F407683

General Info

Members Datasets Scaffolds Average Seq Length
325 187 650 158

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100542849|Ga0070668_1005428491
Length 180
Sequence VGHRPRPRRLGHDAAGGFLTLPRTPSQTVGPFYSIGLSRDPQNELADPRDPAAVRLIGVLVDGQGAPIPDGMVELWDPVGRRWGRSGTDSEGRFSFVVTKPEPLPGEAPRFDALVFARGLLKHELTRVYFPDETEANAADPVWSALDEESRATLVAEAENGALRFDIRMQGDRHSVFFAH

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
81 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
82 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 20
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100542849 3300005347 Bacteria 1011
2 Ga0070683_100058183 3300005329 Bacteria 3592
3 Ga0070683_100631111 3300005329 Bacteria 1026
4 Ga0070690_100342008 3300005330 Bacteria 1084
5 Ga0070690_100761194 3300005330 Unclassified 748
6 Ga0070670_100545019 3300005331 Bacteria 1035
7 Ga0068869_100192163 3300005334 Bacteria 1606
8 Ga0070682_100051486 3300005337 Bacteria 2573
9 Ga0068868_101081705 3300005338 Bacteria 737
10 Ga0070660_100212447 3300005339 Bacteria 1571
11 Ga0070687_100705532 3300005343 Bacteria 705
12 Ga0070661_100075607 3300005344 Bacteria 2482
13 Ga0070692_10398458 3300005345 Bacteria 868
14 Ga0070671_101172383 3300005355 Bacteria 676
15 Ga0070709_10751379 3300005434 Unclassified 762
16 Ga0070701_10250220 3300005438 Bacteria 1070
17 Ga0070705_100165988 3300005440 Bacteria 1481
18 Ga0070678_100268913 3300005456 Bacteria 1437
19 Ga0070681_10179796 3300005458 Bacteria 2037
20 Ga0070685_10264052 3300005466 Bacteria 1146
21 Ga0070698_100077554 3300005471 Bacteria 3323
22 Ga0070679_100001190 3300005530 Bacteria 22847
23 Ga0070684_100002475 3300005535 Bacteria 13601
24 Ga0070693_100005640 3300005547 Bacteria 6035
25 Ga0070665_101159261 3300005548 Bacteria 784
26 Ga0068855_101165138 3300005563 Bacteria 803
27 Ga0070664_100075767 3300005564 Bacteria 2890
28 Ga0068857_100891131 3300005577 Bacteria 853
29 Ga0068854_100238853 3300005578 Bacteria 1446
30 Ga0068856_100100292 3300005614 Bacteria 2887
31 Ga0068856_100284190 3300005614 Bacteria 1671
32 Ga0068856_100306009 3300005614 Bacteria 1607
33 Ga0068856_100876047 3300005614 Bacteria 917
34 Ga0068861_100468785 3300005719 Bacteria 1132
35 Ga0068870_10421504 3300005840 Bacteria 873
36 Ga0081539_10016802 3300005985 Bacteria 5193
37 Ga0070712_100693002 3300006175 Bacteria 868
38 Ga0097621_100279261 3300006237 Bacteria 1470
39 Ga0068871_100243984 3300006358 Bacteria 1563
40 Ga0075431_100750616 3300006847 Bacteria 951
41 Ga0075433_10441049 3300006852 Bacteria 1148
42 Ga0075433_10719031 3300006852 Bacteria 874
43 Ga0075434_100379267 3300006871 Bacteria 1435
44 Ga0075434_100409519 3300006871 Bacteria 1377
45 Ga0075434_100780855 3300006871 Bacteria 972
46 Ga0068865_100257183 3300006881 Bacteria 1381
47 Ga0075435_101065783 3300007076 Bacteria 706
48 Ga0075435_101233697 3300007076 Unclassified 654
49 Ga0105240_10598056 3300009093 Bacteria 1215
50 Ga0111539_11034960 3300009094 Bacteria 954
51 Ga0105245_10002157 3300009098 Bacteria 17822
52 Ga0105245_10190642 3300009098 Bacteria 1963
53 Ga0105245_10355470 3300009098 Bacteria 1453
54 Ga0114129_10020160 3300009147 Bacteria 9490
55 Ga0105243_10215021 3300009148 Bacteria 1695
56 Ga0105241_10246741 3300009174 Bacteria 1512
57 Ga0105242_10159489 3300009176 Bacteria 1973
58 Ga0105242_10588752 3300009176 Bacteria 1073
59 Ga0105248_10378161 3300009177 Bacteria 1594
60 Ga0105248_11190138 3300009177 Bacteria 862
61 Ga0105239_10215966 3300010375 Bacteria 2150
62 Ga0157369_11927267 3300013105 Bacteria 600
63 Ga0157374_10611360 3300013296 Bacteria 1100
64 Ga0163162_12223042 3300013306 Bacteria 630
65 Ga0157375_10357455 3300013308 Bacteria 1627
66 Ga0163163_10385961 3300014325 Bacteria 1458
67 Ga0163163_11905043 3300014325 Unclassified 654
68 Ga0157377_10177295 3300014745 Unclassified 1337
69 Ga0157379_10535925 3300014968 Bacteria 1088
70 Ga0207688_10127788 3300025901 Bacteria 1488
71 Ga0207643_10195698 3300025908 Bacteria 1229
72 Ga0207707_10016692 3300025912 Bacteria 6401
73 Ga0207695_10739831 3300025913 Bacteria 864
74 Ga0207660_10046065 3300025917 Bacteria 3076
75 Ga0207649_10028105 3300025920 Bacteria 3309
76 Ga0207652_10006583 3300025921 Bacteria 9365
77 Ga0207687_10002663 3300025927 Bacteria 12086
78 Ga0207686_10122999 3300025934 Bacteria 1769
79 Ga0207686_10593626 3300025934 Bacteria 871
80 Ga0207709_10037015 3300025935 Bacteria 2897
81 Ga0207665_10796358 3300025939 Bacteria 747
82 Ga0207711_10584387 3300025941 Bacteria 1042
83 Ga0207689_10042142 3300025942 Bacteria 3778
84 Ga0207661_10113137 3300025944 Bacteria 2299
85 Ga0207661_10199878 3300025944 Bacteria 1757
86 Ga0207661_11169768 3300025944 Bacteria 708
87 Ga0207679_10048434 3300025945 Bacteria 3094
88 Ga0207640_10310765 3300025981 Bacteria 1251
89 Ga0207702_10035262 3300026078 Bacteria 4183
90 Ga0207702_10036928 3300026078 Bacteria 4087
91 Ga0207702_10304090 3300026078 Bacteria 1514
92 Ga0207648_10605733 3300026089 Bacteria 1010
93 Ga0207674_10858230 3300026116 Bacteria 875
94 Ga0207675_101401190 3300026118 Bacteria 720
95 Ga0207683_10266081 3300026121 Bacteria 1566
96 Ga0207698_10523291 3300026142 Bacteria 1158
97 Ga0265326_10008632 3300028558 Bacteria 3066
98 Ga0265334_10008388 3300028573 Bacteria 4395
99 Ga0265318_10000362 3300028577 Bacteria 35865
100 Ga0265318_10062326 3300028577 Bacteria 1388
101 Ga0265323_10070559 3300028653 Bacteria 1195
102 Ga0265322_10028580 3300028654 Bacteria 1592
103 Ga0265336_10022798 3300028666 Bacteria 1991
104 Ga0265338_10013617 3300028800 Bacteria 9158
105 Ga0265324_10030442 3300029957 Bacteria 1894
106 Ga0265332_10005163 3300031238 Bacteria 6044
107 Ga0265332_10136423 3300031238 Bacteria 1028
108 Ga0265328_10010407 3300031239 Bacteria 3746
109 Ga0265320_10020805 3300031240 Bacteria 3545
110 Ga0265320_10150222 3300031240 Bacteria 1052
111 Ga0265325_10000713 3300031241 Bacteria 24024
112 Ga0265325_10260033 3300031241 Bacteria 784
113 Ga0265329_10006004 3300031242 Bacteria 4858
114 Ga0265340_10007454 3300031247 Bacteria 5940
115 Ga0265339_10035447 3300031249 Bacteria 2799
116 Ga0265339_10184747 3300031249 Bacteria 1036
117 Ga0265331_10018941 3300031250 Bacteria 3558
118 Ga0265331_10082609 3300031250 Bacteria 1490
119 Ga0265331_10309919 3300031250 Bacteria 707
120 Ga0265327_10011962 3300031251 Bacteria 5913
121 Ga0265327_10097893 3300031251 Bacteria 1420
122 Ga0307408_100100732 3300031548 Bacteria 2201
123 Ga0265313_10007862 3300031595 Bacteria 7191
124 Ga0265314_10024228 3300031711 Bacteria 4604
125 Ga0265314_10113233 3300031711 Bacteria 1720
126 Ga0265342_10091348 3300031712 Bacteria 1745
127 Ga0307412_10070138 3300031911 Bacteria 2388
128 Ga0307409_100507264 3300031995 Bacteria 1176
129 Ga0307416_100033851 3300032002 Bacteria 3880
130 Ga0373946_0060090 3300035171 Bacteria 1615
131 Ga0373935_0095433 3300035692 Bacteria 1953
132 Ga0373927_0466050 3300035695 Bacteria 835
133 Ga0373947_0549830 3300035725 Bacteria 786
134 Ga0373925_0077617 3300037068 Bacteria 2521
135 Ga0395899_0004454 3300037312 Bacteria 10925
136 Ga0395899_0020327 3300037312 Bacteria 5036
137 Ga0395899_0031666 3300037312 Bacteria 3974
138 Ga0395899_0039199 3300037312 Bacteria 3548
139 Ga0395899_0065673 3300037312 Bacteria 2666
140 Ga0395899_0764291 3300037312 Bacteria 600
141 Ga0395900_0023536 3300037418 Bacteria 6302
142 Ga0395900_0107136 3300037418 Bacteria 2871
143 Ga0395900_0308779 3300037418 Bacteria 1565
144 Ga0395898_0004319 3300037466 Bacteria 15574
145 Ga0395898_0007120 3300037466 Bacteria 11877
146 Ga0395898_0010307 3300037466 Bacteria 9780
147 Ga0395898_0086613 3300037466 Bacteria 3018
148 Ga0395898_0121816 3300037466 Bacteria 2499
149 Ga0395898_0206266 3300037466 Bacteria 1875
150 Ga0395898_0827600 3300037466 Unclassified 865
151 Ga0395898_1615014 3300037466 Bacteria 572
152 Ga0395905_0008674 3300037471 Bacteria 10011
153 Ga0395905_0105912 3300037471 Bacteria 2640
154 Ga0395905_0349873 3300037471 Bacteria 1369
155 Ga0395905_0425476 3300037471 Bacteria 1224
156 Ga0395901_0008010 3300038443 Bacteria 10669
157 Ga0395901_0024752 3300038443 Bacteria 6163
158 Ga0395901_0086472 3300038443 Bacteria 3278
159 Ga0395901_0095126 3300038443 Bacteria 3121
160 Ga0395901_0118790 3300038443 Bacteria 2778
161 Ga0395901_0137510 3300038443 Bacteria 2567
162 Ga0395901_0180113 3300038443 Bacteria 2216
163 Ga0395901_0200316 3300038443 Bacteria 2093
164 Ga0395901_0260509 3300038443 Bacteria 1805
165 Ga0395901_0403939 3300038443 Bacteria 1403
166 Ga0395901_0673003 3300038443 Bacteria 1035
167 Ga0466966_0794321 3300044684 Bacteria 571
168 Ga0466964_0033947 3300044706 Bacteria 2034
169 Ga0466957_0288132 3300044842 Bacteria 1101
170 Ga0466967_0020137 3300045976 Bacteria 5383
171 Ga0466967_0021807 3300045976 Bacteria 5212
172 Ga0466967_0128681 3300045976 Bacteria 2348
173 Ga0466967_0374408 3300045976 Bacteria 1382
174 Ga0466967_1215528 3300045976 Bacteria 751
175 Ga0495603_0524613 3300046455 Bacteria 678
176 Ga0495629_0009759 3300046459 Bacteria 7006
177 Ga0495651_0167292 3300046462 Bacteria 1569
178 Ga0495653_0069422 3300046463 Bacteria 2640
179 Ga0495582_0038983 3300046473 Bacteria 2616
180 Ga0495605_0050017 3300046474 Bacteria 2040
181 Ga0495639_0165747 3300046475 Bacteria 1071
182 Ga0495662_0162385 3300046476 Bacteria 1101
183 Ga0495594_0425258 3300046499 Bacteria 755
184 Ga0495608_0280360 3300046511 Bacteria 1035
185 Ga0495628_0234728 3300046516 Bacteria 1373
186 Ga0495630_0097972 3300046517 Bacteria 2218
187 Ga0495630_0242130 3300046517 Bacteria 1378
188 Ga0495630_0914626 3300046517 Bacteria 668
189 Ga0495652_0066512 3300046529 Bacteria 3024
190 Ga0495587_0023929 3300046536 Bacteria 3748
191 Ga0495667_0024305 3300046559 Bacteria 4080
192 Ga0495656_0045081 3300046615 Bacteria 1860
193 Ga0495634_0057313 3300046642 Bacteria 2601
194 Ga0495634_0068513 3300046642 Bacteria 2344
195 Ga0495635_0025858 3300046663 Bacteria 4088
196 Ga0495657_0143337 3300046675 Bacteria 1488
197 Ga0495599_0021565 3300046678 Bacteria 4020
198 Ga0495658_0034442 3300046683 Bacteria 2779
199 Ga0495658_0233063 3300046683 Bacteria 1155
200 Ga0495613_0109990 3300046689 Bacteria 1986
201 Ga0495670_0628983 3300046691 Unclassified 585
202 Ga0495600_0166067 3300046809 Bacteria 1426
203 Ga0495604_0352467 3300047317 Bacteria 978
204 Ga0495674_0238946 3300047319 Bacteria 1497
205 Ga0495674_0439003 3300047319 Bacteria 1050
206 Ga0495676_0073250 3300047321 Bacteria 2627
207 Ga0495676_0126237 3300047321 Bacteria 1854
208 Ga0495680_0088040 3300047322 Bacteria 2334
209 Ga0495680_0289264 3300047322 Bacteria 1153
210 Ga0495685_119913 3300047447 Bacteria 864
211 Ga0495684_0171067 3300047471 Bacteria 1616
212 Ga0495684_0210103 3300047471 Bacteria 1432
213 Ga0495602_0095045 3300048088 Bacteria 2461
214 Ga0496100_0008606 3300048903 Bacteria 5697
215 Ga0496100_0030033 3300048903 Bacteria 3367
216 Ga0496100_0391466 3300048903 Bacteria 1057
217 Ga0496101_0007646 3300048904 Bacteria 7016
218 Ga0496101_0194739 3300048904 Bacteria 1565
219 Ga0496101_0214123 3300048904 Bacteria 1493
220 Ga0496102_0070785 3300048905 Bacteria 3202
221 Ga0496102_0223175 3300048905 Bacteria 1777
222 Ga0496102_0296242 3300048905 Bacteria 1525
223 Ga0496102_1662251 3300048905 Unclassified 556
224 Ga0496103_0087023 3300048906 Bacteria 1969
225 Ga0496104_0016128 3300048907 Bacteria 6781
226 Ga0496104_0107730 3300048907 Bacteria 2670
227 Ga0496104_0130428 3300048907 Bacteria 2414
228 Ga0496104_0194690 3300048907 Bacteria 1939
229 Ga0496104_0392859 3300048907 Bacteria 1299
230 Ga0496104_1030133 3300048907 Bacteria 727
231 Ga0496105_0071909 3300048908 Bacteria 2859
232 Ga0496105_0102575 3300048908 Bacteria 2362
233 Ga0496105_0103560 3300048908 Bacteria 2350
234 Ga0496105_0354644 3300048908 Bacteria 1171
235 Ga0496105_0372502 3300048908 Bacteria 1137
236 Ga0496106_0062279 3300048909 Bacteria 2832
237 Ga0496106_0125331 3300048909 Bacteria 2010
238 Ga0496106_0177669 3300048909 Bacteria 1689
239 Ga0496106_0520480 3300048909 Bacteria 955
240 Ga0496107_0004029 3300048910 Bacteria 9897
241 Ga0496107_0012632 3300048910 Bacteria 5897
242 Ga0496107_0064746 3300048910 Bacteria 2650
243 Ga0496107_0066558 3300048910 Bacteria 2612
244 Ga0496108_0015244 3300048911 Bacteria 6272
245 Ga0496108_0094156 3300048911 Bacteria 2549
246 Ga0496108_0234714 3300048911 Bacteria 1595
247 Ga0496108_0537197 3300048911 Bacteria 1020
248 Ga0496109_0003941 3300048912 Bacteria 12400
249 Ga0496109_0058016 3300048912 Bacteria 3535
250 Ga0496109_0132976 3300048912 Bacteria 2323
251 Ga0496109_0514416 3300048912 Bacteria 1130
252 Ga0496109_0683486 3300048912 Bacteria 964
253 Ga0496109_1327097 3300048912 Unclassified 655
254 Ga0496110_0000093 3300048913 Bacteria 48032
255 Ga0496110_0009989 3300048913 Bacteria 7699
256 Ga0496110_0243662 3300048913 Bacteria 1636
257 Ga0496110_0470640 3300048913 Bacteria 1145
258 Ga0496110_1271898 3300048913 Unclassified 645
259 Ga0496111_0000166 3300048914 Bacteria 29882
260 Ga0496111_0005371 3300048914 Bacteria 8196
261 Ga0496111_0008226 3300048914 Bacteria 6896
262 Ga0496111_0182069 3300048914 Bacteria 1562
263 Ga0496112_0021739 3300048915 Bacteria 6104
264 Ga0496112_0229671 3300048915 Bacteria 1810
265 Ga0496112_0280750 3300048915 Bacteria 1613
266 Ga0496112_0395379 3300048915 Bacteria 1322
267 Ga0496112_0551454 3300048915 Unclassified 1086
268 Ga0496112_0876594 3300048915 Bacteria 820
269 Ga0496112_1040640 3300048915 Bacteria 738
270 Ga0496113_0097618 3300048916 Bacteria 2273
271 Ga0496113_0209079 3300048916 Bacteria 1553
272 Ga0496113_0330943 3300048916 Bacteria 1221
273 Ga0496114_0024913 3300048917 Bacteria 4885
274 Ga0496114_0039125 3300048917 Bacteria 3924
275 Ga0496114_0064472 3300048917 Bacteria 3068
276 Ga0496114_0909842 3300048917 Bacteria 761
277 Ga0496114_1431859 3300048917 Unclassified 578
278 Ga0496115_0708488 3300048918 Bacteria 791
279 Ga0501033_0302455 3300049570 Bacteria 1126
280 Ga0501040_0166792 3300049576 Bacteria 1558
281 Ga0501047_0024150 3300049581 Bacteria 5839
282 Ga0501047_0058802 3300049581 Bacteria 3713
283 Ga0501047_0087860 3300049581 Bacteria 2986
284 Ga0501047_0167862 3300049581 Bacteria 2065
285 Ga0501047_0245043 3300049581 Bacteria 1642
286 Ga0501068_0114875 3300049584 Bacteria 1676
287 Ga0501069_0077708 3300049585 Bacteria 1866
288 Ga0501069_0778716 3300049585 Bacteria 579
289 Ga0501070_0000619 3300049586 Bacteria 32593
290 Ga0501070_0006452 3300049586 Bacteria 9988
291 Ga0501070_0051309 3300049586 Bacteria 3425
292 Ga0501070_0185277 3300049586 Bacteria 1712
293 Ga0501072_0266944 3300049588 Bacteria 1362
294 Ga0501073_0019088 3300049589 Bacteria 4954
295 Ga0501073_0154601 3300049589 Bacteria 1590
296 Ga0501073_0449430 3300049589 Bacteria 891
297 Ga0501074_0061716 3300049590 Bacteria 2700
298 Ga0501074_0445390 3300049590 Bacteria 918
299 Ga0501075_0222080 3300049591 Bacteria 1441
300 Ga0501079_0028442 3300049741 Bacteria 4290
301 Ga0501080_0043995 3300049742 Bacteria 4157
302 Ga0501080_0243095 3300049742 Bacteria 1642
303 Ga0501080_0340467 3300049742 Bacteria 1355
304 Ga0501080_0380374 3300049742 Bacteria 1272
305 Ga0501080_0909119 3300049742 Bacteria 767
306 Ga0501080_1297770 3300049742 Bacteria 623
307 Ga0501081_0018742 3300049743 Bacteria 4597
308 Ga0501035_0418298 3300049822 Bacteria 1113
309 Ga0501035_0855570 3300049822 Bacteria 723
310 Ga0501045_0517052 3300049824 Bacteria 886
311 nmdc:mga05p37_73364_c1 3300050507 Bacteria 4212
312 nmdc:mga06r32_418636_c1 3300050510 Bacteria 1321
313 nmdc:mga08y16_591265_c1 3300050511 Bacteria 1119
314 nmdc:mga0n895_210791_c1 3300050512 Bacteria 1973
315 nmdc:mga0n895_451388_c1 3300050512 Bacteria 1298
316 nmdc:mga0n895_483698_c1 3300050512 Bacteria 1248
317 nmdc:mga0rr50_1044519_c1 3300050513 Unclassified 696
318 nmdc:mga0a205_673278_c1 3300050515 Bacteria 885
319 nmdc:mga0a205_939974_c1 3300050515 Bacteria 711
320 Ga0495601_0178842 3300053077 Unclassified 1387
321 Ga0495619_0017653 3300053085 Bacteria 4520
322 Ga0495619_0155870 3300053085 Bacteria 1576
323 Ga0495619_0224502 3300053085 Bacteria 1301
324 Ga0501084_0083258 3300054114 Bacteria 2685
325 Ga0501082_0059946 3300060353 Bacteria 3279
326 Ga0070668_100542849
327 Ga0070683_100058183
328 Ga0070683_100631111
329 Ga0070690_100342008
330 Ga0070690_100761194
331 Ga0070670_100545019
332 Ga0068869_100192163
333 Ga0070682_100051486
334 Ga0068868_101081705
335 Ga0070660_100212447
336 Ga0070687_100705532
337 Ga0070661_100075607
338 Ga0070692_10398458
339 Ga0070671_101172383
340 Ga0070709_10751379
341 Ga0070701_10250220
342 Ga0070705_100165988
343 Ga0070678_100268913
344 Ga0070681_10179796
345 Ga0070685_10264052
346 Ga0070698_100077554
347 Ga0070679_100001190
348 Ga0070684_100002475
349 Ga0070693_100005640
350 Ga0070665_101159261
351 Ga0068855_101165138
352 Ga0070664_100075767
353 Ga0068857_100891131
354 Ga0068854_100238853
355 Ga0068856_100100292
356 Ga0068856_100284190
357 Ga0068856_100306009
358 Ga0068856_100876047
359 Ga0068861_100468785
360 Ga0068870_10421504
361 Ga0081539_10016802
362 Ga0070712_100693002
363 Ga0097621_100279261
364 Ga0068871_100243984
365 Ga0075431_100750616
366 Ga0075433_10441049
367 Ga0075433_10719031
368 Ga0075434_100379267
369 Ga0075434_100409519
370 Ga0075434_100780855
371 Ga0068865_100257183
372 Ga0075435_101065783
373 Ga0075435_101233697
374 Ga0105240_10598056
375 Ga0111539_11034960
376 Ga0105245_10002157
377 Ga0105245_10190642
378 Ga0105245_10355470
379 Ga0114129_10020160
380 Ga0105243_10215021
381 Ga0105241_10246741
382 Ga0105242_10159489
383 Ga0105242_10588752
384 Ga0105248_10378161
385 Ga0105248_11190138
386 Ga0105239_10215966
387 Ga0157369_11927267
388 Ga0157374_10611360
389 Ga0163162_12223042
390 Ga0157375_10357455
391 Ga0163163_10385961
392 Ga0163163_11905043
393 Ga0157377_10177295
394 Ga0157379_10535925
395 Ga0207688_10127788
396 Ga0207643_10195698
397 Ga0207707_10016692
398 Ga0207695_10739831
399 Ga0207660_10046065
400 Ga0207649_10028105
401 Ga0207652_10006583
402 Ga0207687_10002663
403 Ga0207686_10122999
404 Ga0207686_10593626
405 Ga0207709_10037015
406 Ga0207665_10796358
407 Ga0207711_10584387
408 Ga0207689_10042142
409 Ga0207661_10113137
410 Ga0207661_10199878
411 Ga0207661_11169768
412 Ga0207679_10048434
413 Ga0207640_10310765
414 Ga0207702_10035262
415 Ga0207702_10036928
416 Ga0207702_10304090
417 Ga0207648_10605733
418 Ga0207674_10858230
419 Ga0207675_101401190
420 Ga0207683_10266081
421 Ga0207698_10523291
422 Ga0265326_10008632
423 Ga0265334_10008388
424 Ga0265318_10000362
425 Ga0265318_10062326
426 Ga0265323_10070559
427 Ga0265322_10028580
428 Ga0265336_10022798
429 Ga0265338_10013617
430 Ga0265324_10030442
431 Ga0265332_10005163
432 Ga0265332_10136423
433 Ga0265328_10010407
434 Ga0265320_10020805
435 Ga0265320_10150222
436 Ga0265325_10000713
437 Ga0265325_10260033
438 Ga0265329_10006004
439 Ga0265340_10007454
440 Ga0265339_10035447
441 Ga0265339_10184747
442 Ga0265331_10018941
443 Ga0265331_10082609
444 Ga0265331_10309919
445 Ga0265327_10011962
446 Ga0265327_10097893
447 Ga0307408_100100732
448 Ga0265313_10007862
449 Ga0265314_10024228
450 Ga0265314_10113233
451 Ga0265342_10091348
452 Ga0307412_10070138
453 Ga0307409_100507264
454 Ga0307416_100033851
455 Ga0373946_0060090
456 Ga0373935_0095433
457 Ga0373927_0466050
458 Ga0373947_0549830
459 Ga0373925_0077617
460 Ga0395899_0004454
461 Ga0395899_0020327
462 Ga0395899_0031666
463 Ga0395899_0039199
464 Ga0395899_0065673
465 Ga0395899_0764291
466 Ga0395900_0023536
467 Ga0395900_0107136
468 Ga0395900_0308779
469 Ga0395898_0004319
470 Ga0395898_0007120
471 Ga0395898_0010307
472 Ga0395898_0086613
473 Ga0395898_0121816
474 Ga0395898_0206266
475 Ga0395898_0827600
476 Ga0395898_1615014
477 Ga0395905_0008674
478 Ga0395905_0105912
479 Ga0395905_0349873
480 Ga0395905_0425476
481 Ga0395901_0008010
482 Ga0395901_0024752
483 Ga0395901_0086472
484 Ga0395901_0095126
485 Ga0395901_0118790
486 Ga0395901_0137510
487 Ga0395901_0180113
488 Ga0395901_0200316
489 Ga0395901_0260509
490 Ga0395901_0403939
491 Ga0395901_0673003
492 Ga0466966_0794321
493 Ga0466964_0033947
494 Ga0466957_0288132
495 Ga0466967_0020137
496 Ga0466967_0021807
497 Ga0466967_0128681
498 Ga0466967_0374408
499 Ga0466967_1215528
500 Ga0495603_0524613
501 Ga0495629_0009759
502 Ga0495651_0167292
503 Ga0495653_0069422
504 Ga0495582_0038983
505 Ga0495605_0050017
506 Ga0495639_0165747
507 Ga0495662_0162385
508 Ga0495594_0425258
509 Ga0495608_0280360
510 Ga0495628_0234728
511 Ga0495630_0097972
512 Ga0495630_0242130
513 Ga0495630_0914626
514 Ga0495652_0066512
515 Ga0495587_0023929
516 Ga0495667_0024305
517 Ga0495656_0045081
518 Ga0495634_0057313
519 Ga0495634_0068513
520 Ga0495635_0025858
521 Ga0495657_0143337
522 Ga0495599_0021565
523 Ga0495658_0034442
524 Ga0495658_0233063
525 Ga0495613_0109990
526 Ga0495670_0628983
527 Ga0495600_0166067
528 Ga0495604_0352467
529 Ga0495674_0238946
530 Ga0495674_0439003
531 Ga0495676_0073250
532 Ga0495676_0126237
533 Ga0495680_0088040
534 Ga0495680_0289264
535 Ga0495685_119913
536 Ga0495684_0171067
537 Ga0495684_0210103
538 Ga0495602_0095045
539 Ga0496100_0008606
540 Ga0496100_0030033
541 Ga0496100_0391466
542 Ga0496101_0007646
543 Ga0496101_0194739
544 Ga0496101_0214123
545 Ga0496102_0070785
546 Ga0496102_0223175
547 Ga0496102_0296242
548 Ga0496102_1662251
549 Ga0496103_0087023
550 Ga0496104_0016128
551 Ga0496104_0107730
552 Ga0496104_0130428
553 Ga0496104_0194690
554 Ga0496104_0392859
555 Ga0496104_1030133
556 Ga0496105_0071909
557 Ga0496105_0102575
558 Ga0496105_0103560
559 Ga0496105_0354644
560 Ga0496105_0372502
561 Ga0496106_0062279
562 Ga0496106_0125331
563 Ga0496106_0177669
564 Ga0496106_0520480
565 Ga0496107_0004029
566 Ga0496107_0012632
567 Ga0496107_0064746
568 Ga0496107_0066558
569 Ga0496108_0015244
570 Ga0496108_0094156
571 Ga0496108_0234714
572 Ga0496108_0537197
573 Ga0496109_0003941
574 Ga0496109_0058016
575 Ga0496109_0132976
576 Ga0496109_0514416
577 Ga0496109_0683486
578 Ga0496109_1327097
579 Ga0496110_0000093
580 Ga0496110_0009989
581 Ga0496110_0243662
582 Ga0496110_0470640
583 Ga0496110_1271898
584 Ga0496111_0000166
585 Ga0496111_0005371
586 Ga0496111_0008226
587 Ga0496111_0182069
588 Ga0496112_0021739
589 Ga0496112_0229671
590 Ga0496112_0280750
591 Ga0496112_0395379
592 Ga0496112_0551454
593 Ga0496112_0876594
594 Ga0496112_1040640
595 Ga0496113_0097618
596 Ga0496113_0209079
597 Ga0496113_0330943
598 Ga0496114_0024913
599 Ga0496114_0039125
600 Ga0496114_0064472
601 Ga0496114_0909842
602 Ga0496114_1431859
603 Ga0496115_0708488
604 Ga0501033_0302455
605 Ga0501040_0166792
606 Ga0501047_0024150
607 Ga0501047_0058802
608 Ga0501047_0087860
609 Ga0501047_0167862
610 Ga0501047_0245043
611 Ga0501068_0114875
612 Ga0501069_0077708
613 Ga0501069_0778716
614 Ga0501070_0000619
615 Ga0501070_0006452
616 Ga0501070_0051309
617 Ga0501070_0185277
618 Ga0501072_0266944
619 Ga0501073_0019088
620 Ga0501073_0154601
621 Ga0501073_0449430
622 Ga0501074_0061716
623 Ga0501074_0445390
624 Ga0501075_0222080
625 Ga0501079_0028442
626 Ga0501080_0043995
627 Ga0501080_0243095
628 Ga0501080_0340467
629 Ga0501080_0380374
630 Ga0501080_0909119
631 Ga0501080_1297770
632 Ga0501081_0018742
633 Ga0501035_0418298
634 Ga0501035_0855570
635 Ga0501045_0517052
636 nmdc:mga05p37_73364_c1
637 nmdc:mga06r32_418636_c1
638 nmdc:mga08y16_591265_c1
639 nmdc:mga0n895_210791_c1
640 nmdc:mga0n895_451388_c1
641 nmdc:mga0n895_483698_c1
642 nmdc:mga0rr50_1044519_c1
643 nmdc:mga0a205_673278_c1
644 nmdc:mga0a205_939974_c1
645 Ga0495601_0178842
646 Ga0495619_0017653
647 Ga0495619_0155870
648 Ga0495619_0224502
649 Ga0501084_0083258
650 Ga0501082_0059946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eo9-assembly1.cif.gz_A crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 0.8771 19 162
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.7858 34 114
2bum-assembly1.cif.gz_A crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 0.7823 2 162
1eo9-assembly1.cif.gz_A crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 0.78 19 162
3lkt-assembly1.cif.gz_A tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis 0.7784 1 162
ID Description Score Start End Superfamily
af_B7Z0Z5_381_464_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8163 38 150 2.60.40.1120
1ti2B03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7842 34 114 2.60.40.10
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7754 1 162 2.60.130.10
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7709 1 162 2.60.130.10
af_P76578_289_383_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7635 47 108 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A0Q4H2L1-F1-model_v4 Intradiol ring-cleavage dioxygenases domain-containing protein 0.9456 24 162 GO:0008199
GO:0009056
GO:0018578
AF-A0A6I5GJL7-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit alpha (EC 1.13.11.3) 0.9395 39 162 GO:0005506
GO:0009056
GO:0018578
AF-A0A839EE86-F1-model_v4 Protocatechuate 3,4-dioxygenase alpha subunit (EC 1.13.11.3) 0.9386 25 162 GO:0008199
GO:0009056
GO:0018578
AF-A0A2V9K6P2-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9088 34 101 GO:0030246
AF-A0A849G1J1-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit alpha (EC 1.13.11.3) 0.8997 36 162 GO:0008199
GO:0009056
GO:0018578

Map