F407646
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 220 | 315 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300003794|Ga0055531_10040094|Ga0055531_100400941 |
| Length | 251 |
| Sequence | MLDLPRPRKGPRLFPGYTQRPTSTFHRAGRDRMSFEISPVFSVPFAQDFLPDAAALNPQLRALILSRESEGMRYANPNPSLKQQPGVFESDFNLFAWQDACIQQLRQFCWATLGRTIRDLNGYSAEEMKQLQIFSHTWFHVTRQGGFTINHTHPMASWSGVYCVDPGTTPEDRPESGVLRFHNPHHYSNLFLDAGNARLRAPYHHGTWNIRFQAGQLVLFPSWLQHEVMPFYGDDERITIAFNCWFGMKNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 4 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 5 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 6 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 7 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 8 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 9 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 10 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 170 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 171 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 177 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 178 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 179 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 180 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 181 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 182 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 183 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 184 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 195 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 196 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 199 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 200 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 201 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 202 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 203 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 204 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 205 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 206 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 209 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 210 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 211 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 212 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 213 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 220 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.92 |
| Metatranscriptomes | 0 |
| Isolates | 3.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.08 |
| Nodule | 0 |
| Rhizoplane | 3.38 |
| Rhizosphere | 81.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_11054327 | 2162886012 | Unclassified | 2348 |
| 2 | JGI24750J21931_1021598 | 3300002070 | Bacteria | 903 |
| 3 | JGI25151J46595_10020460 | 3300003187 | Bacteria | 2789 |
| 4 | rootH2_10097781 | 3300003320 | Bacteria | 3666 |
| 5 | Ga0055524_1015367 | 3300003775 | Bacteria | 2794 |
| 6 | Ga0055524_1025223 | 3300003775 | Bacteria | 1866 |
| 7 | Ga0055536_1001866 | 3300003781 | Bacteria | 12286 |
| 8 | Ga0055534_1007188 | 3300003784 | Bacteria | 2694 |
| 9 | Ga0055530_10005031 | 3300003791 | Bacteria | 6505 |
| 10 | Ga0055531_10015676 | 3300003794 | Bacteria | 3321 |
| 11 | Ga0055531_10020582 | 3300003794 | Bacteria | 2602 |
| 12 | Ga0055531_10029540 | 3300003794 | Bacteria | 1865 |
| 13 | Ga0055531_10040094 | 3300003794 | Bacteria | 1379 |
| 14 | Ga0055531_10044392 | 3300003794 | Bacteria | 1246 |
| 15 | Ga0055531_10045758 | 3300003794 | Bacteria | 1211 |
| 16 | Ga0065714_10096898 | 3300005288 | Unclassified | 1749 |
| 17 | Ga0065712_10075743 | 3300005290 | Bacteria | 3795 |
| 18 | Ga0065715_10098994 | 3300005293 | Bacteria | 3471 |
| 19 | Ga0070676_10059239 | 3300005328 | Bacteria | 2271 |
| 20 | Ga0070690_100030709 | 3300005330 | Bacteria | 3342 |
| 21 | Ga0070670_100004115 | 3300005331 | Bacteria | 12156 |
| 22 | Ga0070670_100050264 | 3300005331 | Unclassified | 3583 |
| 23 | Ga0068869_100002081 | 3300005334 | Bacteria | 12030 |
| 24 | Ga0070666_10012427 | 3300005335 | Bacteria | 5371 |
| 25 | Ga0070666_10543708 | 3300005335 | Unclassified | 844 |
| 26 | Ga0070680_100168911 | 3300005336 | Unclassified | 1840 |
| 27 | Ga0070689_100035492 | 3300005340 | Unclassified | 3810 |
| 28 | Ga0070687_100001650 | 3300005343 | Bacteria | 7982 |
| 29 | Ga0070661_100139667 | 3300005344 | Bacteria | 1825 |
| 30 | Ga0070661_100344550 | 3300005344 | Bacteria | 1168 |
| 31 | Ga0070668_100003603 | 3300005347 | Bacteria | 11431 |
| 32 | Ga0070668_100019852 | 3300005347 | Bacteria | 5063 |
| 33 | Ga0070669_100059871 | 3300005353 | Bacteria | 2796 |
| 34 | Ga0070675_100002911 | 3300005354 | Bacteria | 12905 |
| 35 | Ga0070671_100025507 | 3300005355 | Bacteria | 4851 |
| 36 | Ga0070674_100616473 | 3300005356 | Bacteria | 919 |
| 37 | Ga0070673_100106443 | 3300005364 | Unclassified | 2319 |
| 38 | Ga0070667_100029333 | 3300005367 | Bacteria | 4583 |
| 39 | Ga0070667_100146902 | 3300005367 | Bacteria | 2068 |
| 40 | Ga0070714_100000395 | 3300005435 | Bacteria | 32294 |
| 41 | Ga0070714_100021904 | 3300005435 | Bacteria | 5233 |
| 42 | Ga0070713_100337133 | 3300005436 | Unclassified | 1396 |
| 43 | Ga0070701_10054844 | 3300005438 | Bacteria | 2080 |
| 44 | Ga0070711_100098734 | 3300005439 | Bacteria | 2120 |
| 45 | Ga0070705_100060546 | 3300005440 | Unclassified | 2246 |
| 46 | Ga0070694_100409684 | 3300005444 | Bacteria | 1063 |
| 47 | Ga0070678_100087911 | 3300005456 | Unclassified | 2374 |
| 48 | Ga0070678_100467941 | 3300005456 | Unclassified | 1107 |
| 49 | Ga0070662_100016467 | 3300005457 | Bacteria | 4966 |
| 50 | Ga0070662_100096680 | 3300005457 | Unclassified | 2228 |
| 51 | Ga0070681_10427034 | 3300005458 | Unclassified | 1237 |
| 52 | Ga0068867_100070402 | 3300005459 | Unclassified | 2615 |
| 53 | Ga0070685_10158780 | 3300005466 | Bacteria | 1439 |
| 54 | Ga0070679_100596594 | 3300005530 | Unclassified | 1048 |
| 55 | Ga0070684_100016956 | 3300005535 | Bacteria | 5969 |
| 56 | Ga0068853_100079908 | 3300005539 | Bacteria | 2860 |
| 57 | Ga0070672_100172746 | 3300005543 | Unclassified | 1798 |
| 58 | Ga0070686_100027234 | 3300005544 | Bacteria | 3458 |
| 59 | Ga0070664_100002473 | 3300005564 | Bacteria | 14879 |
| 60 | Ga0068857_100512738 | 3300005577 | Bacteria | 1126 |
| 61 | Ga0068854_100189152 | 3300005578 | Unclassified | 1612 |
| 62 | Ga0068856_100096589 | 3300005614 | Bacteria | 2943 |
| 63 | Ga0070702_100003638 | 3300005615 | Bacteria | 6935 |
| 64 | Ga0068852_100515317 | 3300005616 | Bacteria | 1193 |
| 65 | Ga0068859_100014440 | 3300005617 | Bacteria | 7926 |
| 66 | Ga0068859_100069245 | 3300005617 | Bacteria | 3563 |
| 67 | Ga0068864_100004083 | 3300005618 | Bacteria | 11988 |
| 68 | Ga0068864_100175036 | 3300005618 | Bacteria | 1959 |
| 69 | Ga0068866_10336312 | 3300005718 | Bacteria | 955 |
| 70 | Ga0068861_100001281 | 3300005719 | Bacteria | 15707 |
| 71 | Ga0068861_100045077 | 3300005719 | Unclassified | 3319 |
| 72 | Ga0068870_10067969 | 3300005840 | Unclassified | 1935 |
| 73 | Ga0068863_100001465 | 3300005841 | Bacteria | 23413 |
| 74 | Ga0068863_100013531 | 3300005841 | Bacteria | 7871 |
| 75 | Ga0068858_100019915 | 3300005842 | Bacteria | 6272 |
| 76 | Ga0068858_100202038 | 3300005842 | Bacteria | 1879 |
| 77 | Ga0068860_100014496 | 3300005843 | Bacteria | 7715 |
| 78 | Ga0068860_100018622 | 3300005843 | Bacteria | 6754 |
| 79 | Ga0068862_100000444 | 3300005844 | Bacteria | 45032 |
| 80 | Ga0068862_100006783 | 3300005844 | Bacteria | 9494 |
| 81 | Ga0068862_100059066 | 3300005844 | Unclassified | 3292 |
| 82 | Ga0068862_101012267 | 3300005844 | Unclassified | 822 |
| 83 | Ga0097621_100226265 | 3300006237 | Bacteria | 1632 |
| 84 | Ga0097621_100231224 | 3300006237 | Unclassified | 1614 |
| 85 | Ga0068871_100066717 | 3300006358 | Bacteria | 2950 |
| 86 | Ga0068871_100306052 | 3300006358 | Unclassified | 1396 |
| 87 | Ga0075428_100000877 | 3300006844 | Bacteria | 31669 |
| 88 | Ga0075428_100448016 | 3300006844 | Bacteria | 1383 |
| 89 | Ga0075430_100051178 | 3300006846 | Bacteria | 3481 |
| 90 | Ga0075430_100097943 | 3300006846 | Bacteria | 2450 |
| 91 | Ga0075431_100000544 | 3300006847 | Bacteria | 31685 |
| 92 | Ga0075431_100094131 | 3300006847 | Bacteria | 3092 |
| 93 | Ga0075431_100132305 | 3300006847 | Unclassified | 2573 |
| 94 | Ga0075429_100020585 | 3300006880 | Bacteria | 5725 |
| 95 | Ga0068865_100067756 | 3300006881 | Unclassified | 2522 |
| 96 | Ga0097620_100014443 | 3300006931 | Bacteria | 7926 |
| 97 | Ga0097620_100069245 | 3300006931 | Bacteria | 3563 |
| 98 | Ga0111539_10007604 | 3300009094 | Bacteria | 13845 |
| 99 | Ga0111539_10020533 | 3300009094 | Bacteria | 8135 |
| 100 | Ga0111539_10025852 | 3300009094 | Bacteria | 7188 |
| 101 | Ga0111539_10099765 | 3300009094 | Unclassified | 3410 |
| 102 | Ga0105247_10150919 | 3300009101 | Unclassified | 1531 |
| 103 | Ga0114129_10174006 | 3300009147 | Unclassified | 2933 |
| 104 | Ga0114129_11464936 | 3300009147 | Bacteria | 840 |
| 105 | Ga0105243_10020398 | 3300009148 | Bacteria | 5026 |
| 106 | Ga0105248_10004291 | 3300009177 | Bacteria | 15775 |
| 107 | Ga0105238_10532374 | 3300009551 | Bacteria | 1178 |
| 108 | Ga0105249_10001844 | 3300009553 | Bacteria | 18422 |
| 109 | Ga0105249_10009136 | 3300009553 | Bacteria | 8669 |
| 110 | Ga0105239_10265502 | 3300010375 | Bacteria | 1930 |
| 111 | Ga0105239_10315210 | 3300010375 | Bacteria | 1763 |
| 112 | Ga0157316_1015265 | 3300012510 | Bacteria | 775 |
| 113 | Ga0157374_10054875 | 3300013296 | Unclassified | 3718 |
| 114 | Ga0163162_10058715 | 3300013306 | Bacteria | 3877 |
| 115 | Ga0163162_10108093 | 3300013306 | Unclassified | 2877 |
| 116 | Ga0163163_10002210 | 3300014325 | Bacteria | 16364 |
| 117 | Ga0163163_10499037 | 3300014325 | Bacteria | 1279 |
| 118 | Ga0163163_10952501 | 3300014325 | Bacteria | 922 |
| 119 | Ga0157380_11111480 | 3300014326 | Bacteria | 830 |
| 120 | Ga0157377_10004781 | 3300014745 | Bacteria | 6278 |
| 121 | Ga0157377_10627412 | 3300014745 | Bacteria | 770 |
| 122 | Ga0157379_10121093 | 3300014968 | Bacteria | 2353 |
| 123 | Ga0157376_10097948 | 3300014969 | Bacteria | 2556 |
| 124 | Ga0209675_1008212 | 3300025291 | Bacteria | 3874 |
| 125 | Ga0209675_1033019 | 3300025291 | Bacteria | 1205 |
| 126 | Ga0209676_1000853 | 3300025292 | Bacteria | 39341 |
| 127 | Ga0209676_1001638 | 3300025292 | Bacteria | 19672 |
| 128 | Ga0209676_1002245 | 3300025292 | Bacteria | 14279 |
| 129 | Ga0209676_1005352 | 3300025292 | Bacteria | 6748 |
| 130 | Ga0209676_1017075 | 3300025292 | Bacteria | 2585 |
| 131 | Ga0209676_1029451 | 3300025292 | Bacteria | 1695 |
| 132 | Ga0209025_1006156 | 3300025294 | Bacteria | 9439 |
| 133 | Ga0209025_1022651 | 3300025294 | Bacteria | 3320 |
| 134 | Ga0209025_1055602 | 3300025294 | Bacteria | 1528 |
| 135 | Ga0209564_1014357 | 3300025295 | Bacteria | 3301 |
| 136 | Ga0209758_1018388 | 3300025297 | Bacteria | 3426 |
| 137 | Ga0209050_1000652 | 3300025298 | Bacteria | 53645 |
| 138 | Ga0209050_1015492 | 3300025298 | Bacteria | 3196 |
| 139 | Ga0209256_1004152 | 3300025299 | Bacteria | 9349 |
| 140 | Ga0209256_1005109 | 3300025299 | Bacteria | 7778 |
| 141 | Ga0209256_1011411 | 3300025299 | Bacteria | 3557 |
| 142 | Ga0209051_1009836 | 3300025303 | Bacteria | 4892 |
| 143 | Ga0209257_1000378 | 3300025304 | Bacteria | 88945 |
| 144 | Ga0209257_1002057 | 3300025304 | Bacteria | 21312 |
| 145 | Ga0209257_1005547 | 3300025304 | Bacteria | 8786 |
| 146 | Ga0209257_1008474 | 3300025304 | Bacteria | 5832 |
| 147 | Ga0207642_10146054 | 3300025899 | Unclassified | 1253 |
| 148 | Ga0207642_10216534 | 3300025899 | Unclassified | 1068 |
| 149 | Ga0207710_10094984 | 3300025900 | Bacteria | 1400 |
| 150 | Ga0207688_10072305 | 3300025901 | Unclassified | 1959 |
| 151 | Ga0207680_10074782 | 3300025903 | Bacteria | 2111 |
| 152 | Ga0207680_10076497 | 3300025903 | Unclassified | 2090 |
| 153 | Ga0207645_10076703 | 3300025907 | Unclassified | 2141 |
| 154 | Ga0207643_10033475 | 3300025908 | Unclassified | 2875 |
| 155 | Ga0207654_10448286 | 3300025911 | Bacteria | 904 |
| 156 | Ga0207654_10511994 | 3300025911 | Unclassified | 849 |
| 157 | Ga0207671_10006504 | 3300025914 | Bacteria | 10390 |
| 158 | Ga0207663_10075147 | 3300025916 | Bacteria | 2192 |
| 159 | Ga0207662_10003875 | 3300025918 | Bacteria | 7783 |
| 160 | Ga0207649_10020395 | 3300025920 | Bacteria | 3801 |
| 161 | Ga0207652_10503072 | 3300025921 | Unclassified | 1091 |
| 162 | Ga0207681_10020707 | 3300025923 | Bacteria | 4172 |
| 163 | Ga0207694_10328648 | 3300025924 | Bacteria | 1263 |
| 164 | Ga0207650_10008769 | 3300025925 | Bacteria | 6910 |
| 165 | Ga0207650_10113649 | 3300025925 | Unclassified | 2100 |
| 166 | Ga0207659_10038569 | 3300025926 | Bacteria | 3324 |
| 167 | Ga0207664_10005638 | 3300025929 | Bacteria | 8557 |
| 168 | Ga0207644_10036242 | 3300025931 | Bacteria | 3462 |
| 169 | Ga0207706_10007163 | 3300025933 | Bacteria | 10314 |
| 170 | Ga0207706_10125423 | 3300025933 | Unclassified | 2258 |
| 171 | Ga0207670_10032220 | 3300025936 | Unclassified | 3368 |
| 172 | Ga0207669_10009668 | 3300025937 | Bacteria | 4609 |
| 173 | Ga0207669_10490161 | 3300025937 | Bacteria | 981 |
| 174 | Ga0207704_10032306 | 3300025938 | Unclassified | 2960 |
| 175 | Ga0207711_10007133 | 3300025941 | Bacteria | 9363 |
| 176 | Ga0207689_10004165 | 3300025942 | Bacteria | 13147 |
| 177 | Ga0207679_10022794 | 3300025945 | Bacteria | 4269 |
| 178 | Ga0207667_10224913 | 3300025949 | Unclassified | 1922 |
| 179 | Ga0207651_10005488 | 3300025960 | Bacteria | 6520 |
| 180 | Ga0207712_10010651 | 3300025961 | Bacteria | 5839 |
| 181 | Ga0207712_10413777 | 3300025961 | Bacteria | 1136 |
| 182 | Ga0207712_10786435 | 3300025961 | Unclassified | 836 |
| 183 | Ga0207668_10094337 | 3300025972 | Unclassified | 2206 |
| 184 | Ga0207640_10584906 | 3300025981 | Bacteria | 943 |
| 185 | Ga0207658_10162345 | 3300025986 | Unclassified | 1832 |
| 186 | Ga0207658_10195892 | 3300025986 | Bacteria | 1683 |
| 187 | Ga0207703_10000802 | 3300026035 | Bacteria | 30959 |
| 188 | Ga0207703_10949566 | 3300026035 | Bacteria | 824 |
| 189 | Ga0207639_10087521 | 3300026041 | Unclassified | 2483 |
| 190 | Ga0207678_10207179 | 3300026067 | Bacteria | 1677 |
| 191 | Ga0207708_10005652 | 3300026075 | Bacteria | 9235 |
| 192 | Ga0207702_10033079 | 3300026078 | Bacteria | 4316 |
| 193 | Ga0207641_10001349 | 3300026088 | Bacteria | 24338 |
| 194 | Ga0207641_10006148 | 3300026088 | Bacteria | 10158 |
| 195 | Ga0207641_10720217 | 3300026088 | Bacteria | 983 |
| 196 | Ga0207648_10053692 | 3300026089 | Unclassified | 3522 |
| 197 | Ga0207676_10004261 | 3300026095 | Bacteria | 10110 |
| 198 | Ga0207676_10056008 | 3300026095 | Bacteria | 3098 |
| 199 | Ga0207674_10023976 | 3300026116 | Bacteria | 6526 |
| 200 | Ga0207674_10067681 | 3300026116 | Unclassified | 3595 |
| 201 | Ga0207675_100006523 | 3300026118 | Bacteria | 11047 |
| 202 | Ga0207675_100019811 | 3300026118 | Bacteria | 6278 |
| 203 | Ga0207683_10054487 | 3300026121 | Bacteria | 3507 |
| 204 | Ga0207683_10401306 | 3300026121 | Unclassified | 1261 |
| 205 | Ga0207698_10695402 | 3300026142 | Bacteria | 1011 |
| 206 | Ga0207428_10001433 | 3300027907 | Bacteria | 25077 |
| 207 | Ga0207428_10080117 | 3300027907 | Bacteria | 2552 |
| 208 | Ga0207428_10267061 | 3300027907 | Bacteria | 1273 |
| 209 | Ga0268266_10061492 | 3300028379 | Bacteria | 3239 |
| 210 | Ga0268265_10001375 | 3300028380 | Bacteria | 20664 |
| 211 | Ga0268265_10080520 | 3300028380 | Bacteria | 2568 |
| 212 | Ga0268265_10214351 | 3300028380 | Bacteria | 1680 |
| 213 | Ga0268264_10000293 | 3300028381 | Bacteria | 83870 |
| 214 | Ga0268264_10046118 | 3300028381 | Bacteria | 3620 |
| 215 | Ga0265334_10000009 | 3300028573 | Bacteria | 194312 |
| 216 | Ga0265334_10028966 | 3300028573 | Unclassified | 2221 |
| 217 | Ga0265338_10058804 | 3300028800 | Unclassified | 3390 |
| 218 | Ga0316182_1287656 | 3300030745 | Bacteria | 1580 |
| 219 | Ga0307408_100033286 | 3300031548 | Bacteria | 3600 |
| 220 | Ga0307408_100035659 | 3300031548 | Bacteria | 3492 |
| 221 | Ga0307408_100057493 | 3300031548 | Bacteria | 2824 |
| 222 | Ga0307408_100096448 | 3300031548 | Bacteria | 2244 |
| 223 | Ga0265313_10000764 | 3300031595 | Bacteria | 32746 |
| 224 | Ga0265313_10091646 | 3300031595 | Bacteria | 1363 |
| 225 | Ga0316576_10177414 | 3300031727 | Unclassified | 1607 |
| 226 | Ga0307405_10226450 | 3300031731 | Bacteria | 1375 |
| 227 | Ga0307405_10345401 | 3300031731 | Bacteria | 1146 |
| 228 | Ga0307406_10133809 | 3300031901 | Bacteria | 1744 |
| 229 | Ga0307406_10365953 | 3300031901 | Bacteria | 1132 |
| 230 | Ga0307412_10109501 | 3300031911 | Bacteria | 1969 |
| 231 | Ga0307412_10123716 | 3300031911 | Bacteria | 1867 |
| 232 | Ga0307409_100683247 | 3300031995 | Unclassified | 1024 |
| 233 | Ga0307416_100465322 | 3300032002 | Bacteria | 1321 |
| 234 | Ga0307414_10124782 | 3300032004 | Bacteria | 1987 |
| 235 | Ga0307414_10166975 | 3300032004 | Bacteria | 1755 |
| 236 | Ga0307414_10213784 | 3300032004 | Bacteria | 1578 |
| 237 | Ga0307411_10034399 | 3300032005 | Bacteria | 3153 |
| 238 | Ga0307411_10059894 | 3300032005 | Bacteria | 2526 |
| 239 | Ga0307415_100738819 | 3300032126 | Bacteria | 892 |
| 240 | Ga0373958_0012852 | 3300034819 | Unclassified | 1439 |
| 241 | Ga0316574_0039268 | 3300035398 | Bacteria | 2910 |
| 242 | Ga0316574_0058675 | 3300035398 | Bacteria | 2411 |
| 243 | Ga0316574_0145935 | 3300035398 | Unclassified | 1525 |
| 244 | Ga0373927_0000003 | 3300035695 | Bacteria | 480348 |
| 245 | Ga0395899_0225912 | 3300037312 | Bacteria | 1295 |
| 246 | Ga0395900_0110441 | 3300037418 | Bacteria | 2825 |
| 247 | Ga0395898_0111340 | 3300037466 | Bacteria | 2624 |
| 248 | Ga0439436_0016819 | 3300041404 | Bacteria | 2192 |
| 249 | Ga0439436_0025197 | 3300041404 | Bacteria | 1749 |
| 250 | Ga0439436_0037472 | 3300041404 | Bacteria | 1396 |
| 251 | Ga0439465_0000775 | 3300041413 | Bacteria | 9956 |
| 252 | Ga0439465_0001959 | 3300041413 | Bacteria | 6750 |
| 253 | Ga0439465_0026696 | 3300041413 | Bacteria | 1827 |
| 254 | Ga0451787_162886 | 3300041441 | Bacteria | 2086 |
| 255 | Ga0451789_0831714 | 3300041443 | Bacteria | 1855 |
| 256 | Ga0451791_0059521 | 3300041451 | Bacteria | 5861 |
| 257 | Ga0451795_0506400 | 3300041456 | Bacteria | 904 |
| 258 | Ga0451802_1944768 | 3300041460 | Bacteria | 3601 |
| 259 | Ga0451833_0081663 | 3300041491 | Bacteria | 3248 |
| 260 | Ga0451837_1530162 | 3300041494 | Bacteria | 4895 |
| 261 | Ga0439433_0025579 | 3300041999 | Bacteria | 1334 |
| 262 | Ga0439448_0055773 | 3300042005 | Bacteria | 1300 |
| 263 | Ga0439432_006881 | 3300042006 | Bacteria | 4049 |
| 264 | Ga0439432_023316 | 3300042006 | Bacteria | 2039 |
| 265 | Ga0439449_0001471 | 3300042007 | Bacteria | 9227 |
| 266 | Ga0439449_0002945 | 3300042007 | Bacteria | 6624 |
| 267 | Ga0439449_0005956 | 3300042007 | Bacteria | 4657 |
| 268 | Ga0439449_0006265 | 3300042007 | Bacteria | 4549 |
| 269 | Ga0439449_0006813 | 3300042007 | Bacteria | 4359 |
| 270 | Ga0439454_042818 | 3300042011 | Bacteria | 745 |
| 271 | Ga0439462_0011271 | 3300042015 | Bacteria | 2275 |
| 272 | Ga0451577_0027725 | 3300042876 | Bacteria | 5126 |
| 273 | Ga0466963_0087294 | 3300044694 | Unclassified | 2121 |
| 274 | Ga0451576_0010878 | 3300045051 | Bacteria | 10410 |
| 275 | Ga0495582_0303902 | 3300046473 | Unclassified | 917 |
| 276 | Ga0495632_0012104 | 3300046519 | Unclassified | 4992 |
| 277 | Ga0495656_0002875 | 3300046615 | Bacteria | 5768 |
| 278 | Ga0495670_0173739 | 3300046691 | Bacteria | 1135 |
| 279 | Ga0495636_0000118 | 3300047318 | Bacteria | 32623 |
| 280 | Ga0495636_0020261 | 3300047318 | Bacteria | 2679 |
| 281 | Ga0495636_0020456 | 3300047318 | Bacteria | 2667 |
| 282 | Ga0495687_097723 | 3300047443 | Bacteria | 1109 |
| 283 | Ga0496102_0003801 | 3300048905 | Bacteria | 12766 |
| 284 | Ga0496103_0043747 | 3300048906 | Bacteria | 2758 |
| 285 | Ga0496104_0055561 | 3300048907 | Bacteria | 3744 |
| 286 | Ga0496106_0014465 | 3300048909 | Bacteria | 5830 |
| 287 | Ga0496108_0586775 | 3300048911 | Bacteria | 971 |
| 288 | Ga0496111_0054771 | 3300048914 | Bacteria | 2884 |
| 289 | Ga0496118_0031529 | 3300048921 | Bacteria | 4392 |
| 290 | Ga0496125_0000813 | 3300048928 | Bacteria | 50736 |
| 291 | Ga0496126_0098327 | 3300048929 | Bacteria | 2564 |
| 292 | Ga0501290_001700 | 3300049513 | Bacteria | 2947 |
| 293 | Ga0501299_005296 | 3300049522 | Unclassified | 1976 |
| 294 | Ga0501300_000697 | 3300049523 | Bacteria | 5033 |
| 295 | Ga0501303_016604 | 3300049526 | Bacteria | 747 |
| 296 | Ga0501043_0063870 | 3300049579 | Bacteria | 2891 |
| 297 | Ga0501068_0141116 | 3300049584 | Bacteria | 1510 |
| 298 | Ga0501202_052408 | 3300049652 | Bacteria | 906 |
| 299 | Ga0501249_011580 | 3300049679 | Bacteria | 1853 |
| 300 | Ga0501265_000684 | 3300049762 | Bacteria | 3700 |
| 301 | Ga0501266_002893 | 3300049763 | Unclassified | 2141 |
| 302 | Ga0501275_000043 | 3300049772 | Bacteria | 12657 |
| 303 | nmdc:mga05p37_148607_c1 | 3300050507 | Unclassified | 2868 |
| 304 | nmdc:mga09592_3846_c1 | 3300050508 | Bacteria | 12087 |
| 305 | nmdc:mga0qj67_48925_c1 | 3300050509 | Bacteria | 3341 |
| 306 | nmdc:mga0qj67_79920_c1 | 3300050509 | Bacteria | 2619 |
| 307 | nmdc:mga06r32_236551_c1 | 3300050510 | Unclassified | 1814 |
| 308 | nmdc:mga06r32_391754_c1 | 3300050510 | Bacteria | 1372 |
| 309 | nmdc:mga06r32_8_c1 | 3300050510 | Bacteria | 120971 |
| 310 | nmdc:mga08y16_10318_c1 | 3300050511 | Bacteria | 9804 |
| 311 | nmdc:mga08y16_1386_c1 | 3300050511 | Bacteria | 24240 |
| 312 | nmdc:mga08y16_61850_c1 | 3300050511 | Bacteria | 3910 |
| 313 | nmdc:mga08y16_99779_c1 | 3300050511 | Unclassified | 3023 |
| 314 | nmdc:mga0n895_685581_c1 | 3300050512 | Bacteria | 1021 |
| 315 | Ga0500597_139169 | 3300053120 | Bacteria | 1047 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049652 | Ga0501202_052408 | Ga0501202_052408_124_747 | 185 |
| 2 | 3300031548 | Ga0307408_100035659 | Ga0307408_1000356592 | 198 |
| 3 | 3300031727 | Ga0316576_10177414 | Ga0316576_101774141 | 198 |
| 4 | 3300032005 | Ga0307411_10059894 | Ga0307411_100598942 | 198 |
| 5 | 3300041404 | Ga0439436_0016819 | Ga0439436_0016819_656_1318 | 198 |
| 6 | 3300049526 | Ga0501303_016604 | Ga0501303_016604_38_697 | 198 |
| 7 | 3300049763 | Ga0501266_002893 | Ga0501266_002893_90_749 | 198 |
| 8 | 3300003320 | rootH2_10097781 | rootH2_100977812 | 201 |
| 9 | 3300048905 | Ga0496102_0003801 | Ga0496102_0003801_5948_6586 | 202 |
| 10 | 3300048906 | Ga0496103_0043747 | Ga0496103_0043747_1322_1960 | 202 |
| 11 | 3300048921 | Ga0496118_0031529 | Ga0496118_0031529_2417_3055 | 202 |
| 12 | 3300005335 | Ga0070666_10543708 | Ga0070666_105437081 | 208 |
| 13 | 3300005466 | Ga0070685_10158780 | Ga0070685_101587802 | 208 |
| 14 | 3300005539 | Ga0068853_100079908 | Ga0068853_1000799083 | 208 |
| 15 | 3300005614 | Ga0068856_100096589 | Ga0068856_1000965893 | 208 |
| 16 | 3300005616 | Ga0068852_100515317 | Ga0068852_1005153172 | 208 |
| 17 | 3300005617 | Ga0068859_100069245 | Ga0068859_1000692453 | 208 |
| 18 | 3300005618 | Ga0068864_100175036 | Ga0068864_1001750362 | 208 |
| 19 | 3300005841 | Ga0068863_100013531 | Ga0068863_1000135315 | 208 |
| 20 | 3300005842 | Ga0068858_100019915 | Ga0068858_1000199152 | 208 |
| 21 | 3300005843 | Ga0068860_100018622 | Ga0068860_1000186223 | 208 |
| 22 | 3300005844 | Ga0068862_101012267 | Ga0068862_1010122671 | 208 |
| 23 | 3300006931 | Ga0097620_100069245 | Ga0097620_1000692453 | 208 |
| 24 | 3300009101 | Ga0105247_10150919 | Ga0105247_101509192 | 208 |
| 25 | 3300010375 | Ga0105239_10265502 | Ga0105239_102655022 | 208 |
| 26 | 3300013296 | Ga0157374_10054875 | Ga0157374_100548753 | 208 |
| 27 | 3300013306 | Ga0163162_10108093 | Ga0163162_101080933 | 208 |
| 28 | 3300014325 | Ga0163163_10499037 | Ga0163163_104990372 | 208 |
| 29 | 3300014325 | Ga0163163_10952501 | Ga0163163_109525011 | 208 |
| 30 | 3300014968 | Ga0157379_10121093 | Ga0157379_101210932 | 208 |
| 31 | 3300025900 | Ga0207710_10094984 | Ga0207710_100949842 | 208 |
| 32 | 3300025903 | Ga0207680_10074782 | Ga0207680_100747822 | 208 |
| 33 | 3300025911 | Ga0207654_10511994 | Ga0207654_105119941 | 208 |
| 34 | 3300025949 | Ga0207667_10224913 | Ga0207667_102249132 | 208 |
| 35 | 3300025961 | Ga0207712_10786435 | Ga0207712_107864352 | 208 |
| 36 | 3300025986 | Ga0207658_10162345 | Ga0207658_101623452 | 208 |
| 37 | 3300026035 | Ga0207703_10000802 | Ga0207703_100008026 | 208 |
| 38 | 3300026041 | Ga0207639_10087521 | Ga0207639_100875212 | 208 |
| 39 | 3300026067 | Ga0207678_10207179 | Ga0207678_102071792 | 208 |
| 40 | 3300026078 | Ga0207702_10033079 | Ga0207702_100330793 | 208 |
| 41 | 3300026088 | Ga0207641_10001349 | Ga0207641_100013495 | 208 |
| 42 | 3300026088 | Ga0207641_10720217 | Ga0207641_107202172 | 208 |
| 43 | 3300026095 | Ga0207676_10056008 | Ga0207676_100560083 | 208 |
| 44 | 3300026142 | Ga0207698_10695402 | Ga0207698_106954022 | 208 |
| 45 | 3300028381 | Ga0268264_10000293 | Ga0268264_1000029323 | 208 |
| 46 | 3300046519 | Ga0495632_0012104 | Ga0495632_0012104_2341_3015 | 208 |
| 47 | 3300047443 | Ga0495687_097723 | Ga0495687_097723_300_974 | 208 |
| 48 | 3300048928 | Ga0496125_0000813 | Ga0496125_0000813_20154_20828 | 208 |
| 49 | 3300048929 | Ga0496126_0098327 | Ga0496126_0098327_1507_2181 | 208 |
| 50 | 3300035398 | Ga0316574_0145935 | Ga0316574_0145935_732_1376 | 209 |
| 51 | iso_pu_bacteria | 2643221559 | 2643816644 | 210 |
| 52 | iso_pu_bacteria | 2643221586 | 2643938676 | 210 |
| 53 | iso_pu_bacteria | 2643221612 | 2644077580 | 210 |
| 54 | iso_pu_bacteria | 2643221727 | 2644694105 | 210 |
| 55 | iso_pu_bacteria | 8003014200 | 8003016809 | 210 |
| 56 | 3300047318 | Ga0495636_0000118 | Ga0495636_0000118_23019_23672 | 211 |
| 57 | 3300047318 | Ga0495636_0020261 | Ga0495636_0020261_1821_2474 | 211 |
| 58 | 3300049513 | Ga0501290_001700 | Ga0501290_001700_707_1378 | 211 |
| 59 | 3300049523 | Ga0501300_000697 | Ga0501300_000697_647_1318 | 211 |
| 60 | 3300049762 | Ga0501265_000684 | Ga0501265_000684_2318_2989 | 211 |
| 61 | 3300049772 | Ga0501275_000043 | Ga0501275_000043_7441_8112 | 211 |
| 62 | iso_pu_bacteria | 2643221573 | 2643880991 | 211 |
| 63 | iso_pu_bacteria | 2643221720 | 2644661560 | 211 |
| 64 | iso_pu_bacteria | 2643221728 | 2644699641 | 211 |
| 65 | 3300012510 | Ga0157316_1015265 | Ga0157316_10152651 | 212 |
| 66 | 3300030745 | Ga0316182_1287656 | Ga0316182_12876561 | 212 |
| 67 | 3300031731 | Ga0307405_10345401 | Ga0307405_103454012 | 212 |
| 68 | 3300032004 | Ga0307414_10166975 | Ga0307414_101669752 | 212 |
| 69 | 3300032004 | Ga0307414_10213784 | Ga0307414_102137842 | 212 |
| 70 | 3300032005 | Ga0307411_10034399 | Ga0307411_100343993 | 212 |
| 71 | 3300041413 | Ga0439465_0000775 | Ga0439465_0000775_6675_7352 | 212 |
| 72 | 3300042006 | Ga0439432_006881 | Ga0439432_006881_2511_3167 | 212 |
| 73 | 3300042006 | Ga0439432_023316 | Ga0439432_023316_503_1159 | 212 |
| 74 | 3300042007 | Ga0439449_0001471 | Ga0439449_0001471_8533_9189 | 212 |
| 75 | 3300042007 | Ga0439449_0005956 | Ga0439449_0005956_1091_1747 | 212 |
| 76 | 3300042007 | Ga0439449_0006813 | Ga0439449_0006813_2776_3453 | 212 |
| 77 | 3300042876 | Ga0451577_0027725 | Ga0451577_0027725_3485_4138 | 212 |
| 78 | iso_pu_bacteria | 2643221695 | 2644530399 | 212 |
| 79 | 3300003187 | JGI25151J46595_10020460 | JGI25151J46595_100204602 | 213 |
| 80 | 3300003775 | Ga0055524_1015367 | Ga0055524_10153672 | 213 |
| 81 | 3300003775 | Ga0055524_1025223 | Ga0055524_10252232 | 213 |
| 82 | 3300003781 | Ga0055536_1001866 | Ga0055536_10018662 | 213 |
| 83 | 3300003784 | Ga0055534_1007188 | Ga0055534_10071881 | 213 |
| 84 | 3300003791 | Ga0055530_10005031 | Ga0055530_100050315 | 213 |
| 85 | 3300003794 | Ga0055531_10015676 | Ga0055531_100156762 | 213 |
| 86 | 3300003794 | Ga0055531_10020582 | Ga0055531_100205821 | 213 |
| 87 | 3300003794 | Ga0055531_10029540 | Ga0055531_100295402 | 213 |
| 88 | 3300003794 | Ga0055531_10040094 | Ga0055531_100400941 | 213 |
| 89 | 3300003794 | Ga0055531_10044392 | Ga0055531_100443922 | 213 |
| 90 | 3300003794 | Ga0055531_10045758 | Ga0055531_100457581 | 213 |
| 91 | 3300005367 | Ga0070667_100029333 | Ga0070667_1000293331 | 213 |
| 92 | 3300005844 | Ga0068862_100059066 | Ga0068862_1000590664 | 213 |
| 93 | 3300006358 | Ga0068871_100066717 | Ga0068871_1000667172 | 213 |
| 94 | 3300006844 | Ga0075428_100000877 | Ga0075428_10000087712 | 213 |
| 95 | 3300006847 | Ga0075431_100000544 | Ga0075431_10000054422 | 213 |
| 96 | 3300006880 | Ga0075429_100020585 | Ga0075429_1000205854 | 213 |
| 97 | 3300009094 | Ga0111539_10007604 | Ga0111539_100076046 | 213 |
| 98 | 3300009094 | Ga0111539_10099765 | Ga0111539_100997654 | 213 |
| 99 | 3300009147 | Ga0114129_10174006 | Ga0114129_101740063 | 213 |
| 100 | 3300014326 | Ga0157380_11111480 | Ga0157380_111114801 | 213 |
| 101 | 3300025291 | Ga0209675_1008212 | Ga0209675_10082124 | 213 |
| 102 | 3300025291 | Ga0209675_1033019 | Ga0209675_10330192 | 213 |
| 103 | 3300025292 | Ga0209676_1000853 | Ga0209676_100085318 | 213 |
| 104 | 3300025292 | Ga0209676_1001638 | Ga0209676_100163815 | 213 |
| 105 | 3300025292 | Ga0209676_1002245 | Ga0209676_10022456 | 213 |
| 106 | 3300025292 | Ga0209676_1005352 | Ga0209676_10053522 | 213 |
| 107 | 3300025292 | Ga0209676_1017075 | Ga0209676_10170752 | 213 |
| 108 | 3300025292 | Ga0209676_1029451 | Ga0209676_10294512 | 213 |
| 109 | 3300025294 | Ga0209025_1006156 | Ga0209025_100615610 | 213 |
| 110 | 3300025294 | Ga0209025_1022651 | Ga0209025_10226513 | 213 |
| 111 | 3300025294 | Ga0209025_1055602 | Ga0209025_10556022 | 213 |
| 112 | 3300025295 | Ga0209564_1014357 | Ga0209564_10143572 | 213 |
| 113 | 3300025297 | Ga0209758_1018388 | Ga0209758_10183882 | 213 |
| 114 | 3300025298 | Ga0209050_1000652 | Ga0209050_100065216 | 213 |
| 115 | 3300025298 | Ga0209050_1015492 | Ga0209050_10154922 | 213 |
| 116 | 3300025299 | Ga0209256_1004152 | Ga0209256_10041522 | 213 |
| 117 | 3300025299 | Ga0209256_1005109 | Ga0209256_10051092 | 213 |
| 118 | 3300025299 | Ga0209256_1011411 | Ga0209256_10114114 | 213 |
| 119 | 3300025303 | Ga0209051_1009836 | Ga0209051_10098362 | 213 |
| 120 | 3300025304 | Ga0209257_1000378 | Ga0209257_100037831 | 213 |
| 121 | 3300025304 | Ga0209257_1002057 | Ga0209257_10020573 | 213 |
| 122 | 3300025304 | Ga0209257_1005547 | Ga0209257_10055478 | 213 |
| 123 | 3300025304 | Ga0209257_1008474 | Ga0209257_10084742 | 213 |
| 124 | 3300025899 | Ga0207642_10146054 | Ga0207642_101460541 | 213 |
| 125 | 3300025914 | Ga0207671_10006504 | Ga0207671_100065045 | 213 |
| 126 | 3300027907 | Ga0207428_10001433 | Ga0207428_1000143310 | 213 |
| 127 | 3300027907 | Ga0207428_10267061 | Ga0207428_102670612 | 213 |
| 128 | 3300028380 | Ga0268265_10214351 | Ga0268265_102143513 | 213 |
| 129 | 3300031548 | Ga0307408_100057493 | Ga0307408_1000574933 | 213 |
| 130 | 3300031901 | Ga0307406_10365953 | Ga0307406_103659532 | 213 |
| 131 | 3300031911 | Ga0307412_10123716 | Ga0307412_101237162 | 213 |
| 132 | 3300041404 | Ga0439436_0025197 | Ga0439436_0025197_54_713 | 213 |
| 133 | 3300041404 | Ga0439436_0037472 | Ga0439436_0037472_440_1099 | 213 |
| 134 | 3300041413 | Ga0439465_0001959 | Ga0439465_0001959_3570_4229 | 213 |
| 135 | 3300041413 | Ga0439465_0026696 | Ga0439465_0026696_44_703 | 213 |
| 136 | 3300041999 | Ga0439433_0025579 | Ga0439433_0025579_654_1313 | 213 |
| 137 | 3300042005 | Ga0439448_0055773 | Ga0439448_0055773_644_1285 | 213 |
| 138 | 3300042007 | Ga0439449_0002945 | Ga0439449_0002945_2319_2978 | 213 |
| 139 | 3300042007 | Ga0439449_0006265 | Ga0439449_0006265_2597_3256 | 213 |
| 140 | 3300042015 | Ga0439462_0011271 | Ga0439462_0011271_431_1090 | 213 |
| 141 | 3300046615 | Ga0495656_0002875 | Ga0495656_0002875_4848_5507 | 213 |
| 142 | 3300046691 | Ga0495670_0173739 | Ga0495670_0173739_244_903 | 213 |
| 143 | 3300047318 | Ga0495636_0020456 | Ga0495636_0020456_161_820 | 213 |
| 144 | 3300049522 | Ga0501299_005296 | Ga0501299_005296_72_713 | 213 |
| 145 | 3300049579 | Ga0501043_0063870 | Ga0501043_0063870_2202_2861 | 213 |
| 146 | 3300049679 | Ga0501249_011580 | Ga0501249_011580_928_1569 | 213 |
| 147 | 3300050507 | nmdc:mga05p37_148607_c1 | nmdc:mga05p37_148607_c1_1228_1869 | 213 |
| 148 | 3300050508 | nmdc:mga09592_3846_c1 | nmdc:mga09592_3846_c1_10664_11305 | 213 |
| 149 | 3300050510 | nmdc:mga06r32_8_c1 | nmdc:mga06r32_8_c1_10262_10903 | 213 |
| 150 | 3300050511 | nmdc:mga08y16_1386_c1 | nmdc:mga08y16_1386_c1_11588_12229 | 213 |
| 151 | 3300050511 | nmdc:mga08y16_99779_c1 | nmdc:mga08y16_99779_c1_304_945 | 213 |
| 152 | iso_pu_bacteria | 2571042365 | 2572254675 | 213 |
| 153 | 3300005458 | Ga0070681_10427034 | Ga0070681_104270342 | 214 |
| 154 | 3300006237 | Ga0097621_100226265 | Ga0097621_1002262653 | 214 |
| 155 | 3300006358 | Ga0068871_100306052 | Ga0068871_1003060523 | 214 |
| 156 | 3300037418 | Ga0395900_0110441 | Ga0395900_0110441_2020_2685 | 214 |
| 157 | 3300037466 | Ga0395898_0111340 | Ga0395898_0111340_1510_2175 | 214 |
| 158 | 3300009551 | Ga0105238_10532374 | Ga0105238_105323741 | 215 |
| 159 | 3300025924 | Ga0207694_10328648 | Ga0207694_103286482 | 215 |
| 160 | 3300028573 | Ga0265334_10000009 | Ga0265334_100000095 | 215 |
| 161 | 3300031595 | Ga0265313_10000764 | Ga0265313_1000076424 | 215 |
| 162 | 3300044694 | Ga0466963_0087294 | Ga0466963_0087294_1237_1929 | 215 |
| 163 | 2162886012 | MBSR1b_contig_11054327 | MBSR1b_0437.00004890 | 216 |
| 164 | 3300002070 | JGI24750J21931_1021598 | JGI24750J21931_10215982 | 216 |
| 165 | 3300005288 | Ga0065714_10096898 | Ga0065714_100968982 | 216 |
| 166 | 3300005290 | Ga0065712_10075743 | Ga0065712_100757432 | 216 |
| 167 | 3300005293 | Ga0065715_10098994 | Ga0065715_100989944 | 216 |
| 168 | 3300005328 | Ga0070676_10059239 | Ga0070676_100592394 | 216 |
| 169 | 3300005330 | Ga0070690_100030709 | Ga0070690_1000307094 | 216 |
| 170 | 3300005331 | Ga0070670_100004115 | Ga0070670_10000411512 | 216 |
| 171 | 3300005331 | Ga0070670_100050264 | Ga0070670_1000502643 | 216 |
| 172 | 3300005334 | Ga0068869_100002081 | Ga0068869_10000208112 | 216 |
| 173 | 3300005335 | Ga0070666_10012427 | Ga0070666_100124276 | 216 |
| 174 | 3300005336 | Ga0070680_100168911 | Ga0070680_1001689113 | 216 |
| 175 | 3300005340 | Ga0070689_100035492 | Ga0070689_1000354924 | 216 |
| 176 | 3300005343 | Ga0070687_100001650 | Ga0070687_1000016503 | 216 |
| 177 | 3300005344 | Ga0070661_100139667 | Ga0070661_1001396671 | 216 |
| 178 | 3300005344 | Ga0070661_100344550 | Ga0070661_1003445502 | 216 |
| 179 | 3300005347 | Ga0070668_100003603 | Ga0070668_1000036034 | 216 |
| 180 | 3300005347 | Ga0070668_100019852 | Ga0070668_1000198522 | 216 |
| 181 | 3300005353 | Ga0070669_100059871 | Ga0070669_1000598712 | 216 |
| 182 | 3300005354 | Ga0070675_100002911 | Ga0070675_10000291110 | 216 |
| 183 | 3300005355 | Ga0070671_100025507 | Ga0070671_1000255074 | 216 |
| 184 | 3300005356 | Ga0070674_100616473 | Ga0070674_1006164732 | 216 |
| 185 | 3300005364 | Ga0070673_100106443 | Ga0070673_1001064434 | 216 |
| 186 | 3300005367 | Ga0070667_100146902 | Ga0070667_1001469023 | 216 |
| 187 | 3300005435 | Ga0070714_100000395 | Ga0070714_1000003952 | 216 |
| 188 | 3300005435 | Ga0070714_100021904 | Ga0070714_1000219043 | 216 |
| 189 | 3300005436 | Ga0070713_100337133 | Ga0070713_1003371332 | 216 |
| 190 | 3300005438 | Ga0070701_10054844 | Ga0070701_100548443 | 216 |
| 191 | 3300005439 | Ga0070711_100098734 | Ga0070711_1000987341 | 216 |
| 192 | 3300005440 | Ga0070705_100060546 | Ga0070705_1000605463 | 216 |
| 193 | 3300005444 | Ga0070694_100409684 | Ga0070694_1004096842 | 216 |
| 194 | 3300005456 | Ga0070678_100087911 | Ga0070678_1000879112 | 216 |
| 195 | 3300005456 | Ga0070678_100467941 | Ga0070678_1004679412 | 216 |
| 196 | 3300005457 | Ga0070662_100016467 | Ga0070662_1000164674 | 216 |
| 197 | 3300005457 | Ga0070662_100096680 | Ga0070662_1000966802 | 216 |
| 198 | 3300005459 | Ga0068867_100070402 | Ga0068867_1000704022 | 216 |
| 199 | 3300005530 | Ga0070679_100596594 | Ga0070679_1005965942 | 216 |
| 200 | 3300005535 | Ga0070684_100016956 | Ga0070684_1000169564 | 216 |
| 201 | 3300005543 | Ga0070672_100172746 | Ga0070672_1001727463 | 216 |
| 202 | 3300005544 | Ga0070686_100027234 | Ga0070686_1000272344 | 216 |
| 203 | 3300005564 | Ga0070664_100002473 | Ga0070664_1000024734 | 216 |
| 204 | 3300005577 | Ga0068857_100512738 | Ga0068857_1005127382 | 216 |
| 205 | 3300005578 | Ga0068854_100189152 | Ga0068854_1001891523 | 216 |
| 206 | 3300005615 | Ga0070702_100003638 | Ga0070702_1000036386 | 216 |
| 207 | 3300005617 | Ga0068859_100014440 | Ga0068859_1000144406 | 216 |
| 208 | 3300005618 | Ga0068864_100004083 | Ga0068864_1000040834 | 216 |
| 209 | 3300005718 | Ga0068866_10336312 | Ga0068866_103363122 | 216 |
| 210 | 3300005719 | Ga0068861_100001281 | Ga0068861_10000128111 | 216 |
| 211 | 3300005719 | Ga0068861_100045077 | Ga0068861_1000450773 | 216 |
| 212 | 3300005840 | Ga0068870_10067969 | Ga0068870_100679693 | 216 |
| 213 | 3300005841 | Ga0068863_100001465 | Ga0068863_10000146513 | 216 |
| 214 | 3300005842 | Ga0068858_100202038 | Ga0068858_1002020383 | 216 |
| 215 | 3300005843 | Ga0068860_100014496 | Ga0068860_1000144963 | 216 |
| 216 | 3300005844 | Ga0068862_100000444 | Ga0068862_1000004444 | 216 |
| 217 | 3300005844 | Ga0068862_100006783 | Ga0068862_10000678310 | 216 |
| 218 | 3300006237 | Ga0097621_100231224 | Ga0097621_1002312242 | 216 |
| 219 | 3300006844 | Ga0075428_100448016 | Ga0075428_1004480161 | 216 |
| 220 | 3300006846 | Ga0075430_100051178 | Ga0075430_1000511784 | 216 |
| 221 | 3300006846 | Ga0075430_100097943 | Ga0075430_1000979432 | 216 |
| 222 | 3300006847 | Ga0075431_100094131 | Ga0075431_1000941312 | 216 |
| 223 | 3300006847 | Ga0075431_100132305 | Ga0075431_1001323053 | 216 |
| 224 | 3300006881 | Ga0068865_100067756 | Ga0068865_1000677563 | 216 |
| 225 | 3300006931 | Ga0097620_100014443 | Ga0097620_1000144436 | 216 |
| 226 | 3300009094 | Ga0111539_10020533 | Ga0111539_100205336 | 216 |
| 227 | 3300009094 | Ga0111539_10025852 | Ga0111539_100258527 | 216 |
| 228 | 3300009147 | Ga0114129_11464936 | Ga0114129_114649361 | 216 |
| 229 | 3300009148 | Ga0105243_10020398 | Ga0105243_100203982 | 216 |
| 230 | 3300009177 | Ga0105248_10004291 | Ga0105248_1000429110 | 216 |
| 231 | 3300009553 | Ga0105249_10001844 | Ga0105249_1000184410 | 216 |
| 232 | 3300009553 | Ga0105249_10009136 | Ga0105249_100091367 | 216 |
| 233 | 3300010375 | Ga0105239_10315210 | Ga0105239_103152102 | 216 |
| 234 | 3300013306 | Ga0163162_10058715 | Ga0163162_100587155 | 216 |
| 235 | 3300014325 | Ga0163163_10002210 | Ga0163163_1000221011 | 216 |
| 236 | 3300014745 | Ga0157377_10004781 | Ga0157377_100047818 | 216 |
| 237 | 3300014745 | Ga0157377_10627412 | Ga0157377_106274121 | 216 |
| 238 | 3300014969 | Ga0157376_10097948 | Ga0157376_100979484 | 216 |
| 239 | 3300025899 | Ga0207642_10216534 | Ga0207642_102165342 | 216 |
| 240 | 3300025901 | Ga0207688_10072305 | Ga0207688_100723053 | 216 |
| 241 | 3300025903 | Ga0207680_10076497 | Ga0207680_100764972 | 216 |
| 242 | 3300025907 | Ga0207645_10076703 | Ga0207645_100767033 | 216 |
| 243 | 3300025908 | Ga0207643_10033475 | Ga0207643_100334753 | 216 |
| 244 | 3300025911 | Ga0207654_10448286 | Ga0207654_104482862 | 216 |
| 245 | 3300025916 | Ga0207663_10075147 | Ga0207663_100751471 | 216 |
| 246 | 3300025918 | Ga0207662_10003875 | Ga0207662_100038759 | 216 |
| 247 | 3300025920 | Ga0207649_10020395 | Ga0207649_100203952 | 216 |
| 248 | 3300025921 | Ga0207652_10503072 | Ga0207652_105030722 | 216 |
| 249 | 3300025923 | Ga0207681_10020707 | Ga0207681_100207075 | 216 |
| 250 | 3300025925 | Ga0207650_10008769 | Ga0207650_100087692 | 216 |
| 251 | 3300025925 | Ga0207650_10113649 | Ga0207650_101136493 | 216 |
| 252 | 3300025926 | Ga0207659_10038569 | Ga0207659_100385693 | 216 |
| 253 | 3300025929 | Ga0207664_10005638 | Ga0207664_100056386 | 216 |
| 254 | 3300025931 | Ga0207644_10036242 | Ga0207644_100362424 | 216 |
| 255 | 3300025933 | Ga0207706_10007163 | Ga0207706_1000716310 | 216 |
| 256 | 3300025933 | Ga0207706_10125423 | Ga0207706_101254232 | 216 |
| 257 | 3300025936 | Ga0207670_10032220 | Ga0207670_100322204 | 216 |
| 258 | 3300025937 | Ga0207669_10009668 | Ga0207669_100096684 | 216 |
| 259 | 3300025937 | Ga0207669_10490161 | Ga0207669_104901612 | 216 |
| 260 | 3300025938 | Ga0207704_10032306 | Ga0207704_100323063 | 216 |
| 261 | 3300025941 | Ga0207711_10007133 | Ga0207711_100071338 | 216 |
| 262 | 3300025942 | Ga0207689_10004165 | Ga0207689_100041654 | 216 |
| 263 | 3300025945 | Ga0207679_10022794 | Ga0207679_100227943 | 216 |
| 264 | 3300025960 | Ga0207651_10005488 | Ga0207651_100054888 | 216 |
| 265 | 3300025961 | Ga0207712_10010651 | Ga0207712_100106516 | 216 |
| 266 | 3300025961 | Ga0207712_10413777 | Ga0207712_104137771 | 216 |
| 267 | 3300025972 | Ga0207668_10094337 | Ga0207668_100943373 | 216 |
| 268 | 3300025981 | Ga0207640_10584906 | Ga0207640_105849061 | 216 |
| 269 | 3300025986 | Ga0207658_10195892 | Ga0207658_101958922 | 216 |
| 270 | 3300026035 | Ga0207703_10949566 | Ga0207703_109495661 | 216 |
| 271 | 3300026075 | Ga0207708_10005652 | Ga0207708_100056522 | 216 |
| 272 | 3300026088 | Ga0207641_10006148 | Ga0207641_100061484 | 216 |
| 273 | 3300026089 | Ga0207648_10053692 | Ga0207648_100536923 | 216 |
| 274 | 3300026095 | Ga0207676_10004261 | Ga0207676_100042615 | 216 |
| 275 | 3300026116 | Ga0207674_10023976 | Ga0207674_100239762 | 216 |
| 276 | 3300026116 | Ga0207674_10067681 | Ga0207674_100676813 | 216 |
| 277 | 3300026118 | Ga0207675_100006523 | Ga0207675_1000065234 | 216 |
| 278 | 3300026118 | Ga0207675_100019811 | Ga0207675_1000198116 | 216 |
| 279 | 3300026121 | Ga0207683_10054487 | Ga0207683_100544873 | 216 |
| 280 | 3300026121 | Ga0207683_10401306 | Ga0207683_104013062 | 216 |
| 281 | 3300027907 | Ga0207428_10080117 | Ga0207428_100801174 | 216 |
| 282 | 3300028379 | Ga0268266_10061492 | Ga0268266_100614923 | 216 |
| 283 | 3300028380 | Ga0268265_10001375 | Ga0268265_1000137510 | 216 |
| 284 | 3300028380 | Ga0268265_10080520 | Ga0268265_100805202 | 216 |
| 285 | 3300028381 | Ga0268264_10046118 | Ga0268264_100461183 | 216 |
| 286 | 3300028573 | Ga0265334_10028966 | Ga0265334_100289663 | 216 |
| 287 | 3300028800 | Ga0265338_10058804 | Ga0265338_100588044 | 216 |
| 288 | 3300031548 | Ga0307408_100033286 | Ga0307408_1000332864 | 216 |
| 289 | 3300031548 | Ga0307408_100096448 | Ga0307408_1000964482 | 216 |
| 290 | 3300031595 | Ga0265313_10091646 | Ga0265313_100916461 | 216 |
| 291 | 3300031731 | Ga0307405_10226450 | Ga0307405_102264502 | 216 |
| 292 | 3300031901 | Ga0307406_10133809 | Ga0307406_101338092 | 216 |
| 293 | 3300031911 | Ga0307412_10109501 | Ga0307412_101095012 | 216 |
| 294 | 3300031995 | Ga0307409_100683247 | Ga0307409_1006832472 | 216 |
| 295 | 3300032002 | Ga0307416_100465322 | Ga0307416_1004653222 | 216 |
| 296 | 3300032004 | Ga0307414_10124782 | Ga0307414_101247823 | 216 |
| 297 | 3300032126 | Ga0307415_100738819 | Ga0307415_1007388191 | 216 |
| 298 | 3300034819 | Ga0373958_0012852 | Ga0373958_0012852_504_1154 | 216 |
| 299 | 3300035398 | Ga0316574_0039268 | Ga0316574_0039268_1928_2626 | 216 |
| 300 | 3300035398 | Ga0316574_0058675 | Ga0316574_0058675_1641_2342 | 216 |
| 301 | 3300035695 | Ga0373927_0000003 | Ga0373927_0000003_467412_468113 | 216 |
| 302 | 3300037312 | Ga0395899_0225912 | Ga0395899_0225912_332_1024 | 216 |
| 303 | 3300041441 | Ga0451787_162886 | Ga0451787_162886_1092_1757 | 216 |
| 304 | 3300041443 | Ga0451789_0831714 | Ga0451789_0831714_593_1258 | 216 |
| 305 | 3300041451 | Ga0451791_0059521 | Ga0451791_0059521_3367_4032 | 216 |
| 306 | 3300041456 | Ga0451795_0506400 | Ga0451795_0506400_72_737 | 216 |
| 307 | 3300041460 | Ga0451802_1944768 | Ga0451802_1944768_659_1324 | 216 |
| 308 | 3300041491 | Ga0451833_0081663 | Ga0451833_0081663_1446_2111 | 216 |
| 309 | 3300041494 | Ga0451837_1530162 | Ga0451837_1530162_300_965 | 216 |
| 310 | 3300042011 | Ga0439454_042818 | Ga0439454_042818_48_713 | 216 |
| 311 | 3300045051 | Ga0451576_0010878 | Ga0451576_0010878_9552_10202 | 216 |
| 312 | 3300046473 | Ga0495582_0303902 | Ga0495582_0303902_131_808 | 216 |
| 313 | 3300048907 | Ga0496104_0055561 | Ga0496104_0055561_64_714 | 216 |
| 314 | 3300048909 | Ga0496106_0014465 | Ga0496106_0014465_2134_2784 | 216 |
| 315 | 3300048911 | Ga0496108_0586775 | Ga0496108_0586775_63_713 | 216 |
| 316 | 3300048914 | Ga0496111_0054771 | Ga0496111_0054771_1462_2112 | 216 |
| 317 | 3300049584 | Ga0501068_0141116 | Ga0501068_0141116_779_1450 | 216 |
| 318 | 3300050509 | nmdc:mga0qj67_48925_c1 | nmdc:mga0qj67_48925_c1_1624_2274 | 216 |
| 319 | 3300050509 | nmdc:mga0qj67_79920_c1 | nmdc:mga0qj67_79920_c1_1463_2128 | 216 |
| 320 | 3300050510 | nmdc:mga06r32_236551_c1 | nmdc:mga06r32_236551_c1_489_1139 | 216 |
| 321 | 3300050510 | nmdc:mga06r32_391754_c1 | nmdc:mga06r32_391754_c1_442_1092 | 216 |
| 322 | 3300050511 | nmdc:mga08y16_10318_c1 | nmdc:mga08y16_10318_c1_5541_6206 | 216 |
| 323 | 3300050511 | nmdc:mga08y16_61850_c1 | nmdc:mga08y16_61850_c1_2018_2668 | 216 |
| 324 | 3300050512 | nmdc:mga0n895_685581_c1 | nmdc:mga0n895_685581_c1_194_844 | 216 |
| 325 | 3300053120 | Ga0500597_139169 | Ga0500597_139169_220_903 | 216 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zbe-assembly1.cif.gz_A | crystal structure of aere from microcystis aeruginosa | 0.8329 | 101 | 207 |
| 4e2g-assembly2.cif.gz_C | crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus | 0.7748 | 102 | 205 |
| 3bvc-assembly1.cif.gz_A | crystal structure of uncharacterized protein ism_01780 from roseovarius nubinhibens ism | 0.7662 | 4 | 206 |
| 6l9i-assembly1.cif.gz_A | crystal structure of lactobacillus farciminis oxalate decarboxylase formate complex | 0.7557 | 102 | 216 |
| 3bvc-assembly1.cif.gz_A | crystal structure of uncharacterized protein ism_01780 from roseovarius nubinhibens ism | 0.7532 | 4 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0I0F2_21_185_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8353 | 104 | 203 | 2.60.120.10 |
| af_Q59013_3_123_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8199 | 102 | 207 | 2.60.120.10 |
| af_A0A0R0EIG9_21_186_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7555 | 102 | 214 | 2.60.120.10 |
| 2vqaB02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7543 | 102 | 205 | 2.60.120.10 |
| 4b29A00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7495 | 102 | 204 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I5AMK1-F1-model_v4 | 2OG-Fe(II) oxygenase superfamily protein | 0.9785 | 1 | 210 |
|
| AF-A0A7W3TKN5-F1-model_v4 | JmjC domain-containing protein | 0.9774 | 1 | 213 |
|
| AF-A0A355VDF0-F1-model_v4 | Fe2OG dioxygenase domain-containing protein | 0.968 | 1 | 210 |
|
| AF-A0A521HMS0-F1-model_v4 | JmjC domain-containing protein | 0.9664 | 1 | 212 |
|
| AF-A0A368NI42-F1-model_v4 | JmjC domain-containing protein | 0.9663 | 2 | 209 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar