0097621_100484851 | Ga0097621_1004848512 | 112 |
| 4 | 3300013306 | Ga0163162_13283905 | Ga0163162_132839052 | 112 |
| 5 | 3300031731 | Ga0307405_10295466 | Ga0307405_102954662 | 112 |
| 6 | 3300005295 | Ga0065707_10003560 | Ga0065707_100035603 | 113 |
| 7 | 3300005330 | Ga0070690_100127843 | Ga0070690_1001278431 | 113 |
| 8 | 3300005331 | Ga0070670_100110136 | Ga0070670_1001101362 | 113 |
| 9 | 3300005333 | Ga0070677_10445135 | Ga0070677_104451351 | 113 |
| 10 | 3300005336 | Ga0070680_100504067 | Ga0070680_1005040672 | 113 |
| 11 | 3300005340 | Ga0070689_101098535 | Ga0070689_1010985352 | 113 |
| 12 | 3300005343 | Ga0070687_100058683 | Ga0070687_1000586832 | 113 |
| 13 | 3300005347 | Ga0070668_101426423 | Ga0070668_1014264231 | 113 |
| 14 | 3300005355 | Ga0070671_101400505 | Ga0070671_1014005051 | 113 |
| 15 | 3300005364 | Ga0070673_100038665 | Ga0070673_1000386654 | 113 |
| 16 | 3300005365 | Ga0070688_100062590 | Ga0070688_1000625903 | 113 |
| 17 | 3300005367 | Ga0070667_100819775 | Ga0070667_1008197752 | 113 |
| 18 | 3300005456 | Ga0070678_100913995 | Ga0070678_1009139952 | 113 |
| 19 | 3300005468 | Ga0070707_100756618 | Ga0070707_1007566181 | 113 |
| 20 | 3300005535 | Ga0070684_100351444 | Ga0070684_1003514442 | 113 |
| 21 | 3300005544 | Ga0070686_100161173 | Ga0070686_1001611731 | 113 |
| 22 | 3300005546 | Ga0070696_100669754 | Ga0070696_1006697541 | 113 |
| 23 | 3300005577 | Ga0068857_100334697 | Ga0068857_1003346974 | 113 |
| 24 | 3300005577 | Ga0068857_100762910 | Ga0068857_1007629102 | 113 |
| 25 | 3300005618 | Ga0068864_100603676 | Ga0068864_1006036762 | 113 |
| 26 | 3300005844 | Ga0068862_101472752 | Ga0068862_1014727522 | 113 |
| 27 | 3300006844 | Ga0075428_100100856 | Ga0075428_1001008563 | 113 |
| 28 | 3300006844 | Ga0075428_101011037 | Ga0075428_1010110371 | 113 |
| 29 | 3300006846 | Ga0075430_100039526 | Ga0075430_1000395263 | 113 |
| 30 | 3300006846 | Ga0075430_100050218 | Ga0075430_1000502182 | 113 |
| 31 | 3300006846 | Ga0075430_100396801 | Ga0075430_1003968011 | 113 |
| 32 | 3300006847 | Ga0075431_100122035 | Ga0075431_1001220352 | 113 |
| 33 | 3300006847 | Ga0075431_101102019 | Ga0075431_1011020192 | 113 |
| 34 | 3300006847 | Ga0075431_101362340 | Ga0075431_1013623402 | 113 |
| 35 | 3300006880 | Ga0075429_100008267 | Ga0075429_1000082675 | 113 |
| 36 | 3300006880 | Ga0075429_100173845 | Ga0075429_1001738452 | 113 |
| 37 | 3300006880 | Ga0075429_100270313 | Ga0075429_1002703132 | 113 |
| 38 | 3300006914 | Ga0075436_100251470 | Ga0075436_1002514702 | 113 |
| 39 | 3300009094 | Ga0111539_10000302 | Ga0111539_1000030243 | 113 |
| 40 | 3300009094 | Ga0111539_10050747 | Ga0111539_100507475 | 113 |
| 41 | 3300009101 | Ga0105247_10163559 | Ga0105247_101635591 | 113 |
| 42 | 3300009147 | Ga0114129_10020321 | Ga0114129_100203216 | 113 |
| 43 | 3300009148 | Ga0105243_11383610 | Ga0105243_113836102 | 113 |
| 44 | 3300009174 | Ga0105241_10341363 | Ga0105241_103413633 | 113 |
| 45 | 3300009176 | Ga0105242_12480733 | Ga0105242_124807331 | 113 |
| 46 | 3300009177 | Ga0105248_10003714 | Ga0105248_1000371415 | 113 |
| 47 | 3300009551 | Ga0105238_10303345 | Ga0105238_103033452 | 113 |
| 48 | 3300013308 | Ga0157375_10022868 | Ga0157375_100228688 | 113 |
| 49 | 3300014325 | Ga0163163_10072531 | Ga0163163_100725313 | 113 |
| 50 | 3300014968 | Ga0157379_10009408 | Ga0157379_1000940810 | 113 |
| 51 | 3300014969 | Ga0157376_10006284 | Ga0157376_1000628411 | 113 |
| 52 | 3300025893 | Ga0207682_10301847 | Ga0207682_103018471 | 113 |
| 53 | 3300025918 | Ga0207662_10117158 | Ga0207662_101171582 | 113 |
| 54 | 3300025918 | Ga0207662_10883473 | Ga0207662_108834731 | 113 |
| 55 | 3300025923 | Ga0207681_10667847 | Ga0207681_106678472 | 113 |
| 56 | 3300025925 | Ga0207650_10902022 | Ga0207650_109020222 | 113 |
| 57 | 3300025926 | Ga0207659_10020489 | Ga0207659_100204893 | 113 |
| 58 | 3300025926 | Ga0207659_10657699 | Ga0207659_106576991 | 113 |
| 59 | 3300025933 | Ga0207706_10586415 | Ga0207706_105864152 | 113 |
| 60 | 3300025960 | Ga0207651_10554944 | Ga0207651_105549442 | 113 |
| 61 | 3300025972 | Ga0207668_11162435 | Ga0207668_111624351 | 113 |
| 62 | 3300026088 | Ga0207641_10070568 | Ga0207641_100705682 | 113 |
| 63 | 3300026089 | Ga0207648_10640932 | Ga0207648_106409322 | 113 |
| 64 | 3300026095 | Ga0207676_10309456 | Ga0207676_103094562 | 113 |
| 65 | 3300026116 | Ga0207674_10717226 | Ga0207674_107172262 | 113 |
| 66 | 3300026121 | Ga0207683_10259999 | Ga0207683_102599992 | 113 |
| 67 | 3300027682 | Ga0209971_1053193 | Ga0209971_10531932 | 113 |
| 68 | 3300027907 | Ga0207428_10001618 | Ga0207428_1000161811 | 113 |
| 69 | 3300027907 | Ga0207428_10060684 | Ga0207428_100606843 | 113 |
| 70 | 3300028381 | Ga0268264_10397371 | Ga0268264_103973712 | 113 |
| 71 | 3300032002 | Ga0307416_100253467 | Ga0307416_1002534672 | 113 |
| 72 | 3300041406 | Ga0439439_0045390 | Ga0439439_0045390_313_663 | 113 |
| 73 | 3300042013 | Ga0439456_058224 | Ga0439456_058224_368_718 | 113 |
| 74 | 3300042436 | Ga0439435_0003629 | Ga0439435_0003629_2195_2545 | 113 |
| 75 | 3300042993 | Ga0439440_0143689 | Ga0439440_0143689_212_562 | 113 |
| 76 | 3300046615 | Ga0495656_0115829 | Ga0495656_0115829_580_930 | 113 |
| 77 | 3300046684 | Ga0495669_0151929 | Ga0495669_0151929_529_879 | 113 |
| 78 | 3300048904 | Ga0496101_0142552 | Ga0496101_0142552_34_414 | 113 |
| 79 | 3300048905 | Ga0496102_0031940 | Ga0496102_0031940_4247_4627 | 113 |
| 80 | 3300048906 | Ga0496103_0027035 | Ga0496103_0027035_1184_1564 | 113 |
| 81 | 3300048907 | Ga0496104_0120569 | Ga0496104_0120569_2128_2508 | 113 |
| 82 | 3300048909 | Ga0496106_0007342 | Ga0496106_0007342_6780_7160 | 113 |
| 83 | 3300048910 | Ga0496107_0002966 | Ga0496107_0002966_9811_10191 | 113 |
| 84 | 3300048912 | Ga0496109_0035761 | Ga0496109_0035761_1128_1508 | 113 |
| 85 | 3300048914 | Ga0496111_0027885 | Ga0496111_0027885_2413_2793 | 113 |
| 86 | 3300048915 | Ga0496112_0435789 | Ga0496112_0435789_215_595 | 113 |
| 87 | 3300049570 | Ga0501033_1178071 | Ga0501033_1178071_101_451 | 113 |
| 88 | 3300049575 | Ga0501039_0366313 | Ga0501039_0366313_570_920 | 113 |
| 89 | 3300049576 | Ga0501040_0025226 | Ga0501040_0025226_1805_2155 | 113 |
| 90 | 3300049577 | Ga0501041_0017747 | Ga0501041_0017747_518_868 | 113 |
| 91 | 3300049578 | Ga0501042_0026441 | Ga0501042_0026441_209_559 | 113 |
| 92 | 3300049580 | Ga0501046_0134400 | Ga0501046_0134400_208_558 | 113 |
| 93 | 3300049584 | Ga0501068_0086505 | Ga0501068_0086505_355_705 | 113 |
| 94 | 3300049587 | Ga0501071_0291875 | Ga0501071_0291875_616_966 | 113 |
| 95 | 3300049591 | Ga0501075_0025651 | Ga0501075_0025651_1057_1407 | 113 |
| 96 | 3300049591 | Ga0501075_0438610 | Ga0501075_0438610_490_840 | 113 |
| 97 | 3300049592 | Ga0501076_0029797 | Ga0501076_0029797_1632_1982 | 113 |
| 98 | 3300049593 | Ga0501077_0228859 | Ga0501077_0228859_365_715 | 113 |
| 99 | 3300049741 | Ga0501079_0718307 | Ga0501079_0718307_224_646 | 113 |
| 100 | 3300049743 | Ga0501081_0124635 | Ga0501081_0124635_486_836 | 113 |
| 101 | 3300049822 | Ga0501035_0141236 | Ga0501035_0141236_754_1104 | 113 |
| 102 | 3300050507 | nmdc:mga05p37_245112_c1 | nmdc:mga05p37_245112_c1_1417_1767 | 113 |
| 103 | 3300050508 | nmdc:mga09592_1257193_c1 | nmdc:mga09592_1257193_c1_144_494 | 113 |
| 104 | 3300050508 | nmdc:mga09592_24668_c1 | nmdc:mga09592_24668_c1_975_1325 | 113 |
| 105 | 3300050508 | nmdc:mga09592_9650_c1 | nmdc:mga09592_9650_c1_7149_7499 | 113 |
| 106 | 3300050509 | nmdc:mga0qj67_1364450_c1 | nmdc:mga0qj67_1364450_c1_71_421 | 113 |
| 107 | 3300050509 | nmdc:mga0qj67_295052_c1 | nmdc:mga0qj67_295052_c1_201_551 | 113 |
| 108 | 3300050509 | nmdc:mga0qj67_32205_c1 | nmdc:mga0qj67_32205_c1_1757_2107 | 113 |
| 109 | 3300050509 | nmdc:mga0qj67_382836_c1 | nmdc:mga0qj67_382836_c1_382_732 | 113 |
| 110 | 3300050510 | nmdc:mga06r32_1047067_c1 | nmdc:mga06r32_1047067_c1_245_595 | 113 |
| 111 | 3300050510 | nmdc:mga06r32_32239_c1 | nmdc:mga06r32_32239_c1_3567_3917 | 113 |
| 112 | 3300050510 | nmdc:mga06r32_72069_c1 | nmdc:mga06r32_72069_c1_2078_2428 | 113 |
| 113 | 3300050511 | nmdc:mga08y16_135_c1 | nmdc:mga08y16_135_c1_12925_13275 | 113 |
| 114 | 3300050511 | nmdc:mga08y16_55878_c1 | nmdc:mga08y16_55878_c1_3549_3899 | 113 |
| 115 | 3300054114 | Ga0501084_0172174 | Ga0501084_0172174_278_628 | 113 |
| 116 | 3300061734 | Ga0530510_0491344 | Ga0530510_0491344_218_568 | 113 |
| 117 | iso_pu_bacteria | 8016539877 | 8016541648 | 113 |
| 118 | 3300005329 | Ga0070683_100023799 | Ga0070683_1000237995 | 114 |
| 119 | 3300005331 | Ga0070670_100558674 | Ga0070670_1005586742 | 114 |
| 120 | 3300005366 | Ga0070659_100165452 | Ga0070659_1001654522 | 114 |
| 121 | 3300005535 | Ga0070684_100009616 | Ga0070684_1000096163 | 114 |
| 122 | 3300005539 | Ga0068853_101443325 | Ga0068853_1014433251 | 114 |
| 123 | 3300005617 | Ga0068859_101257532 | Ga0068859_1012575323 | 114 |
| 124 | 3300006931 | Ga0097620_101257505 | Ga0097620_1012575053 | 114 |
| 125 | 3300009553 | Ga0105249_11926206 | Ga0105249_119262061 | 114 |
| 126 | 3300009553 | Ga0105249_12336183 | Ga0105249_123361832 | 114 |
| 127 | 3300013306 | Ga0163162_11205851 | Ga0163162_112058511 | 114 |
| 128 | 3300025910 | Ga0207684_10264644 | Ga0207684_102646442 | 114 |
| 129 | 3300025923 | Ga0207681_10242459 | Ga0207681_102424592 | 114 |
| 130 | 3300025932 | Ga0207690_10707222 | Ga0207690_107072221 | 114 |
| 131 | 3300025944 | Ga0207661_10012044 | Ga0207661_100120443 | 114 |
| 132 | 3300026118 | Ga0207675_100774087 | Ga0207675_1007740873 | 114 |
| 133 | 3300031995 | Ga0307409_101881654 | Ga0307409_1018816542 | 114 |
| 134 | 3300042461 | Ga0439460_0067739 | Ga0439460_0067739_233_586 | 114 |
| 135 | 3300005347 | Ga0070668_101532453 | Ga0070668_1015324531 | 115 |
| 136 | 3300005356 | Ga0070674_101175832 | Ga0070674_1011758322 | 115 |
| 137 | 3300005444 | Ga0070694_101605805 | Ga0070694_1016058051 | 115 |
| 138 | 3300005459 | Ga0068867_101119170 | Ga0068867_1011191701 | 115 |
| 139 | 3300005617 | Ga0068859_100690184 | Ga0068859_1006901843 | 115 |
| 140 | 3300005719 | Ga0068861_101662458 | Ga0068861_1016624581 | 115 |
| 141 | 3300005844 | Ga0068862_101858150 | Ga0068862_1018581501 | 115 |
| 142 | 3300006194 | Ga0075427_10022052 | Ga0075427_100220522 | 115 |
| 143 | 3300006846 | Ga0075430_100065660 | Ga0075430_1000656605 | 115 |
| 144 | 3300006880 | Ga0075429_100156356 | Ga0075429_1001563564 | 115 |
| 145 | 3300006931 | Ga0097620_100690167 | Ga0097620_1006901673 | 115 |
| 146 | 3300009094 | Ga0111539_10001828 | Ga0111539_1000182826 | 115 |
| 147 | 3300009101 | Ga0105247_10110512 | Ga0105247_101105122 | 115 |
| 148 | 3300009147 | Ga0114129_10066507 | Ga0114129_100665075 | 115 |
| 149 | 3300009176 | Ga0105242_12223069 | Ga0105242_122230691 | 115 |
| 150 | 3300009177 | Ga0105248_10438633 | Ga0105248_104386332 | 115 |
| 151 | 3300014326 | Ga0157380_12591463 | Ga0157380_125914631 | 115 |
| 152 | 3300025900 | Ga0207710_10087818 | Ga0207710_100878182 | 115 |
| 153 | 3300025903 | Ga0207680_10996478 | Ga0207680_109964781 | 115 |
| 154 | 3300025936 | Ga0207670_10306493 | Ga0207670_103064931 | 115 |
| 155 | 3300025938 | Ga0207704_11363154 | Ga0207704_113631541 | 115 |
| 156 | 3300025940 | Ga0207691_11163873 | Ga0207691_111638731 | 115 |
| 157 | 3300025941 | Ga0207711_10478393 | Ga0207711_104783931 | 115 |
| 158 | 3300025945 | Ga0207679_12062212 | Ga0207679_120622121 | 115 |
| 159 | 3300026035 | Ga0207703_10205658 | Ga0207703_102056582 | 115 |
| 160 | 3300026089 | Ga0207648_10284078 | Ga0207648_102840781 | 115 |
| 161 | 3300027907 | Ga0207428_10000013 | Ga0207428_10000013273 | 115 |
| 162 | 3300028380 | Ga0268265_11523028 | Ga0268265_115230281 | 115 |
| 163 | 3300028577 | Ga0265318_10088574 | Ga0265318_100885741 | 115 |
| 164 | 3300031240 | Ga0265320_10039776 | Ga0265320_100397762 | 115 |
| 165 | 3300034819 | Ga0373958_0010576 | Ga0373958_0010576_676_1044 | 115 |
| 166 | 3300034957 | Ga0373938_0079032 | Ga0373938_0079032_44_412 | 115 |
| 167 | 3300035085 | Ga0373929_0181619 | Ga0373929_0181619_89_457 | 115 |
| 168 | 3300035088 | Ga0373940_0009228 | Ga0373940_0009228_871_1239 | 115 |
| 169 | 3300035112 | Ga0373932_0064344 | Ga0373932_0064344_332_700 | 115 |
| 170 | 3300035121 | Ga0373960_0066611 | Ga0373960_0066611_218_586 | 115 |
| 171 | 3300035207 | Ga0373942_0026333 | Ga0373942_0026333_778_1146 | 115 |
| 172 | 3300035242 | Ga0373962_0003263 | Ga0373962_0003263_1386_1754 | 115 |
| 173 | 3300035691 | Ga0373931_0008091 | Ga0373931_0008091_1111_1479 | 115 |
| 174 | 3300050507 | nmdc:mga05p37_1151683_c1 | nmdc:mga05p37_1151683_c1_246_614 | 115 |
| 175 | 3300050509 | nmdc:mga0qj67_100432_c1 | nmdc:mga0qj67_100432_c1_744_1112 | 115 |
| 176 | 3300050510 | nmdc:mga06r32_166195_c1 | nmdc:mga06r32_166195_c1_1467_1835 | 115 |
| 177 | 3300050511 | nmdc:mga08y16_14898_c1 | nmdc:mga08y16_14898_c1_4146_4514 | 115 |
| 178 | 3300050515 | nmdc:mga0a205_202323_c1 | nmdc:mga0a205_202323_c1_680_1048 | 115 |
| 179 | 3300005295 | Ga0065707_10006580 | Ga0065707_100065802 | 116 |
| 180 | 3300005328 | Ga0070676_11254062 | Ga0070676_112540621 | 116 |
| 181 | 3300005335 | Ga0070666_10000497 | Ga0070666_100004977 | 116 |
| 182 | 3300005338 | Ga0068868_101110778 | Ga0068868_1011107782 | 116 |
| 183 | 3300005340 | Ga0070689_100019969 | Ga0070689_1000199692 | 116 |
| 184 | 3300005343 | Ga0070687_101115054 | Ga0070687_1011150541 | 116 |
| 185 | 3300005355 | Ga0070671_101659164 | Ga0070671_1016591641 | 116 |
| 186 | 3300005356 | Ga0070674_100183861 | Ga0070674_1001838612 | 116 |
| 187 | 3300005364 | Ga0070673_100012595 | Ga0070673_1000125958 | 116 |
| 188 | 3300005367 | Ga0070667_100002449 | Ga0070667_10000244915 | 116 |
| 189 | 3300005435 | Ga0070714_102396854 | Ga0070714_1023968541 | 116 |
| 190 | 3300005440 | Ga0070705_100006629 | Ga0070705_1000066297 | 116 |
| 191 | 3300005459 | Ga0068867_100133213 | Ga0068867_1001332132 | 116 |
| 192 | 3300005518 | Ga0070699_100233851 | Ga0070699_1002338511 | 116 |
| 193 | 3300005543 | Ga0070672_100011039 | Ga0070672_1000110396 | 116 |
| 194 | 3300005548 | Ga0070665_100020949 | Ga0070665_1000209498 | 116 |
| 195 | 3300005549 | Ga0070704_100180839 | Ga0070704_1001808392 | 116 |
| 196 | 3300005564 | Ga0070664_100090582 | Ga0070664_1000905822 | 116 |
| 197 | 3300005614 | Ga0068856_100020691 | Ga0068856_1000206918 | 116 |
| 198 | 3300005615 | Ga0070702_100005477 | Ga0070702_1000054772 | 116 |
| 199 | 3300005617 | Ga0068859_100000713 | Ga0068859_10000071311 | 116 |
| 200 | 3300005618 | Ga0068864_100062368 | Ga0068864_1000623686 | 116 |
| 201 | 3300005618 | Ga0068864_100079897 | Ga0068864_1000798973 | 116 |
| 202 | 3300005718 | Ga0068866_10264104 | Ga0068866_102641042 | 116 |
| 203 | 3300005841 | Ga0068863_100272839 | Ga0068863_1002728395 | 116 |
| 204 | 3300005841 | Ga0068863_100894661 | Ga0068863_1008946611 | 116 |
| 205 | 3300005842 | Ga0068858_100009921 | Ga0068858_1000099212 | 116 |
| 206 | 3300005842 | Ga0068858_100148123 | Ga0068858_1001481232 | 116 |
| 207 | 3300005843 | Ga0068860_100000203 | Ga0068860_1000002037 | 116 |
| 208 | 3300006358 | Ga0068871_100112273 | Ga0068871_1001122731 | 116 |
| 209 | 3300006847 | Ga0075431_101819206 | Ga0075431_1018192061 | 116 |
| 210 | 3300006852 | Ga0075433_10825354 | Ga0075433_108253542 | 116 |
| 211 | 3300006881 | Ga0068865_100090609 | Ga0068865_1000906092 | 116 |
| 212 | 3300006931 | Ga0097620_100000713 | Ga0097620_10000071311 | 116 |
| 213 | 3300007076 | Ga0075435_100336634 | Ga0075435_1003366342 | 116 |
| 214 | 3300009147 | Ga0114129_10432129 | Ga0114129_104321292 | 116 |
| 215 | 3300009147 | Ga0114129_12055545 | Ga0114129_120555452 | 116 |
| 216 | 3300009177 | Ga0105248_11523596 | Ga0105248_115235962 | 116 |
| 217 | 3300010375 | Ga0105239_11968591 | Ga0105239_119685911 | 116 |
| 218 | 3300011119 | Ga0105246_10011404 | Ga0105246_100114044 | 116 |
| 219 | 3300013307 | Ga0157372_10235362 | Ga0157372_102353622 | 116 |
| 220 | 3300013308 | Ga0157375_11330422 | Ga0157375_113304221 | 116 |
| 221 | 3300014325 | Ga0163163_10984546 | Ga0163163_109845462 | 116 |
| 222 | 3300014968 | Ga0157379_11337452 | Ga0157379_113374521 | 116 |
| 223 | 3300025899 | Ga0207642_10005024 | Ga0207642_100050243 | 116 |
| 224 | 3300025903 | Ga0207680_10000175 | Ga0207680_100001756 | 116 |
| 225 | 3300025907 | Ga0207645_10609801 | Ga0207645_106098011 | 116 |
| 226 | 3300025914 | Ga0207671_10240420 | Ga0207671_102404202 | 116 |
| 227 | 3300025918 | Ga0207662_10785527 | Ga0207662_107855271 | 116 |
| 228 | 3300025925 | Ga0207650_10223395 | Ga0207650_102233952 | 116 |
| 229 | 3300025925 | Ga0207650_11555436 | Ga0207650_115554362 | 116 |
| 230 | 3300025934 | Ga0207686_10509070 | Ga0207686_105090702 | 116 |
| 231 | 3300025936 | Ga0207670_10012703 | Ga0207670_100127036 | 116 |
| 232 | 3300025938 | Ga0207704_10009458 | Ga0207704_100094585 | 116 |
| 233 | 3300025940 | Ga0207691_10005166 | Ga0207691_100051668 | 116 |
| 234 | 3300025941 | Ga0207711_10000362 | Ga0207711_1000036219 | 116 |
| 235 | 3300025942 | Ga0207689_10030965 | Ga0207689_100309654 | 116 |
| 236 | 3300025944 | Ga0207661_10825592 | Ga0207661_108255922 | 116 |
| 237 | 3300025945 | Ga0207679_10033419 | Ga0207679_100334195 | 116 |
| 238 | 3300025960 | Ga0207651_10152687 | Ga0207651_101526873 | 116 |
| 239 | 3300025986 | Ga0207658_10002775 | Ga0207658_1000277512 | 116 |
| 240 | 3300025986 | Ga0207658_10956369 | Ga0207658_109563692 | 116 |
| 241 | 3300026023 | Ga0207677_10317192 | Ga0207677_103171922 | 116 |
| 242 | 3300026035 | Ga0207703_10019353 | Ga0207703_100193532 | 116 |
| 243 | 3300026035 | Ga0207703_10683481 | Ga0207703_106834812 | 116 |
| 244 | 3300026067 | Ga0207678_10054546 | Ga0207678_100545463 | 116 |
| 245 | 3300026078 | Ga0207702_10009626 | Ga0207702_1000962610 | 116 |
| 246 | 3300026089 | Ga0207648_10004273 | Ga0207648_1000427316 | 116 |
| 247 | 3300026095 | Ga0207676_10008850 | Ga0207676_100088501 | 116 |
| 248 | 3300026095 | Ga0207676_10123301 | Ga0207676_101233012 | 116 |
| 249 | 3300026095 | Ga0207676_10382048 | Ga0207676_103820482 | 116 |
| 250 | 3300028379 | Ga0268266_10212042 | Ga0268266_102120423 | 116 |
| 251 | 3300028381 | Ga0268264_10002845 | Ga0268264_100028456 | 116 |
| 252 | 3300028381 | Ga0268264_11333968 | Ga0268264_113339682 | 116 |
| 253 | 3300032002 | Ga0307416_100611957 | Ga0307416_1006119572 | 116 |
| 254 | 3300034816 | Ga0373930_0043987 | Ga0373930_0043987_555_914 | 116 |
| 255 | 3300034818 | Ga0373950_0098419 | Ga0373950_0098419_19_378 | 116 |
| 256 | 3300035112 | Ga0373932_0141667 | Ga0373932_0141667_62_421 | 116 |
| 257 | 3300035113 | Ga0373936_0017646 | Ga0373936_0017646_1407_1769 | 116 |
| 258 | 3300039437 | Ga0436365_0556663 | Ga0436365_0556663_444_842 | 116 |
| 259 | 3300044712 | Ga0453684_0424768 | Ga0453684_0424768_79_444 | 116 |
| 260 | 3300046455 | Ga0495603_0091180 | Ga0495603_0091180_1316_1690 | 116 |
| 261 | 3300046475 | Ga0495639_0526260 | Ga0495639_0526260_120_485 | 116 |
| 262 | 3300046517 | Ga0495630_0904301 | Ga0495630_0904301_58_453 | 116 |
| 263 | 3300046543 | Ga0495645_0006813 | Ga0495645_0006813_3326_3721 | 116 |
| 264 | 3300046674 | Ga0495588_0424333 | Ga0495588_0424333_98_472 | 116 |
| 265 | 3300046678 | Ga0495599_0130735 | Ga0495599_0130735_683_1078 | 116 |
| 266 | 3300048907 | Ga0496104_0020466 | Ga0496104_0020466_1765_2124 | 116 |
| 267 | 3300048911 | Ga0496108_0000432 | Ga0496108_0000432_32974_33333 | 116 |
| 268 | 3300048912 | Ga0496109_0000770 | Ga0496109_0000770_15417_15776 | 116 |
| 269 | 3300048913 | Ga0496110_0005270 | Ga0496110_0005270_2287_2646 | 116 |
| 270 | 3300048914 | Ga0496111_0112845 | Ga0496111_0112845_1622_1981 | 116 |
| 271 | 3300048915 | Ga0496112_0000221 | Ga0496112_0000221_11028_11387 | 116 |
| 272 | 3300048916 | Ga0496113_0000493 | Ga0496113_0000493_17807_18166 | 116 |
| 273 | 3300048916 | Ga0496113_1046373 | Ga0496113_1046373_14_385 | 116 |
| 274 | 3300049593 | Ga0501077_1132175 | Ga0501077_1132175_50_436 | 116 |
| 275 | 3300050507 | nmdc:mga05p37_637268_c1 | nmdc:mga05p37_637268_c1_701_1060 | 116 |
| 276 | 3300050507 | nmdc:mga05p37_9516_c1 | nmdc:mga05p37_9516_c1_98_478 | 116 |
| 277 | 3300050515 | nmdc:mga0a205_1144660_c1 | nmdc:mga0a205_1144660_c1_229_609 | 116 |
| 278 | 3300050515 | nmdc:mga0a205_594137_c1 | nmdc:mga0a205_594137_c1_538_897 | 116 |
| 279 | 3300053077 | Ga0495601_0018893 | Ga0495601_0018893_1131_1526 | 116 |
| 280 | 3300053078 | Ga0495612_0045798 | Ga0495612_0045798_194_589 | 116 |
| 281 | 3300053092 | Ga0500583_0164109 | Ga0500583_0164109_317_688 | 116 |
| 282 | 3300053178 | Ga0500637_0002603 | Ga0500637_0002603_2390_2749 | 116 |
| 283 | 3300054114 | Ga0501084_0339894 | Ga0501084_0339894_832_1218 | 116 |
| 284 | 3300030878 | Ga0265770_1012352 | Ga0265770_10123522 | 117 |
| 285 | 3300042876 | Ga0451577_0139435 | Ga0451577_0139435_1698_2051 | 117 |
| 286 | 3300044712 | Ga0453684_0370675 | Ga0453684_0370675_170_523 | 117 |
| 287 | 3300045051 | Ga0451576_0090693 | Ga0451576_0090693_373_726 | 117 |
| 288 | 3300049572 | Ga0501036_1044326 | Ga0501036_1044326_104_466 | 117 |
| 289 | 3300005468 | Ga0070707_100475400 | Ga0070707_1004754002 | 118 |
| 290 | 3300005518 | Ga0070699_101358049 | Ga0070699_1013580492 | 118 |
| 291 | 3300005536 | Ga0070697_100048365 | Ga0070697_1000483653 | 118 |
| 292 | 3300005563 | Ga0068855_100306126 | Ga0068855_1003061261 | 118 |
| 293 | 3300006173 | Ga0070716_100262731 | Ga0070716_1002627312 | 118 |
| 294 | 3300009101 | Ga0105247_11045240 | Ga0105247_110452401 | 118 |
| 295 | 3300009545 | Ga0105237_11560845 | Ga0105237_115608451 | 118 |
| 296 | 3300013307 | Ga0157372_13484668 | Ga0157372_134846681 | 118 |
| 297 | 3300025910 | Ga0207684_10046665 | Ga0207684_100466656 | 118 |
| 298 | 3300025939 | Ga0207665_10110098 | Ga0207665_101100982 | 118 |
| 299 | 3300031711 | Ga0265314_10001851 | Ga0265314_1000185119 | 118 |
| 300 | 3300048915 | Ga0496112_0053928 | Ga0496112_0053928_1648_2004 | 118 |
| 301 | 3300049744 | Ga0501083_0380187 | Ga0501083_0380187_148_504 | 118 |
| 302 | 2162886011 | MRS1b_contig_5246994 | MRS1b_0200.00003070 | 119 |
| 303 | 3300005290 | Ga0065712_10073926 | Ga0065712_100739265 | 119 |
| 304 | 3300005339 | Ga0070660_100467962 | Ga0070660_1004679622 | 119 |
| 305 | 3300005367 | Ga0070667_100327301 | Ga0070667_1003273012 | 119 |
| 306 | 3300005435 | Ga0070714_100135116 | Ga0070714_1001351162 | 119 |
| 307 | 3300005436 | Ga0070713_100117309 | Ga0070713_1001173094 | 119 |
| 308 | 3300005441 | Ga0070700_100391755 | Ga0070700_1003917552 | 119 |
| 309 | 3300005616 | Ga0068852_101165161 | Ga0068852_1011651612 | 119 |
| 310 | 3300005844 | Ga0068862_100393347 | Ga0068862_1003933472 | 119 |
| 311 | 3300006028 | Ga0070717_10666948 | Ga0070717_106669482 | 119 |
| 312 | 3300009177 | Ga0105248_10158693 | Ga0105248_101586932 | 119 |
| 313 | 3300009553 | Ga0105249_10043099 | Ga0105249_100430996 | 119 |
| 314 | 3300025923 | Ga0207681_11074802 | Ga0207681_110748021 | 119 |
| 315 | 3300025941 | Ga0207711_10377804 | Ga0207711_103778043 | 119 |
| 316 | 3300026041 | Ga0207639_10016890 | Ga0207639_100168905 | 119 |
| 317 | 3300026118 | Ga0207675_101056386 | Ga0207675_1010563862 | 119 |
| 318 | 3300028380 | Ga0268265_10371958 | Ga0268265_103719582 | 119 |
| 319 | 3300028577 | Ga0265318_10021401 | Ga0265318_100214013 | 119 |
| 320 | 3300031090 | Ga0265760_10002959 | Ga0265760_100029592 | 119 |
| 321 | 3300031235 | Ga0265330_10205496 | Ga0265330_102054962 | 119 |
| 322 | 3300031241 | Ga0265325_10031182 | Ga0265325_100311824 | 119 |
| 323 | 3300031344 | Ga0265316_10950382 | Ga0265316_109503821 | 119 |
| 324 | 3300031852 | Ga0307410_11062791 | Ga0307410_110627911 | 119 |
| 325 | 3300036401 | Ga0373937_1599141 | Ga0373937_1599141_75_437 | 119 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.953 | 1 | 111 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.8839 | 1 | 111 |
| 1mwq-assembly1.cif.gz_A | structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine | 0.7502 | 1 | 112 |
| 1mwq-assembly1.cif.gz_A | structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine | 0.7234 | 1 | 112 |
| 4lbp-assembly1.cif.gz_A | 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone | 0.7106 | 1 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.953 | 1 | 111 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.8839 | 1 | 111 | 3.30.70.1060 |
| af_P0AB55_1_98_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7399 | 1 | 112 | 3.30.70.1060 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7374 | 1 | 116 | 3.30.70.1060 |
| af_P0AB55_1_98_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7266 | 1 | 112 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A432MIB2-F1-model_v4 | YciI family protein | 1.002 | 1 | 115 |
|
| AF-A0A2T1D8K4-F1-model_v4 | YciI family protein | 0.9994 | 1 | 116 |
|
| AF-A0A3A0D6U6-F1-model_v4 | YCII-related domain-containing protein | 0.9992 | 1 | 116 |
|
| AF-A0A3S1AJQ6-F1-model_v4 | YCII-related domain-containing protein | 0.9984 | 1 | 116 |
|
| AF-A0A812N0Z2-F1-model_v4 | YCII-related domain-containing protein | 0.9931 | 1 | 112 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar