F407646

General Info

Members Datasets Scaffolds Average Seq Length
325 220 315 218

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10040094|Ga0055531_100400941
Length 251
Sequence MLDLPRPRKGPRLFPGYTQRPTSTFHRAGRDRMSFEISPVFSVPFAQDFLPDAAALNPQLRALILSRESEGMRYANPNPSLKQQPGVFESDFNLFAWQDACIQQLRQFCWATLGRTIRDLNGYSAEEMKQLQIFSHTWFHVTRQGGFTINHTHPMASWSGVYCVDPGTTPEDRPESGVLRFHNPHHYSNLFLDAGNARLRAPYHHGTWNIRFQAGQLVLFPSWLQHEVMPFYGDDERITIAFNCWFGMKNA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221612 Lysobacter sp. Root76 Isolate Unclassified
7 2643221695 Lysobacter sp. Root494 Isolate Unclassified
8 2643221720 Lysobacter sp. Root916 Isolate Unclassified
9 2643221727 Lysobacter sp. Root96 Isolate Unclassified
10 2643221728 Lysobacter sp. Root983 Isolate Unclassified
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
172 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
173 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
174 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
175 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
176 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
177 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
178 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
203 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
204 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
205 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
209 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
210 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
211 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
212 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
220 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.08
Nodule 0
Rhizoplane 3.38
Rhizosphere 81.23
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11054327 2162886012 Unclassified 2348
2 JGI24750J21931_1021598 3300002070 Bacteria 903
3 JGI25151J46595_10020460 3300003187 Bacteria 2789
4 rootH2_10097781 3300003320 Bacteria 3666
5 Ga0055524_1015367 3300003775 Bacteria 2794
6 Ga0055524_1025223 3300003775 Bacteria 1866
7 Ga0055536_1001866 3300003781 Bacteria 12286
8 Ga0055534_1007188 3300003784 Bacteria 2694
9 Ga0055530_10005031 3300003791 Bacteria 6505
10 Ga0055531_10015676 3300003794 Bacteria 3321
11 Ga0055531_10020582 3300003794 Bacteria 2602
12 Ga0055531_10029540 3300003794 Bacteria 1865
13 Ga0055531_10040094 3300003794 Bacteria 1379
14 Ga0055531_10044392 3300003794 Bacteria 1246
15 Ga0055531_10045758 3300003794 Bacteria 1211
16 Ga0065714_10096898 3300005288 Unclassified 1749
17 Ga0065712_10075743 3300005290 Bacteria 3795
18 Ga0065715_10098994 3300005293 Bacteria 3471
19 Ga0070676_10059239 3300005328 Bacteria 2271
20 Ga0070690_100030709 3300005330 Bacteria 3342
21 Ga0070670_100004115 3300005331 Bacteria 12156
22 Ga0070670_100050264 3300005331 Unclassified 3583
23 Ga0068869_100002081 3300005334 Bacteria 12030
24 Ga0070666_10012427 3300005335 Bacteria 5371
25 Ga0070666_10543708 3300005335 Unclassified 844
26 Ga0070680_100168911 3300005336 Unclassified 1840
27 Ga0070689_100035492 3300005340 Unclassified 3810
28 Ga0070687_100001650 3300005343 Bacteria 7982
29 Ga0070661_100139667 3300005344 Bacteria 1825
30 Ga0070661_100344550 3300005344 Bacteria 1168
31 Ga0070668_100003603 3300005347 Bacteria 11431
32 Ga0070668_100019852 3300005347 Bacteria 5063
33 Ga0070669_100059871 3300005353 Bacteria 2796
34 Ga0070675_100002911 3300005354 Bacteria 12905
35 Ga0070671_100025507 3300005355 Bacteria 4851
36 Ga0070674_100616473 3300005356 Bacteria 919
37 Ga0070673_100106443 3300005364 Unclassified 2319
38 Ga0070667_100029333 3300005367 Bacteria 4583
39 Ga0070667_100146902 3300005367 Bacteria 2068
40 Ga0070714_100000395 3300005435 Bacteria 32294
41 Ga0070714_100021904 3300005435 Bacteria 5233
42 Ga0070713_100337133 3300005436 Unclassified 1396
43 Ga0070701_10054844 3300005438 Bacteria 2080
44 Ga0070711_100098734 3300005439 Bacteria 2120
45 Ga0070705_100060546 3300005440 Unclassified 2246
46 Ga0070694_100409684 3300005444 Bacteria 1063
47 Ga0070678_100087911 3300005456 Unclassified 2374
48 Ga0070678_100467941 3300005456 Unclassified 1107
49 Ga0070662_100016467 3300005457 Bacteria 4966
50 Ga0070662_100096680 3300005457 Unclassified 2228
51 Ga0070681_10427034 3300005458 Unclassified 1237
52 Ga0068867_100070402 3300005459 Unclassified 2615
53 Ga0070685_10158780 3300005466 Bacteria 1439
54 Ga0070679_100596594 3300005530 Unclassified 1048
55 Ga0070684_100016956 3300005535 Bacteria 5969
56 Ga0068853_100079908 3300005539 Bacteria 2860
57 Ga0070672_100172746 3300005543 Unclassified 1798
58 Ga0070686_100027234 3300005544 Bacteria 3458
59 Ga0070664_100002473 3300005564 Bacteria 14879
60 Ga0068857_100512738 3300005577 Bacteria 1126
61 Ga0068854_100189152 3300005578 Unclassified 1612
62 Ga0068856_100096589 3300005614 Bacteria 2943
63 Ga0070702_100003638 3300005615 Bacteria 6935
64 Ga0068852_100515317 3300005616 Bacteria 1193
65 Ga0068859_100014440 3300005617 Bacteria 7926
66 Ga0068859_100069245 3300005617 Bacteria 3563
67 Ga0068864_100004083 3300005618 Bacteria 11988
68 Ga0068864_100175036 3300005618 Bacteria 1959
69 Ga0068866_10336312 3300005718 Bacteria 955
70 Ga0068861_100001281 3300005719 Bacteria 15707
71 Ga0068861_100045077 3300005719 Unclassified 3319
72 Ga0068870_10067969 3300005840 Unclassified 1935
73 Ga0068863_100001465 3300005841 Bacteria 23413
74 Ga0068863_100013531 3300005841 Bacteria 7871
75 Ga0068858_100019915 3300005842 Bacteria 6272
76 Ga0068858_100202038 3300005842 Bacteria 1879
77 Ga0068860_100014496 3300005843 Bacteria 7715
78 Ga0068860_100018622 3300005843 Bacteria 6754
79 Ga0068862_100000444 3300005844 Bacteria 45032
80 Ga0068862_100006783 3300005844 Bacteria 9494
81 Ga0068862_100059066 3300005844 Unclassified 3292
82 Ga0068862_101012267 3300005844 Unclassified 822
83 Ga0097621_100226265 3300006237 Bacteria 1632
84 Ga0097621_100231224 3300006237 Unclassified 1614
85 Ga0068871_100066717 3300006358 Bacteria 2950
86 Ga0068871_100306052 3300006358 Unclassified 1396
87 Ga0075428_100000877 3300006844 Bacteria 31669
88 Ga0075428_100448016 3300006844 Bacteria 1383
89 Ga0075430_100051178 3300006846 Bacteria 3481
90 Ga0075430_100097943 3300006846 Bacteria 2450
91 Ga0075431_100000544 3300006847 Bacteria 31685
92 Ga0075431_100094131 3300006847 Bacteria 3092
93 Ga0075431_100132305 3300006847 Unclassified 2573
94 Ga0075429_100020585 3300006880 Bacteria 5725
95 Ga0068865_100067756 3300006881 Unclassified 2522
96 Ga0097620_100014443 3300006931 Bacteria 7926
97 Ga0097620_100069245 3300006931 Bacteria 3563
98 Ga0111539_10007604 3300009094 Bacteria 13845
99 Ga0111539_10020533 3300009094 Bacteria 8135
100 Ga0111539_10025852 3300009094 Bacteria 7188
101 Ga0111539_10099765 3300009094 Unclassified 3410
102 Ga0105247_10150919 3300009101 Unclassified 1531
103 Ga0114129_10174006 3300009147 Unclassified 2933
104 Ga0114129_11464936 3300009147 Bacteria 840
105 Ga0105243_10020398 3300009148 Bacteria 5026
106 Ga0105248_10004291 3300009177 Bacteria 15775
107 Ga0105238_10532374 3300009551 Bacteria 1178
108 Ga0105249_10001844 3300009553 Bacteria 18422
109 Ga0105249_10009136 3300009553 Bacteria 8669
110 Ga0105239_10265502 3300010375 Bacteria 1930
111 Ga0105239_10315210 3300010375 Bacteria 1763
112 Ga0157316_1015265 3300012510 Bacteria 775
113 Ga0157374_10054875 3300013296 Unclassified 3718
114 Ga0163162_10058715 3300013306 Bacteria 3877
115 Ga0163162_10108093 3300013306 Unclassified 2877
116 Ga0163163_10002210 3300014325 Bacteria 16364
117 Ga0163163_10499037 3300014325 Bacteria 1279
118 Ga0163163_10952501 3300014325 Bacteria 922
119 Ga0157380_11111480 3300014326 Bacteria 830
120 Ga0157377_10004781 3300014745 Bacteria 6278
121 Ga0157377_10627412 3300014745 Bacteria 770
122 Ga0157379_10121093 3300014968 Bacteria 2353
123 Ga0157376_10097948 3300014969 Bacteria 2556
124 Ga0209675_1008212 3300025291 Bacteria 3874
125 Ga0209675_1033019 3300025291 Bacteria 1205
126 Ga0209676_1000853 3300025292 Bacteria 39341
127 Ga0209676_1001638 3300025292 Bacteria 19672
128 Ga0209676_1002245 3300025292 Bacteria 14279
129 Ga0209676_1005352 3300025292 Bacteria 6748
130 Ga0209676_1017075 3300025292 Bacteria 2585
131 Ga0209676_1029451 3300025292 Bacteria 1695
132 Ga0209025_1006156 3300025294 Bacteria 9439
133 Ga0209025_1022651 3300025294 Bacteria 3320
134 Ga0209025_1055602 3300025294 Bacteria 1528
135 Ga0209564_1014357 3300025295 Bacteria 3301
136 Ga0209758_1018388 3300025297 Bacteria 3426
137 Ga0209050_1000652 3300025298 Bacteria 53645
138 Ga0209050_1015492 3300025298 Bacteria 3196
139 Ga0209256_1004152 3300025299 Bacteria 9349
140 Ga0209256_1005109 3300025299 Bacteria 7778
141 Ga0209256_1011411 3300025299 Bacteria 3557
142 Ga0209051_1009836 3300025303 Bacteria 4892
143 Ga0209257_1000378 3300025304 Bacteria 88945
144 Ga0209257_1002057 3300025304 Bacteria 21312
145 Ga0209257_1005547 3300025304 Bacteria 8786
146 Ga0209257_1008474 3300025304 Bacteria 5832
147 Ga0207642_10146054 3300025899 Unclassified 1253
148 Ga0207642_10216534 3300025899 Unclassified 1068
149 Ga0207710_10094984 3300025900 Bacteria 1400
150 Ga0207688_10072305 3300025901 Unclassified 1959
151 Ga0207680_10074782 3300025903 Bacteria 2111
152 Ga0207680_10076497 3300025903 Unclassified 2090
153 Ga0207645_10076703 3300025907 Unclassified 2141
154 Ga0207643_10033475 3300025908 Unclassified 2875
155 Ga0207654_10448286 3300025911 Bacteria 904
156 Ga0207654_10511994 3300025911 Unclassified 849
157 Ga0207671_10006504 3300025914 Bacteria 10390
158 Ga0207663_10075147 3300025916 Bacteria 2192
159 Ga0207662_10003875 3300025918 Bacteria 7783
160 Ga0207649_10020395 3300025920 Bacteria 3801
161 Ga0207652_10503072 3300025921 Unclassified 1091
162 Ga0207681_10020707 3300025923 Bacteria 4172
163 Ga0207694_10328648 3300025924 Bacteria 1263
164 Ga0207650_10008769 3300025925 Bacteria 6910
165 Ga0207650_10113649 3300025925 Unclassified 2100
166 Ga0207659_10038569 3300025926 Bacteria 3324
167 Ga0207664_10005638 3300025929 Bacteria 8557
168 Ga0207644_10036242 3300025931 Bacteria 3462
169 Ga0207706_10007163 3300025933 Bacteria 10314
170 Ga0207706_10125423 3300025933 Unclassified 2258
171 Ga0207670_10032220 3300025936 Unclassified 3368
172 Ga0207669_10009668 3300025937 Bacteria 4609
173 Ga0207669_10490161 3300025937 Bacteria 981
174 Ga0207704_10032306 3300025938 Unclassified 2960
175 Ga0207711_10007133 3300025941 Bacteria 9363
176 Ga0207689_10004165 3300025942 Bacteria 13147
177 Ga0207679_10022794 3300025945 Bacteria 4269
178 Ga0207667_10224913 3300025949 Unclassified 1922
179 Ga0207651_10005488 3300025960 Bacteria 6520
180 Ga0207712_10010651 3300025961 Bacteria 5839
181 Ga0207712_10413777 3300025961 Bacteria 1136
182 Ga0207712_10786435 3300025961 Unclassified 836
183 Ga0207668_10094337 3300025972 Unclassified 2206
184 Ga0207640_10584906 3300025981 Bacteria 943
185 Ga0207658_10162345 3300025986 Unclassified 1832
186 Ga0207658_10195892 3300025986 Bacteria 1683
187 Ga0207703_10000802 3300026035 Bacteria 30959
188 Ga0207703_10949566 3300026035 Bacteria 824
189 Ga0207639_10087521 3300026041 Unclassified 2483
190 Ga0207678_10207179 3300026067 Bacteria 1677
191 Ga0207708_10005652 3300026075 Bacteria 9235
192 Ga0207702_10033079 3300026078 Bacteria 4316
193 Ga0207641_10001349 3300026088 Bacteria 24338
194 Ga0207641_10006148 3300026088 Bacteria 10158
195 Ga0207641_10720217 3300026088 Bacteria 983
196 Ga0207648_10053692 3300026089 Unclassified 3522
197 Ga0207676_10004261 3300026095 Bacteria 10110
198 Ga0207676_10056008 3300026095 Bacteria 3098
199 Ga0207674_10023976 3300026116 Bacteria 6526
200 Ga0207674_10067681 3300026116 Unclassified 3595
201 Ga0207675_100006523 3300026118 Bacteria 11047
202 Ga0207675_100019811 3300026118 Bacteria 6278
203 Ga0207683_10054487 3300026121 Bacteria 3507
204 Ga0207683_10401306 3300026121 Unclassified 1261
205 Ga0207698_10695402 3300026142 Bacteria 1011
206 Ga0207428_10001433 3300027907 Bacteria 25077
207 Ga0207428_10080117 3300027907 Bacteria 2552
208 Ga0207428_10267061 3300027907 Bacteria 1273
209 Ga0268266_10061492 3300028379 Bacteria 3239
210 Ga0268265_10001375 3300028380 Bacteria 20664
211 Ga0268265_10080520 3300028380 Bacteria 2568
212 Ga0268265_10214351 3300028380 Bacteria 1680
213 Ga0268264_10000293 3300028381 Bacteria 83870
214 Ga0268264_10046118 3300028381 Bacteria 3620
215 Ga0265334_10000009 3300028573 Bacteria 194312
216 Ga0265334_10028966 3300028573 Unclassified 2221
217 Ga0265338_10058804 3300028800 Unclassified 3390
218 Ga0316182_1287656 3300030745 Bacteria 1580
219 Ga0307408_100033286 3300031548 Bacteria 3600
220 Ga0307408_100035659 3300031548 Bacteria 3492
221 Ga0307408_100057493 3300031548 Bacteria 2824
222 Ga0307408_100096448 3300031548 Bacteria 2244
223 Ga0265313_10000764 3300031595 Bacteria 32746
224 Ga0265313_10091646 3300031595 Bacteria 1363
225 Ga0316576_10177414 3300031727 Unclassified 1607
226 Ga0307405_10226450 3300031731 Bacteria 1375
227 Ga0307405_10345401 3300031731 Bacteria 1146
228 Ga0307406_10133809 3300031901 Bacteria 1744
229 Ga0307406_10365953 3300031901 Bacteria 1132
230 Ga0307412_10109501 3300031911 Bacteria 1969
231 Ga0307412_10123716 3300031911 Bacteria 1867
232 Ga0307409_100683247 3300031995 Unclassified 1024
233 Ga0307416_100465322 3300032002 Bacteria 1321
234 Ga0307414_10124782 3300032004 Bacteria 1987
235 Ga0307414_10166975 3300032004 Bacteria 1755
236 Ga0307414_10213784 3300032004 Bacteria 1578
237 Ga0307411_10034399 3300032005 Bacteria 3153
238 Ga0307411_10059894 3300032005 Bacteria 2526
239 Ga0307415_100738819 3300032126 Bacteria 892
240 Ga0373958_0012852 3300034819 Unclassified 1439
241 Ga0316574_0039268 3300035398 Bacteria 2910
242 Ga0316574_0058675 3300035398 Bacteria 2411
243 Ga0316574_0145935 3300035398 Unclassified 1525
244 Ga0373927_0000003 3300035695 Bacteria 480348
245 Ga0395899_0225912 3300037312 Bacteria 1295
246 Ga0395900_0110441 3300037418 Bacteria 2825
247 Ga0395898_0111340 3300037466 Bacteria 2624
248 Ga0439436_0016819 3300041404 Bacteria 2192
249 Ga0439436_0025197 3300041404 Bacteria 1749
250 Ga0439436_0037472 3300041404 Bacteria 1396
251 Ga0439465_0000775 3300041413 Bacteria 9956
252 Ga0439465_0001959 3300041413 Bacteria 6750
253 Ga0439465_0026696 3300041413 Bacteria 1827
254 Ga0451787_162886 3300041441 Bacteria 2086
255 Ga0451789_0831714 3300041443 Bacteria 1855
256 Ga0451791_0059521 3300041451 Bacteria 5861
257 Ga0451795_0506400 3300041456 Bacteria 904
258 Ga0451802_1944768 3300041460 Bacteria 3601
259 Ga0451833_0081663 3300041491 Bacteria 3248
260 Ga0451837_1530162 3300041494 Bacteria 4895
261 Ga0439433_0025579 3300041999 Bacteria 1334
262 Ga0439448_0055773 3300042005 Bacteria 1300
263 Ga0439432_006881 3300042006 Bacteria 4049
264 Ga0439432_023316 3300042006 Bacteria 2039
265 Ga0439449_0001471 3300042007 Bacteria 9227
266 Ga0439449_0002945 3300042007 Bacteria 6624
267 Ga0439449_0005956 3300042007 Bacteria 4657
268 Ga0439449_0006265 3300042007 Bacteria 4549
269 Ga0439449_0006813 3300042007 Bacteria 4359
270 Ga0439454_042818 3300042011 Bacteria 745
271 Ga0439462_0011271 3300042015 Bacteria 2275
272 Ga0451577_0027725 3300042876 Bacteria 5126
273 Ga0466963_0087294 3300044694 Unclassified 2121
274 Ga0451576_0010878 3300045051 Bacteria 10410
275 Ga0495582_0303902 3300046473 Unclassified 917
276 Ga0495632_0012104 3300046519 Unclassified 4992
277 Ga0495656_0002875 3300046615 Bacteria 5768
278 Ga0495670_0173739 3300046691 Bacteria 1135
279 Ga0495636_0000118 3300047318 Bacteria 32623
280 Ga0495636_0020261 3300047318 Bacteria 2679
281 Ga0495636_0020456 3300047318 Bacteria 2667
282 Ga0495687_097723 3300047443 Bacteria 1109
283 Ga0496102_0003801 3300048905 Bacteria 12766
284 Ga0496103_0043747 3300048906 Bacteria 2758
285 Ga0496104_0055561 3300048907 Bacteria 3744
286 Ga0496106_0014465 3300048909 Bacteria 5830
287 Ga0496108_0586775 3300048911 Bacteria 971
288 Ga0496111_0054771 3300048914 Bacteria 2884
289 Ga0496118_0031529 3300048921 Bacteria 4392
290 Ga0496125_0000813 3300048928 Bacteria 50736
291 Ga0496126_0098327 3300048929 Bacteria 2564
292 Ga0501290_001700 3300049513 Bacteria 2947
293 Ga0501299_005296 3300049522 Unclassified 1976
294 Ga0501300_000697 3300049523 Bacteria 5033
295 Ga0501303_016604 3300049526 Bacteria 747
296 Ga0501043_0063870 3300049579 Bacteria 2891
297 Ga0501068_0141116 3300049584 Bacteria 1510
298 Ga0501202_052408 3300049652 Bacteria 906
299 Ga0501249_011580 3300049679 Bacteria 1853
300 Ga0501265_000684 3300049762 Bacteria 3700
301 Ga0501266_002893 3300049763 Unclassified 2141
302 Ga0501275_000043 3300049772 Bacteria 12657
303 nmdc:mga05p37_148607_c1 3300050507 Unclassified 2868
304 nmdc:mga09592_3846_c1 3300050508 Bacteria 12087
305 nmdc:mga0qj67_48925_c1 3300050509 Bacteria 3341
306 nmdc:mga0qj67_79920_c1 3300050509 Bacteria 2619
307 nmdc:mga06r32_236551_c1 3300050510 Unclassified 1814
308 nmdc:mga06r32_391754_c1 3300050510 Bacteria 1372
309 nmdc:mga06r32_8_c1 3300050510 Bacteria 120971
310 nmdc:mga08y16_10318_c1 3300050511 Bacteria 9804
311 nmdc:mga08y16_1386_c1 3300050511 Bacteria 24240
312 nmdc:mga08y16_61850_c1 3300050511 Bacteria 3910
313 nmdc:mga08y16_99779_c1 3300050511 Unclassified 3023
314 nmdc:mga0n895_685581_c1 3300050512 Bacteria 1021
315 Ga0500597_139169 3300053120 Bacteria 1047

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049652 Ga0501202_052408 Ga0501202_052408_124_747 185
2 3300031548 Ga0307408_100035659 Ga0307408_1000356592 198
3 3300031727 Ga0316576_10177414 Ga0316576_101774141 198
4 3300032005 Ga0307411_10059894 Ga0307411_100598942 198
5 3300041404 Ga0439436_0016819 Ga0439436_0016819_656_1318 198
6 3300049526 Ga0501303_016604 Ga0501303_016604_38_697 198
7 3300049763 Ga0501266_002893 Ga0501266_002893_90_749 198
8 3300003320 rootH2_10097781 rootH2_100977812 201
9 3300048905 Ga0496102_0003801 Ga0496102_0003801_5948_6586 202
10 3300048906 Ga0496103_0043747 Ga0496103_0043747_1322_1960 202
11 3300048921 Ga0496118_0031529 Ga0496118_0031529_2417_3055 202
12 3300005335 Ga0070666_10543708 Ga0070666_105437081 208
13 3300005466 Ga0070685_10158780 Ga0070685_101587802 208
14 3300005539 Ga0068853_100079908 Ga0068853_1000799083 208
15 3300005614 Ga0068856_100096589 Ga0068856_1000965893 208
16 3300005616 Ga0068852_100515317 Ga0068852_1005153172 208
17 3300005617 Ga0068859_100069245 Ga0068859_1000692453 208
18 3300005618 Ga0068864_100175036 Ga0068864_1001750362 208
19 3300005841 Ga0068863_100013531 Ga0068863_1000135315 208
20 3300005842 Ga0068858_100019915 Ga0068858_1000199152 208
21 3300005843 Ga0068860_100018622 Ga0068860_1000186223 208
22 3300005844 Ga0068862_101012267 Ga0068862_1010122671 208
23 3300006931 Ga0097620_100069245 Ga0097620_1000692453 208
24 3300009101 Ga0105247_10150919 Ga0105247_101509192 208
25 3300010375 Ga0105239_10265502 Ga0105239_102655022 208
26 3300013296 Ga0157374_10054875 Ga0157374_100548753 208
27 3300013306 Ga0163162_10108093 Ga0163162_101080933 208
28 3300014325 Ga0163163_10499037 Ga0163163_104990372 208
29 3300014325 Ga0163163_10952501 Ga0163163_109525011 208
30 3300014968 Ga0157379_10121093 Ga0157379_101210932 208
31 3300025900 Ga0207710_10094984 Ga0207710_100949842 208
32 3300025903 Ga0207680_10074782 Ga0207680_100747822 208
33 3300025911 Ga0207654_10511994 Ga0207654_105119941 208
34 3300025949 Ga0207667_10224913 Ga0207667_102249132 208
35 3300025961 Ga0207712_10786435 Ga0207712_107864352 208
36 3300025986 Ga0207658_10162345 Ga0207658_101623452 208
37 3300026035 Ga0207703_10000802 Ga0207703_100008026 208
38 3300026041 Ga0207639_10087521 Ga0207639_100875212 208
39 3300026067 Ga0207678_10207179 Ga0207678_102071792 208
40 3300026078 Ga0207702_10033079 Ga0207702_100330793 208
41 3300026088 Ga0207641_10001349 Ga0207641_100013495 208
42 3300026088 Ga0207641_10720217 Ga0207641_107202172 208
43 3300026095 Ga0207676_10056008 Ga0207676_100560083 208
44 3300026142 Ga0207698_10695402 Ga0207698_106954022 208
45 3300028381 Ga0268264_10000293 Ga0268264_1000029323 208
46 3300046519 Ga0495632_0012104 Ga0495632_0012104_2341_3015 208
47 3300047443 Ga0495687_097723 Ga0495687_097723_300_974 208
48 3300048928 Ga0496125_0000813 Ga0496125_0000813_20154_20828 208
49 3300048929 Ga0496126_0098327 Ga0496126_0098327_1507_2181 208
50 3300035398 Ga0316574_0145935 Ga0316574_0145935_732_1376 209
51 iso_pu_bacteria 2643221559 2643816644 210
52 iso_pu_bacteria 2643221586 2643938676 210
53 iso_pu_bacteria 2643221612 2644077580 210
54 iso_pu_bacteria 2643221727 2644694105 210
55 iso_pu_bacteria 8003014200 8003016809 210
56 3300047318 Ga0495636_0000118 Ga0495636_0000118_23019_23672 211
57 3300047318 Ga0495636_0020261 Ga0495636_0020261_1821_2474 211
58 3300049513 Ga0501290_001700 Ga0501290_001700_707_1378 211
59 3300049523 Ga0501300_000697 Ga0501300_000697_647_1318 211
60 3300049762 Ga0501265_000684 Ga0501265_000684_2318_2989 211
61 3300049772 Ga0501275_000043 Ga0501275_000043_7441_8112 211
62 iso_pu_bacteria 2643221573 2643880991 211
63 iso_pu_bacteria 2643221720 2644661560 211
64 iso_pu_bacteria 2643221728 2644699641 211
65 3300012510 Ga0157316_1015265 Ga0157316_10152651 212
66 3300030745 Ga0316182_1287656 Ga0316182_12876561 212
67 3300031731 Ga0307405_10345401 Ga0307405_103454012 212
68 3300032004 Ga0307414_10166975 Ga0307414_101669752 212
69 3300032004 Ga0307414_10213784 Ga0307414_102137842 212
70 3300032005 Ga0307411_10034399 Ga0307411_100343993 212
71 3300041413 Ga0439465_0000775 Ga0439465_0000775_6675_7352 212
72 3300042006 Ga0439432_006881 Ga0439432_006881_2511_3167 212
73 3300042006 Ga0439432_023316 Ga0439432_023316_503_1159 212
74 3300042007 Ga0439449_0001471 Ga0439449_0001471_8533_9189 212
75 3300042007 Ga0439449_0005956 Ga0439449_0005956_1091_1747 212
76 3300042007 Ga0439449_0006813 Ga0439449_0006813_2776_3453 212
77 3300042876 Ga0451577_0027725 Ga0451577_0027725_3485_4138 212
78 iso_pu_bacteria 2643221695 2644530399 212
79 3300003187 JGI25151J46595_10020460 JGI25151J46595_100204602 213
80 3300003775 Ga0055524_1015367 Ga0055524_10153672 213
81 3300003775 Ga0055524_1025223 Ga0055524_10252232 213
82 3300003781 Ga0055536_1001866 Ga0055536_10018662 213
83 3300003784 Ga0055534_1007188 Ga0055534_10071881 213
84 3300003791 Ga0055530_10005031 Ga0055530_100050315 213
85 3300003794 Ga0055531_10015676 Ga0055531_100156762 213
86 3300003794 Ga0055531_10020582 Ga0055531_100205821 213
87 3300003794 Ga0055531_10029540 Ga0055531_100295402 213
88 3300003794 Ga0055531_10040094 Ga0055531_100400941 213
89 3300003794 Ga0055531_10044392 Ga0055531_100443922 213
90 3300003794 Ga0055531_10045758 Ga0055531_100457581 213
91 3300005367 Ga0070667_100029333 Ga0070667_1000293331 213
92 3300005844 Ga0068862_100059066 Ga0068862_1000590664 213
93 3300006358 Ga0068871_100066717 Ga0068871_1000667172 213
94 3300006844 Ga0075428_100000877 Ga0075428_10000087712 213
95 3300006847 Ga0075431_100000544 Ga0075431_10000054422 213
96 3300006880 Ga0075429_100020585 Ga0075429_1000205854 213
97 3300009094 Ga0111539_10007604 Ga0111539_100076046 213
98 3300009094 Ga0111539_10099765 Ga0111539_100997654 213
99 3300009147 Ga0114129_10174006 Ga0114129_101740063 213
100 3300014326 Ga0157380_11111480 Ga0157380_111114801 213
101 3300025291 Ga0209675_1008212 Ga0209675_10082124 213
102 3300025291 Ga0209675_1033019 Ga0209675_10330192 213
103 3300025292 Ga0209676_1000853 Ga0209676_100085318 213
104 3300025292 Ga0209676_1001638 Ga0209676_100163815 213
105 3300025292 Ga0209676_1002245 Ga0209676_10022456 213
106 3300025292 Ga0209676_1005352 Ga0209676_10053522 213
107 3300025292 Ga0209676_1017075 Ga0209676_10170752 213
108 3300025292 Ga0209676_1029451 Ga0209676_10294512 213
109 3300025294 Ga0209025_1006156 Ga0209025_100615610 213
110 3300025294 Ga0209025_1022651 Ga0209025_10226513 213
111 3300025294 Ga0209025_1055602 Ga0209025_10556022 213
112 3300025295 Ga0209564_1014357 Ga0209564_10143572 213
113 3300025297 Ga0209758_1018388 Ga0209758_10183882 213
114 3300025298 Ga0209050_1000652 Ga0209050_100065216 213
115 3300025298 Ga0209050_1015492 Ga0209050_10154922 213
116 3300025299 Ga0209256_1004152 Ga0209256_10041522 213
117 3300025299 Ga0209256_1005109 Ga0209256_10051092 213
118 3300025299 Ga0209256_1011411 Ga0209256_10114114 213
119 3300025303 Ga0209051_1009836 Ga0209051_10098362 213
120 3300025304 Ga0209257_1000378 Ga0209257_100037831 213
121 3300025304 Ga0209257_1002057 Ga0209257_10020573 213
122 3300025304 Ga0209257_1005547 Ga0209257_10055478 213
123 3300025304 Ga0209257_1008474 Ga0209257_10084742 213
124 3300025899 Ga0207642_10146054 Ga0207642_101460541 213
125 3300025914 Ga0207671_10006504 Ga0207671_100065045 213
126 3300027907 Ga0207428_10001433 Ga0207428_1000143310 213
127 3300027907 Ga0207428_10267061 Ga0207428_102670612 213
128 3300028380 Ga0268265_10214351 Ga0268265_102143513 213
129 3300031548 Ga0307408_100057493 Ga0307408_1000574933 213
130 3300031901 Ga0307406_10365953 Ga0307406_103659532 213
131 3300031911 Ga0307412_10123716 Ga0307412_101237162 213
132 3300041404 Ga0439436_0025197 Ga0439436_0025197_54_713 213
133 3300041404 Ga0439436_0037472 Ga0439436_0037472_440_1099 213
134 3300041413 Ga0439465_0001959 Ga0439465_0001959_3570_4229 213
135 3300041413 Ga0439465_0026696 Ga0439465_0026696_44_703 213
136 3300041999 Ga0439433_0025579 Ga0439433_0025579_654_1313 213
137 3300042005 Ga0439448_0055773 Ga0439448_0055773_644_1285 213
138 3300042007 Ga0439449_0002945 Ga0439449_0002945_2319_2978 213
139 3300042007 Ga0439449_0006265 Ga0439449_0006265_2597_3256 213
140 3300042015 Ga0439462_0011271 Ga0439462_0011271_431_1090 213
141 3300046615 Ga0495656_0002875 Ga0495656_0002875_4848_5507 213
142 3300046691 Ga0495670_0173739 Ga0495670_0173739_244_903 213
143 3300047318 Ga0495636_0020456 Ga0495636_0020456_161_820 213
144 3300049522 Ga0501299_005296 Ga0501299_005296_72_713 213
145 3300049579 Ga0501043_0063870 Ga0501043_0063870_2202_2861 213
146 3300049679 Ga0501249_011580 Ga0501249_011580_928_1569 213
147 3300050507 nmdc:mga05p37_148607_c1 nmdc:mga05p37_148607_c1_1228_1869 213
148 3300050508 nmdc:mga09592_3846_c1 nmdc:mga09592_3846_c1_10664_11305 213
149 3300050510 nmdc:mga06r32_8_c1 nmdc:mga06r32_8_c1_10262_10903 213
150 3300050511 nmdc:mga08y16_1386_c1 nmdc:mga08y16_1386_c1_11588_12229 213
151 3300050511 nmdc:mga08y16_99779_c1 nmdc:mga08y16_99779_c1_304_945 213
152 iso_pu_bacteria 2571042365 2572254675 213
153 3300005458 Ga0070681_10427034 Ga0070681_104270342 214
154 3300006237 Ga0097621_100226265 Ga0097621_1002262653 214
155 3300006358 Ga0068871_100306052 Ga0068871_1003060523 214
156 3300037418 Ga0395900_0110441 Ga0395900_0110441_2020_2685 214
157 3300037466 Ga0395898_0111340 Ga0395898_0111340_1510_2175 214
158 3300009551 Ga0105238_10532374 Ga0105238_105323741 215
159 3300025924 Ga0207694_10328648 Ga0207694_103286482 215
160 3300028573 Ga0265334_10000009 Ga0265334_100000095 215
161 3300031595 Ga0265313_10000764 Ga0265313_1000076424 215
162 3300044694 Ga0466963_0087294 Ga0466963_0087294_1237_1929 215
163 2162886012 MBSR1b_contig_11054327 MBSR1b_0437.00004890 216
164 3300002070 JGI24750J21931_1021598 JGI24750J21931_10215982 216
165 3300005288 Ga0065714_10096898 Ga0065714_100968982 216
166 3300005290 Ga0065712_10075743 Ga0065712_100757432 216
167 3300005293 Ga0065715_10098994 Ga0065715_100989944 216
168 3300005328 Ga0070676_10059239 Ga0070676_100592394 216
169 3300005330 Ga0070690_100030709 Ga0070690_1000307094 216
170 3300005331 Ga0070670_100004115 Ga0070670_10000411512 216
171 3300005331 Ga0070670_100050264 Ga0070670_1000502643 216
172 3300005334 Ga0068869_100002081 Ga0068869_10000208112 216
173 3300005335 Ga0070666_10012427 Ga0070666_100124276 216
174 3300005336 Ga0070680_100168911 Ga0070680_1001689113 216
175 3300005340 Ga0070689_100035492 Ga0070689_1000354924 216
176 3300005343 Ga0070687_100001650 Ga0070687_1000016503 216
177 3300005344 Ga0070661_100139667 Ga0070661_1001396671 216
178 3300005344 Ga0070661_100344550 Ga0070661_1003445502 216
179 3300005347 Ga0070668_100003603 Ga0070668_1000036034 216
180 3300005347 Ga0070668_100019852 Ga0070668_1000198522 216
181 3300005353 Ga0070669_100059871 Ga0070669_1000598712 216
182 3300005354 Ga0070675_100002911 Ga0070675_10000291110 216
183 3300005355 Ga0070671_100025507 Ga0070671_1000255074 216
184 3300005356 Ga0070674_100616473 Ga0070674_1006164732 216
185 3300005364 Ga0070673_100106443 Ga0070673_1001064434 216
186 3300005367 Ga0070667_100146902 Ga0070667_1001469023 216
187 3300005435 Ga0070714_100000395 Ga0070714_1000003952 216
188 3300005435 Ga0070714_100021904 Ga0070714_1000219043 216
189 3300005436 Ga0070713_100337133 Ga0070713_1003371332 216
190 3300005438 Ga0070701_10054844 Ga0070701_100548443 216
191 3300005439 Ga0070711_100098734 Ga0070711_1000987341 216
192 3300005440 Ga0070705_100060546 Ga0070705_1000605463 216
193 3300005444 Ga0070694_100409684 Ga0070694_1004096842 216
194 3300005456 Ga0070678_100087911 Ga0070678_1000879112 216
195 3300005456 Ga0070678_100467941 Ga0070678_1004679412 216
196 3300005457 Ga0070662_100016467 Ga0070662_1000164674 216
197 3300005457 Ga0070662_100096680 Ga0070662_1000966802 216
198 3300005459 Ga0068867_100070402 Ga0068867_1000704022 216
199 3300005530 Ga0070679_100596594 Ga0070679_1005965942 216
200 3300005535 Ga0070684_100016956 Ga0070684_1000169564 216
201 3300005543 Ga0070672_100172746 Ga0070672_1001727463 216
202 3300005544 Ga0070686_100027234 Ga0070686_1000272344 216
203 3300005564 Ga0070664_100002473 Ga0070664_1000024734 216
204 3300005577 Ga0068857_100512738 Ga0068857_1005127382 216
205 3300005578 Ga0068854_100189152 Ga0068854_1001891523 216
206 3300005615 Ga0070702_100003638 Ga0070702_1000036386 216
207 3300005617 Ga0068859_100014440 Ga0068859_1000144406 216
208 3300005618 Ga0068864_100004083 Ga0068864_1000040834 216
209 3300005718 Ga0068866_10336312 Ga0068866_103363122 216
210 3300005719 Ga0068861_100001281 Ga0068861_10000128111 216
211 3300005719 Ga0068861_100045077 Ga0068861_1000450773 216
212 3300005840 Ga0068870_10067969 Ga0068870_100679693 216
213 3300005841 Ga0068863_100001465 Ga0068863_10000146513 216
214 3300005842 Ga0068858_100202038 Ga0068858_1002020383 216
215 3300005843 Ga0068860_100014496 Ga0068860_1000144963 216
216 3300005844 Ga0068862_100000444 Ga0068862_1000004444 216
217 3300005844 Ga0068862_100006783 Ga0068862_10000678310 216
218 3300006237 Ga0097621_100231224 Ga0097621_1002312242 216
219 3300006844 Ga0075428_100448016 Ga0075428_1004480161 216
220 3300006846 Ga0075430_100051178 Ga0075430_1000511784 216
221 3300006846 Ga0075430_100097943 Ga0075430_1000979432 216
222 3300006847 Ga0075431_100094131 Ga0075431_1000941312 216
223 3300006847 Ga0075431_100132305 Ga0075431_1001323053 216
224 3300006881 Ga0068865_100067756 Ga0068865_1000677563 216
225 3300006931 Ga0097620_100014443 Ga0097620_1000144436 216
226 3300009094 Ga0111539_10020533 Ga0111539_100205336 216
227 3300009094 Ga0111539_10025852 Ga0111539_100258527 216
228 3300009147 Ga0114129_11464936 Ga0114129_114649361 216
229 3300009148 Ga0105243_10020398 Ga0105243_100203982 216
230 3300009177 Ga0105248_10004291 Ga0105248_1000429110 216
231 3300009553 Ga0105249_10001844 Ga0105249_1000184410 216
232 3300009553 Ga0105249_10009136 Ga0105249_100091367 216
233 3300010375 Ga0105239_10315210 Ga0105239_103152102 216
234 3300013306 Ga0163162_10058715 Ga0163162_100587155 216
235 3300014325 Ga0163163_10002210 Ga0163163_1000221011 216
236 3300014745 Ga0157377_10004781 Ga0157377_100047818 216
237 3300014745 Ga0157377_10627412 Ga0157377_106274121 216
238 3300014969 Ga0157376_10097948 Ga0157376_100979484 216
239 3300025899 Ga0207642_10216534 Ga0207642_102165342 216
240 3300025901 Ga0207688_10072305 Ga0207688_100723053 216
241 3300025903 Ga0207680_10076497 Ga0207680_100764972 216
242 3300025907 Ga0207645_10076703 Ga0207645_100767033 216
243 3300025908 Ga0207643_10033475 Ga0207643_100334753 216
244 3300025911 Ga0207654_10448286 Ga0207654_104482862 216
245 3300025916 Ga0207663_10075147 Ga0207663_100751471 216
246 3300025918 Ga0207662_10003875 Ga0207662_100038759 216
247 3300025920 Ga0207649_10020395 Ga0207649_100203952 216
248 3300025921 Ga0207652_10503072 Ga0207652_105030722 216
249 3300025923 Ga0207681_10020707 Ga0207681_100207075 216
250 3300025925 Ga0207650_10008769 Ga0207650_100087692 216
251 3300025925 Ga0207650_10113649 Ga0207650_101136493 216
252 3300025926 Ga0207659_10038569 Ga0207659_100385693 216
253 3300025929 Ga0207664_10005638 Ga0207664_100056386 216
254 3300025931 Ga0207644_10036242 Ga0207644_100362424 216
255 3300025933 Ga0207706_10007163 Ga0207706_1000716310 216
256 3300025933 Ga0207706_10125423 Ga0207706_101254232 216
257 3300025936 Ga0207670_10032220 Ga0207670_100322204 216
258 3300025937 Ga0207669_10009668 Ga0207669_100096684 216
259 3300025937 Ga0207669_10490161 Ga0207669_104901612 216
260 3300025938 Ga0207704_10032306 Ga0207704_100323063 216
261 3300025941 Ga0207711_10007133 Ga0207711_100071338 216
262 3300025942 Ga0207689_10004165 Ga0207689_100041654 216
263 3300025945 Ga0207679_10022794 Ga0207679_100227943 216
264 3300025960 Ga0207651_10005488 Ga0207651_100054888 216
265 3300025961 Ga0207712_10010651 Ga0207712_100106516 216
266 3300025961 Ga0207712_10413777 Ga0207712_104137771 216
267 3300025972 Ga0207668_10094337 Ga0207668_100943373 216
268 3300025981 Ga0207640_10584906 Ga0207640_105849061 216
269 3300025986 Ga0207658_10195892 Ga0207658_101958922 216
270 3300026035 Ga0207703_10949566 Ga0207703_109495661 216
271 3300026075 Ga0207708_10005652 Ga0207708_100056522 216
272 3300026088 Ga0207641_10006148 Ga0207641_100061484 216
273 3300026089 Ga0207648_10053692 Ga0207648_100536923 216
274 3300026095 Ga0207676_10004261 Ga0207676_100042615 216
275 3300026116 Ga0207674_10023976 Ga0207674_100239762 216
276 3300026116 Ga0207674_10067681 Ga0207674_100676813 216
277 3300026118 Ga0207675_100006523 Ga0207675_1000065234 216
278 3300026118 Ga0207675_100019811 Ga0207675_1000198116 216
279 3300026121 Ga0207683_10054487 Ga0207683_100544873 216
280 3300026121 Ga0207683_10401306 Ga0207683_104013062 216
281 3300027907 Ga0207428_10080117 Ga0207428_100801174 216
282 3300028379 Ga0268266_10061492 Ga0268266_100614923 216
283 3300028380 Ga0268265_10001375 Ga0268265_1000137510 216
284 3300028380 Ga0268265_10080520 Ga0268265_100805202 216
285 3300028381 Ga0268264_10046118 Ga0268264_100461183 216
286 3300028573 Ga0265334_10028966 Ga0265334_100289663 216
287 3300028800 Ga0265338_10058804 Ga0265338_100588044 216
288 3300031548 Ga0307408_100033286 Ga0307408_1000332864 216
289 3300031548 Ga0307408_100096448 Ga0307408_1000964482 216
290 3300031595 Ga0265313_10091646 Ga0265313_100916461 216
291 3300031731 Ga0307405_10226450 Ga0307405_102264502 216
292 3300031901 Ga0307406_10133809 Ga0307406_101338092 216
293 3300031911 Ga0307412_10109501 Ga0307412_101095012 216
294 3300031995 Ga0307409_100683247 Ga0307409_1006832472 216
295 3300032002 Ga0307416_100465322 Ga0307416_1004653222 216
296 3300032004 Ga0307414_10124782 Ga0307414_101247823 216
297 3300032126 Ga0307415_100738819 Ga0307415_1007388191 216
298 3300034819 Ga0373958_0012852 Ga0373958_0012852_504_1154 216
299 3300035398 Ga0316574_0039268 Ga0316574_0039268_1928_2626 216
300 3300035398 Ga0316574_0058675 Ga0316574_0058675_1641_2342 216
301 3300035695 Ga0373927_0000003 Ga0373927_0000003_467412_468113 216
302 3300037312 Ga0395899_0225912 Ga0395899_0225912_332_1024 216
303 3300041441 Ga0451787_162886 Ga0451787_162886_1092_1757 216
304 3300041443 Ga0451789_0831714 Ga0451789_0831714_593_1258 216
305 3300041451 Ga0451791_0059521 Ga0451791_0059521_3367_4032 216
306 3300041456 Ga0451795_0506400 Ga0451795_0506400_72_737 216
307 3300041460 Ga0451802_1944768 Ga0451802_1944768_659_1324 216
308 3300041491 Ga0451833_0081663 Ga0451833_0081663_1446_2111 216
309 3300041494 Ga0451837_1530162 Ga0451837_1530162_300_965 216
310 3300042011 Ga0439454_042818 Ga0439454_042818_48_713 216
311 3300045051 Ga0451576_0010878 Ga0451576_0010878_9552_10202 216
312 3300046473 Ga0495582_0303902 Ga0495582_0303902_131_808 216
313 3300048907 Ga0496104_0055561 Ga0496104_0055561_64_714 216
314 3300048909 Ga0496106_0014465 Ga0496106_0014465_2134_2784 216
315 3300048911 Ga0496108_0586775 Ga0496108_0586775_63_713 216
316 3300048914 Ga0496111_0054771 Ga0496111_0054771_1462_2112 216
317 3300049584 Ga0501068_0141116 Ga0501068_0141116_779_1450 216
318 3300050509 nmdc:mga0qj67_48925_c1 nmdc:mga0qj67_48925_c1_1624_2274 216
319 3300050509 nmdc:mga0qj67_79920_c1 nmdc:mga0qj67_79920_c1_1463_2128 216
320 3300050510 nmdc:mga06r32_236551_c1 nmdc:mga06r32_236551_c1_489_1139 216
321 3300050510 nmdc:mga06r32_391754_c1 nmdc:mga06r32_391754_c1_442_1092 216
322 3300050511 nmdc:mga08y16_10318_c1 nmdc:mga08y16_10318_c1_5541_6206 216
323 3300050511 nmdc:mga08y16_61850_c1 nmdc:mga08y16_61850_c1_2018_2668 216
324 3300050512 nmdc:mga0n895_685581_c1 nmdc:mga0n895_685581_c1_194_844 216
325 3300053120 Ga0500597_139169 Ga0500597_139169_220_903 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13759

2OG-FeII_Oxy_5

Putative 2OG-Fe(II) oxygenase

136

243

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zbe-assembly1.cif.gz_A crystal structure of aere from microcystis aeruginosa 0.8329 101 207
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.7748 102 205
3bvc-assembly1.cif.gz_A crystal structure of uncharacterized protein ism_01780 from roseovarius nubinhibens ism 0.7662 4 206
6l9i-assembly1.cif.gz_A crystal structure of lactobacillus farciminis oxalate decarboxylase formate complex 0.7557 102 216
3bvc-assembly1.cif.gz_A crystal structure of uncharacterized protein ism_01780 from roseovarius nubinhibens ism 0.7532 4 206
ID Description Score Start End Superfamily
af_A0A0R0I0F2_21_185_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8353 104 203 2.60.120.10
af_Q59013_3_123_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8199 102 207 2.60.120.10
af_A0A0R0EIG9_21_186_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7555 102 214 2.60.120.10
2vqaB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7543 102 205 2.60.120.10
4b29A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7495 102 204 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1I5AMK1-F1-model_v4 2OG-Fe(II) oxygenase superfamily protein 0.9785 1 210
AF-A0A7W3TKN5-F1-model_v4 JmjC domain-containing protein 0.9774 1 213
AF-A0A355VDF0-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.968 1 210
AF-A0A521HMS0-F1-model_v4 JmjC domain-containing protein 0.9664 1 212
AF-A0A368NI42-F1-model_v4 JmjC domain-containing protein 0.9663 2 209

Feature Viewer

pLDDT pTM Quality
90.97 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map