F407637

General Info

Members Datasets Scaffolds Average Seq Length
325 199 289 212

Family's Representative Sequence

Representative Sequence 3300002459|JGI24751J29686_10000487|JGI24751J29686_100004875
Length 210
Sequence MCNLYTIRKSAAEVAAHFGVSDPTQSNAPEEVYPGYPGLVVREQDGARVMQSMAWGFPLRLKGMSPTAKPKPVNNIADLAKPMWKGLACLVPVTHFAEAEGPKGAKTRTWFNVKDVPIFAWAGLWRISDEWGPVYSGAMTDCNEAIRPVHDRMPVLLHADEYDQWLHGTFEDTLAFQQRCFPDDLIELQRTSELWVKRKVAASAVEPSLL

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
5 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
6 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
7 2643221718 Rhizobium sp. Root268 Isolate Unclassified
8 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
9 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
10 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
11 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
12 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
13 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
14 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
15 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
16 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
17 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
18 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
19 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
20 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
21 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
22 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
23 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
24 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
25 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
26 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
27 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
28 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
29 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
30 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
31 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
32 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
33 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
40 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
174 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
175 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
179 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
180 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
181 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
182 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
185 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
186 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
187 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
188 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
189 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
196 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
197 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
198 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
199 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.92
Metatranscriptomes 0
Isolates 11.08

Biome Distribution

Category Percentage (%)
Aerial Root 0.31
Bulb 0
Endosphere 18.77
Nodule 5.23
Rhizoplane 0.62
Rhizosphere 58.15
Stem 0
Stem Tuber 0
Unclassified 16.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10001812 3300002075 Bacteria 5797
2 JGI24751J29686_10000487 3300002459 Bacteria 11754
3 JGI25152J39213_1000158 3300002773 Bacteria 46003
4 JGI25153J46596_10000242 3300003215 Bacteria 46003
5 JGI25153J46596_10060106 3300003215 Unclassified 1037
6 JGI25153J46596_10065305 3300003215 Bacteria 967
7 rootH1_10068002 3300003316 Bacteria 2301
8 rootH1_10077980 3300003316 Unclassified 2220
9 rootH2_10184542 3300003320 Bacteria 1614
10 Ga0055542_1000115 3300003762 Bacteria 106506
11 Ga0055542_1009568 3300003762 Bacteria 1820
12 Ga0055529_1000052 3300003763 Bacteria 203029
13 Ga0055529_1004298 3300003763 Bacteria 2183
14 Ga0055524_1001546 3300003775 Bacteria 12987
15 Ga0055536_1006207 3300003781 Bacteria 5644
16 Ga0055528_1000018 3300003790 Bacteria 155302
17 Ga0055528_1003337 3300003790 Bacteria 8128
18 Ga0055528_1009476 3300003790 Bacteria 4062
19 Ga0055540_1002544 3300003792 Bacteria 9507
20 Ga0055531_10002695 3300003794 Bacteria 11699
21 Ga0055531_10003780 3300003794 Bacteria 9507
22 Ga0055531_10005602 3300003794 Bacteria 7313
23 Ga0055543_1018388 3300004625 Bacteria 1304
24 Ga0065165_1012488 3300005262 Bacteria 3455
25 Ga0070658_10039621 3300005327 Bacteria 3801
26 Ga0070670_100004404 3300005331 Bacteria 11792
27 Ga0070670_100072816 3300005331 Bacteria 2951
28 Ga0068869_100006884 3300005334 Bacteria 7232
29 Ga0070666_10054890 3300005335 Bacteria 2688
30 Ga0070660_100082530 3300005339 Bacteria 2524
31 Ga0070661_100457751 3300005344 Bacteria 1016
32 Ga0070668_100002824 3300005347 Bacteria 12786
33 Ga0070668_100032613 3300005347 Bacteria 3964
34 Ga0070669_100013377 3300005353 Bacteria 5834
35 Ga0070669_100024515 3300005353 Bacteria 4325
36 Ga0070674_100000127 3300005356 Bacteria 34879
37 Ga0070659_100109414 3300005366 Bacteria 2230
38 Ga0070667_100000103 3300005367 Bacteria 107232
39 Ga0070663_100169116 3300005455 Bacteria 1688
40 Ga0070678_100000068 3300005456 Bacteria 38359
41 Ga0070662_100271954 3300005457 Bacteria 1368
42 Ga0070684_100215721 3300005535 Bacteria 1750
43 Ga0070697_100422131 3300005536 Bacteria 1159
44 Ga0070665_100003036 3300005548 Bacteria 18089
45 Ga0068855_100001788 3300005563 Bacteria 26857
46 Ga0068855_100002167 3300005563 Bacteria 24277
47 Ga0068855_100023295 3300005563 Bacteria 7416
48 Ga0068855_100351900 3300005563 Bacteria 1622
49 Ga0068855_100531956 3300005563 Bacteria 1274
50 Ga0068855_100626205 3300005563 Bacteria 1158
51 Ga0068857_100013959 3300005577 Bacteria 6989
52 Ga0068857_100050479 3300005577 Bacteria 3690
53 Ga0068857_100067074 3300005577 Bacteria 3193
54 Ga0068854_100000257 3300005578 Bacteria 36219
55 Ga0068854_100002569 3300005578 Bacteria 11240
56 Ga0068856_100777289 3300005614 Bacteria 977
57 Ga0068852_100000494 3300005616 Bacteria 25800
58 Ga0068852_100001573 3300005616 Bacteria 15503
59 Ga0068852_100131495 3300005616 Unclassified 2305
60 Ga0068859_100760935 3300005617 Unclassified 1057
61 Ga0068864_100004245 3300005618 Bacteria 11792
62 Ga0068863_100000377 3300005841 Bacteria 45378
63 Ga0068863_100003498 3300005841 Bacteria 15499
64 Ga0068858_100006756 3300005842 Bacteria 11164
65 Ga0068860_100179939 3300005843 Bacteria 2044
66 Ga0068862_100000135 3300005844 Bacteria 85248
67 Ga0068862_100099969 3300005844 Bacteria 2536
68 Ga0068871_100034956 3300006358 Bacteria 3991
69 Ga0097620_100760787 3300006931 Unclassified 1057
70 Ga0105240_10000052 3300009093 Bacteria 232583
71 Ga0105240_10001137 3300009093 Bacteria 46577
72 Ga0105240_10004459 3300009093 Bacteria 21343
73 Ga0105240_10005423 3300009093 Bacteria 19011
74 Ga0105240_10010628 3300009093 Bacteria 12931
75 Ga0105240_10014957 3300009093 Bacteria 10572
76 Ga0105240_10363701 3300009093 Bacteria 1638
77 Ga0105240_11188227 3300009093 Unclassified 808
78 Ga0105241_10514511 3300009174 Bacteria 1069
79 Ga0105248_10010850 3300009177 Bacteria 10057
80 Ga0105248_10020012 3300009177 Bacteria 7410
81 Ga0105248_10141442 3300009177 Plasmid 2715
82 Ga0105248_10340121 3300009177 Bacteria 1690
83 Ga0105237_10000775 3300009545 Bacteria 43719
84 Ga0105237_10016164 3300009545 Bacteria 7763
85 Ga0105237_10019031 3300009545 Bacteria 7098
86 Ga0105237_10184133 3300009545 Bacteria 2088
87 Ga0105238_10000077 3300009551 Bacteria 110207
88 Ga0105238_10002182 3300009551 Bacteria 19769
89 Ga0105239_10000065 3300010375 Bacteria 151224
90 Ga0105239_10000196 3300010375 Bacteria 88069
91 Ga0105239_10004881 3300010375 Bacteria 15872
92 Ga0105239_10019352 3300010375 Bacteria 7519
93 Ga0105239_10085536 3300010375 Bacteria 3475
94 Ga0105239_10664193 3300010375 Bacteria 1191
95 Ga0157373_10037403 3300013100 Bacteria 3479
96 Ga0157373_10047682 3300013100 Bacteria 3055
97 Ga0157371_10000011 3300013102 Bacteria 377608
98 Ga0157371_10000024 3300013102 Bacteria 281202
99 Ga0157370_10000054 3300013104 Bacteria 118718
100 Ga0157374_10007062 3300013296 Bacteria 9561
101 Ga0157374_10214709 3300013296 Bacteria 1887
102 Ga0157372_10004796 3300013307 Bacteria 14367
103 Ga0163161_10041908 3300017792 Bacteria 3291
104 Ga0209674_107571 3300025226 Bacteria 1358
105 Ga0207425_1000076 3300025245 Bacteria 106313
106 Ga0209677_107965 3300025253 Bacteria 2138
107 Ga0209148_1000011 3300025254 Bacteria 1196503
108 Ga0209148_1003492 3300025254 Bacteria 4314
109 Ga0209129_1000280 3300025258 Bacteria 48435
110 Ga0209129_1000295 3300025258 Bacteria 46972
111 Ga0209455_1000006 3300025272 Bacteria 1196503
112 Ga0209455_1000734 3300025272 Bacteria 18804
113 Ga0209455_1007960 3300025272 Bacteria 2933
114 Ga0209673_1000055 3300025273 Bacteria 272768
115 Ga0209673_1000468 3300025273 Bacteria 68029
116 Ga0209673_1002034 3300025273 Bacteria 15376
117 Ga0209676_1002994 3300025292 Bacteria 10994
118 Ga0209025_1016194 3300025294 Bacteria 4424
119 Ga0209758_1000168 3300025297 Bacteria 150965
120 Ga0209758_1000752 3300025297 Bacteria 46978
121 Ga0209758_1006302 3300025297 Bacteria 8618
122 Ga0209050_1005678 3300025298 Bacteria 7715
123 Ga0209256_1000147 3300025299 Bacteria 149002
124 Ga0209256_1031596 3300025299 Bacteria 1446
125 Ga0209051_1000192 3300025303 Bacteria 108667
126 Ga0209051_1003167 3300025303 Bacteria 11025
127 Ga0209257_1000300 3300025304 Bacteria 108786
128 Ga0209257_1000319 3300025304 Bacteria 100552
129 Ga0209257_1005001 3300025304 Bacteria 9672
130 Ga0209257_1031043 3300025304 Bacteria 1715
131 Ga0209257_1045806 3300025304 Bacteria 1268
132 Ga0207697_10189256 3300025315 Bacteria 903
133 Ga0207710_10418797 3300025900 Bacteria 689
134 Ga0207688_10334653 3300025901 Bacteria 931
135 Ga0207680_10075863 3300025903 Bacteria 2098
136 Ga0207647_10052510 3300025904 Bacteria 2516
137 Ga0207705_10081349 3300025909 Bacteria 2361
138 Ga0207695_10000122 3300025913 Bacteria 232677
139 Ga0207695_10000383 3300025913 Bacteria 100354
140 Ga0207695_10006147 3300025913 Bacteria 15657
141 Ga0207695_10008640 3300025913 Bacteria 12714
142 Ga0207695_10145651 3300025913 Bacteria 2313
143 Ga0207671_10000861 3300025914 Bacteria 38444
144 Ga0207671_10001293 3300025914 Bacteria 29404
145 Ga0207657_10119644 3300025919 Bacteria 2167
146 Ga0207657_10193503 3300025919 Bacteria 1639
147 Ga0207649_10123595 3300025920 Bacteria 1748
148 Ga0207681_10009741 3300025923 Bacteria 5879
149 Ga0207681_10016719 3300025923 Bacteria 4596
150 Ga0207694_10000282 3300025924 Bacteria 47859
151 Ga0207694_10007888 3300025924 Bacteria 8063
152 Ga0207650_10002916 3300025925 Bacteria 11806
153 Ga0207650_10089787 3300025925 Bacteria 2346
154 Ga0207706_10249026 3300025933 Bacteria 1552
155 Ga0207669_10000035 3300025937 Bacteria 81855
156 Ga0207711_10001781 3300025941 Bacteria 19721
157 Ga0207711_10009739 3300025941 Bacteria 7995
158 Ga0207711_10348268 3300025941 Bacteria 1371
159 Ga0207689_10000704 3300025942 Bacteria 32031
160 Ga0207667_10000002 3300025949 Bacteria 895662
161 Ga0207667_10000220 3300025949 Bacteria 80179
162 Ga0207667_10006009 3300025949 Bacteria 14774
163 Ga0207667_10296486 3300025949 Bacteria 1652
164 Ga0207712_10002983 3300025961 Bacteria 10805
165 Ga0207668_10000541 3300025972 Bacteria 23747
166 Ga0207668_10012170 3300025972 Bacteria 5258
167 Ga0207668_10018668 3300025972 Bacteria 4370
168 Ga0207640_10000369 3300025981 Bacteria 29179
169 Ga0207640_10012298 3300025981 Bacteria 4870
170 Ga0207658_10000080 3300025986 Bacteria 107226
171 Ga0207703_10005384 3300026035 Bacteria 10306
172 Ga0207639_10000381 3300026041 Bacteria 30545
173 Ga0207678_10645720 3300026067 Bacteria 929
174 Ga0207702_10541710 3300026078 Bacteria 1138
175 Ga0207702_10563243 3300026078 Bacteria 1115
176 Ga0207641_10000014 3300026088 Bacteria 336170
177 Ga0207641_10004228 3300026088 Bacteria 12517
178 Ga0207676_10000041 3300026095 Bacteria 166172
179 Ga0207674_10000167 3300026116 Bacteria 78909
180 Ga0207674_10030602 3300026116 Bacteria 5658
181 Ga0207683_10001436 3300026121 Bacteria 21554
182 Ga0207698_10001137 3300026142 Bacteria 15503
183 Ga0207698_10029600 3300026142 Bacteria 3925
184 Ga0207698_10083796 3300026142 Bacteria 2582
185 Ga0268266_10004368 3300028379 Bacteria 13582
186 Ga0268266_10050860 3300028379 Bacteria 3556
187 Ga0268265_10000152 3300028380 Bacteria 85229
188 Ga0268265_10352426 3300028380 Bacteria 1344
189 Ga0268264_10140236 3300028381 Bacteria 2155
190 Ga0307513_10053357 3300031456 Bacteria 4346
191 Ga0307513_10099676 3300031456 Bacteria 2932
192 Ga0307408_100907785 3300031548 Bacteria 807
193 Ga0307412_10001590 3300031911 Bacteria 12505
194 Ga0307412_10001831 3300031911 Bacteria 11787
195 Ga0373927_0348907 3300035695 Bacteria 975
196 Ga0395901_0348059 3300038443 Bacteria 1530
197 Ga0436365_0943179 3300039437 Bacteria 1079
198 Ga0439465_0001484 3300041413 Bacteria 7608
199 Ga0451853_0542393 3300041512 Bacteria 849
200 Ga0466966_0145512 3300044684 Unclassified 1447
201 Ga0466961_0012474 3300044693 Bacteria 5438
202 Ga0466970_0106185 3300044765 Unclassified 1532
203 Ga0466958_0024894 3300045836 Bacteria 3524
204 Ga0495650_0001705 3300046471 Bacteria 20193
205 Ga0495620_0012352 3300046515 Bacteria 4418
206 Ga0495632_0151687 3300046519 Bacteria 1071
207 Ga0495643_0000336 3300046522 Bacteria 64049
208 Ga0495643_0000557 3300046522 Bacteria 46202
209 Ga0495643_0006596 3300046522 Bacteria 7629
210 Ga0495643_0007890 3300046522 Bacteria 6800
211 Ga0495668_0207585 3300046616 Bacteria 1072
212 Ga0495611_0183910 3300046648 Bacteria 976
213 Ga0495625_0004505 3300046660 Bacteria 13145
214 Ga0495625_0012447 3300046660 Bacteria 6894
215 Ga0495669_0000160 3300046684 Bacteria 42951
216 Ga0495660_0010122 3300046810 Bacteria 5482
217 Ga0495683_0082965 3300047323 Bacteria 1561
218 Ga0495683_0143570 3300047323 Bacteria 1116
219 Ga0495681_0064248 3300047470 Unclassified 1682
220 Ga0495686_0000162 3300047472 Bacteria 126699
221 Ga0495686_0000836 3300047472 Bacteria 39550
222 Ga0495686_0010184 3300047472 Bacteria 6704
223 Ga0495686_0010960 3300047472 Bacteria 6418
224 Ga0495686_0190166 3300047472 Bacteria 1184
225 Ga0496108_0004624 3300048911 Bacteria 11093
226 Ga0496113_0121868 3300048916 Bacteria 2039
227 Ga0496116_0222095 3300048919 Bacteria 967
228 Ga0496117_0000105 3300048920 Bacteria 188970
229 Ga0496117_0077470 3300048920 Bacteria 2200
230 Ga0496118_0000168 3300048921 Bacteria 118938
231 Ga0496118_0021411 3300048921 Bacteria 5691
232 Ga0496119_0000443 3300048922 Bacteria 56795
233 Ga0496120_0000818 3300048923 Bacteria 44506
234 Ga0496121_0014288 3300048924 Bacteria 8442
235 Ga0496121_0057953 3300048924 Bacteria 3206
236 Ga0496121_0153091 3300048924 Bacteria 1694
237 Ga0496121_0172531 3300048924 Bacteria 1569
238 Ga0496121_0280098 3300048924 Bacteria 1141
239 Ga0496121_0341376 3300048924 Bacteria 1001
240 Ga0496122_0000426 3300048925 Bacteria 89190
241 Ga0496122_0000868 3300048925 Bacteria 56966
242 Ga0496122_0013447 3300048925 Bacteria 8010
243 Ga0496122_0143500 3300048925 Bacteria 1489
244 Ga0496122_0225990 3300048925 Unclassified 1069
245 Ga0496123_0000682 3300048926 Bacteria 55995
246 Ga0496123_0008238 3300048926 Bacteria 9608
247 Ga0496123_0016571 3300048926 Bacteria 5975
248 Ga0496123_0032108 3300048926 Bacteria 3809
249 Ga0496123_0076339 3300048926 Bacteria 2063
250 Ga0496123_0099323 3300048926 Bacteria 1699
251 Ga0496123_0137952 3300048926 Bacteria 1339
252 Ga0496124_0003197 3300048927 Bacteria 20225
253 Ga0496124_0163874 3300048927 Bacteria 1730
254 Ga0496124_0285766 3300048927 Bacteria 1200
255 Ga0496125_0000039 3300048928 Bacteria 318665
256 Ga0496125_0010644 3300048928 Bacteria 9287
257 Ga0496125_0261256 3300048928 Bacteria 1085
258 Ga0496125_0362199 3300048928 Bacteria 862
259 Ga0496125_0369846 3300048928 Bacteria 849
260 Ga0496126_0002217 3300048929 Bacteria 26907
261 Ga0496126_0002653 3300048929 Bacteria 23704
262 Ga0496126_0003249 3300048929 Bacteria 20773
263 Ga0496126_0007057 3300048929 Bacteria 12377
264 Ga0501290_007464 3300049513 Bacteria 1370
265 Ga0501292_000073 3300049515 Bacteria 20076
266 Ga0501299_076132 3300049522 Bacteria 737
267 Ga0501038_0460325 3300049574 Bacteria 977
268 Ga0501047_0157524 3300049581 Bacteria 2144
269 Ga0501224_007590 3300049664 Bacteria 1581
270 Ga0501227_047174 3300049665 Bacteria 1079
271 Ga0501249_000114 3300049679 Bacteria 24796
272 Ga0501241_000780 3300049758 Bacteria 6740
273 Ga0501279_000025 3300049775 Bacteria 44341
274 Ga0501044_0001201 3300049823 Bacteria 30718
275 Ga0501204_000714 3300049850 Bacteria 3028
276 Ga0500610_0000042 3300053079 Bacteria 41981
277 Ga0500578_0069513 3300053086 Bacteria 2244
278 Ga0500569_000750 3300053109 Bacteria 5675
279 Ga0500594_0046082 3300053118 Bacteria 1212
280 Ga0500658_0012885 3300053134 Bacteria 3089
281 Ga0500658_0123043 3300053134 Unclassified 1151
282 Ga0500559_0007035 3300053136 Bacteria 5025
283 Ga0500604_0109169 3300053151 Bacteria 918
284 Ga0500616_0000120 3300053153 Bacteria 142980
285 Ga0500616_0000716 3300053153 Bacteria 38440
286 Ga0500616_0017346 3300053153 Bacteria 4084
287 Ga0500570_000100 3300053724 Bacteria 24572
288 Ga0500645_000934 3300053730 Bacteria 16677
289 Ga0500596_004265 3300053735 Bacteria 2642

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049513 Ga0501290_007464 Ga0501290_007464_48_623 189
2 3300005563 Ga0068855_100531956 Ga0068855_1005319562 190
3 3300009093 Ga0105240_10010628 Ga0105240_100106287 190
4 3300010375 Ga0105239_10004881 Ga0105239_1000488113 190
5 3300025913 Ga0207695_10008640 Ga0207695_1000864011 190
6 iso_pu_bacteria 2883577096 2883578593 194
7 3300044684 Ga0466966_0145512 Ga0466966_0145512_161_757 197
8 3300044765 Ga0466970_0106185 Ga0466970_0106185_921_1517 197
9 3300045836 Ga0466958_0024894 Ga0466958_0024894_1213_1809 197
10 iso_pu_bacteria 2512564014 2512645926 197
11 3300025949 Ga0207667_10000002 Ga0207667_10000002725 198
12 3300005356 Ga0070674_100000127 Ga0070674_10000012728 199
13 3300005456 Ga0070678_100000068 Ga0070678_10000006816 199
14 3300026121 Ga0207683_10001436 Ga0207683_1000143613 199
15 3300031456 Ga0307513_10099676 Ga0307513_100996761 200
16 3300046522 Ga0495643_0000557 Ga0495643_0000557_31182_31784 200
17 3300005347 Ga0070668_100032613 Ga0070668_1000326133 202
18 3300005844 Ga0068862_100099969 Ga0068862_1000999692 202
19 3300009177 Ga0105248_10141442 Ga0105248_101414422 202
20 3300025923 Ga0207681_10009741 Ga0207681_100097413 202
21 3300025941 Ga0207711_10348268 Ga0207711_103482682 202
22 3300025972 Ga0207668_10018668 Ga0207668_100186684 202
23 3300028380 Ga0268265_10352426 Ga0268265_103524262 202
24 3300048927 Ga0496124_0285766 Ga0496124_0285766_84_710 202
25 3300005455 Ga0070663_100169116 Ga0070663_1001691162 204
26 3300005457 Ga0070662_100271954 Ga0070662_1002719543 204
27 3300005535 Ga0070684_100215721 Ga0070684_1002157212 204
28 3300005563 Ga0068855_100002167 Ga0068855_1000021672 204
29 3300005578 Ga0068854_100002569 Ga0068854_10000256916 204
30 3300005616 Ga0068852_100000494 Ga0068852_10000049429 204
31 3300009093 Ga0105240_10000052 Ga0105240_10000052183 204
32 3300009093 Ga0105240_10001137 Ga0105240_1000113741 204
33 3300010375 Ga0105239_10000196 Ga0105239_1000019625 204
34 3300013100 Ga0157373_10037403 Ga0157373_100374033 204
35 3300025226 Ga0209674_107571 Ga0209674_1075712 204
36 3300025253 Ga0209677_107965 Ga0209677_1079653 204
37 3300025913 Ga0207695_10000122 Ga0207695_1000012235 204
38 3300025913 Ga0207695_10000383 Ga0207695_1000038358 204
39 3300025919 Ga0207657_10119644 Ga0207657_101196442 204
40 3300025933 Ga0207706_10249026 Ga0207706_102490261 204
41 3300025949 Ga0207667_10000220 Ga0207667_100002208 204
42 3300025981 Ga0207640_10012298 Ga0207640_100122983 204
43 3300026041 Ga0207639_10000381 Ga0207639_100003816 204
44 3300026067 Ga0207678_10645720 Ga0207678_106457202 204
45 3300026142 Ga0207698_10029600 Ga0207698_100296004 204
46 3300046522 Ga0495643_0000336 Ga0495643_0000336_1835_2449 204
47 3300046648 Ga0495611_0183910 Ga0495611_0183910_28_642 204
48 3300046660 Ga0495625_0004505 Ga0495625_0004505_9487_10101 204
49 3300048925 Ga0496122_0143500 Ga0496122_0143500_187_801 204
50 3300048926 Ga0496123_0032108 Ga0496123_0032108_461_1075 204
51 3300048927 Ga0496124_0163874 Ga0496124_0163874_604_1218 204
52 3300048928 Ga0496125_0261256 Ga0496125_0261256_166_780 204
53 3300049515 Ga0501292_000073 Ga0501292_000073_3060_3680 204
54 3300049522 Ga0501299_076132 Ga0501299_076132_83_715 204
55 3300049664 Ga0501224_007590 Ga0501224_007590_64_696 204
56 3300049665 Ga0501227_047174 Ga0501227_047174_57_689 204
57 3300049679 Ga0501249_000114 Ga0501249_000114_7665_8297 204
58 3300049775 Ga0501279_000025 Ga0501279_000025_27325_27945 204
59 3300049850 Ga0501204_000714 Ga0501204_000714_395_1027 204
60 3300005366 Ga0070659_100109414 Ga0070659_1001094143 205
61 3300005563 Ga0068855_100023295 Ga0068855_1000232959 205
62 3300005616 Ga0068852_100001573 Ga0068852_10000157313 205
63 3300010375 Ga0105239_10085536 Ga0105239_100855367 205
64 3300025901 Ga0207688_10334653 Ga0207688_103346531 205
65 3300025914 Ga0207671_10000861 Ga0207671_1000086123 205
66 3300025937 Ga0207669_10000035 Ga0207669_1000003558 205
67 3300025949 Ga0207667_10006009 Ga0207667_1000600918 205
68 3300026142 Ga0207698_10001137 Ga0207698_1000113711 205
69 3300047470 Ga0495681_0064248 Ga0495681_0064248_491_1108 205
70 3300049581 Ga0501047_0157524 Ga0501047_0157524_785_1408 206
71 3300049823 Ga0501044_0001201 Ga0501044_0001201_17186_17809 206
72 3300005841 Ga0068863_100003498 Ga0068863_10000349815 207
73 3300026088 Ga0207641_10004228 Ga0207641_100042288 207
74 3300005353 Ga0070669_100024515 Ga0070669_1000245154 208
75 3300005563 Ga0068855_100001788 Ga0068855_10000178816 208
76 3300005616 Ga0068852_100131495 Ga0068852_1001314952 208
77 3300025272 Ga0209455_1007960 Ga0209455_10079602 208
78 3300026142 Ga0207698_10083796 Ga0207698_100837962 208
79 3300047323 Ga0495683_0143570 Ga0495683_0143570_33_659 208
80 3300009545 Ga0105237_10016164 Ga0105237_100161643 209
81 3300010375 Ga0105239_10019352 Ga0105239_100193526 209
82 3300013102 Ga0157371_10000024 Ga0157371_1000002452 209
83 3300013307 Ga0157372_10004796 Ga0157372_100047968 209
84 iso_pu_bacteria 2510917026 2511170329 209
85 iso_pu_bacteria 2615840698 2616550834 209
86 iso_pu_bacteria 2643221643 2644238336 209
87 iso_pu_bacteria 2643221689 2644501555 209
88 iso_pu_bacteria 2643221718 2644651503 209
89 iso_pu_bacteria 2818991461 2819689133 209
90 iso_pu_bacteria 2821123053 2821129757 209
91 iso_pu_bacteria 2899845264 2899848184 209
92 iso_pu_bacteria 2933594066 2933598858 209
93 iso_pu_bacteria 2979089926 2979091904 209
94 iso_pu_bacteria 2979095461 2979100881 209
95 iso_pu_bacteria 2984587000 2984589014 209
96 iso_pu_bacteria 8005619151 8005626095 209
97 iso_pu_bacteria 8005688590 8005689597 209
98 iso_pu_bacteria 8024486573 8024486772 209
99 3300002459 JGI24751J29686_10000487 JGI24751J29686_100004875 210
100 3300003762 Ga0055542_1000115 Ga0055542_100011568 210
101 3300003763 Ga0055529_1000052 Ga0055529_1000052115 210
102 3300005331 Ga0070670_100004404 Ga0070670_1000044048 210
103 3300005344 Ga0070661_100457751 Ga0070661_1004577511 210
104 3300005577 Ga0068857_100067074 Ga0068857_1000670743 210
105 3300005618 Ga0068864_100004245 Ga0068864_1000042458 210
106 3300009174 Ga0105241_10514511 Ga0105241_105145112 210
107 3300009177 Ga0105248_10340121 Ga0105248_103401212 210
108 3300025254 Ga0209148_1000011 Ga0209148_1000011434 210
109 3300025272 Ga0209455_1000006 Ga0209455_1000006760 210
110 3300025920 Ga0207649_10123595 Ga0207649_101235953 210
111 3300025925 Ga0207650_10002916 Ga0207650_100029165 210
112 3300026095 Ga0207676_10000041 Ga0207676_10000041141 210
113 3300026116 Ga0207674_10000167 Ga0207674_1000016763 210
114 3300046471 Ga0495650_0001705 Ga0495650_0001705_14145_14777 210
115 3300053079 Ga0500610_0000042 Ga0500610_0000042_20759_21391 210
116 3300053735 Ga0500596_004265 Ga0500596_004265_715_1347 210
117 iso_pu_bacteria 2724679232 2725949110 210
118 iso_pu_bacteria 2775507266 2778179742 210
119 iso_pu_bacteria 2775507266 2778180048 210
120 iso_pu_bacteria 2838680041 2838683572 210
121 iso_pu_bacteria 2838694306 2838696162 210
122 iso_pu_bacteria 2838707686 2838710600 210
123 iso_pu_bacteria 2842077413 2842078773 210
124 iso_pu_bacteria 2842118031 2842118718 210
125 iso_pu_bacteria 2842237096 2842240628 210
126 iso_pu_bacteria 2842291075 2842292435 210
127 iso_pu_bacteria 2842370503 2842372158 210
128 iso_pu_bacteria 2842377471 2842378832 210
129 iso_pu_bacteria 2842384541 2842385228 210
130 iso_pu_bacteria 2919100787 2919105056 210
131 iso_pu_bacteria 2935894831 2935897131 210
132 3300005844 Ga0068862_100000135 Ga0068862_10000013566 211
133 3300009545 Ga0105237_10019031 Ga0105237_1001903112 211
134 3300028379 Ga0268266_10050860 Ga0268266_100508604 211
135 3300028380 Ga0268265_10000152 Ga0268265_1000015214 211
136 3300046522 Ga0495643_0006596 Ga0495643_0006596_6702_7337 211
137 3300048916 Ga0496113_0121868 Ga0496113_0121868_776_1423 211
138 3300048926 Ga0496123_0099323 Ga0496123_0099323_635_1282 211
139 iso_pu_bacteria 2582581305 2585263750 211
140 iso_pu_bacteria 3005416602 3005419143 211
141 3300009093 Ga0105240_10363701 Ga0105240_103637012 212
142 3300025900 Ga0207710_10418797 Ga0207710_104187971 212
143 3300031456 Ga0307513_10053357 Ga0307513_100533573 212
144 3300031911 Ga0307412_10001831 Ga0307412_100018318 212
145 3300048929 Ga0496126_0002653 Ga0496126_0002653_21516_22172 212
146 iso_pu_bacteria 2821123053 2821129912 212
147 iso_pu_bacteria 8057101203 8057104553 212
148 3300002773 JGI25152J39213_1000158 JGI25152J39213_100015855 213
149 3300003215 JGI25153J46596_10000242 JGI25153J46596_100002427 213
150 3300003215 JGI25153J46596_10065305 JGI25153J46596_100653052 213
151 3300003781 Ga0055536_1006207 Ga0055536_10062072 213
152 3300003792 Ga0055540_1002544 Ga0055540_10025442 213
153 3300003794 Ga0055531_10002695 Ga0055531_100026959 213
154 3300003794 Ga0055531_10003780 Ga0055531_100037802 213
155 3300003794 Ga0055531_10005602 Ga0055531_100056025 213
156 3300010375 Ga0105239_10000065 Ga0105239_10000065142 213
157 3300013104 Ga0157370_10000054 Ga0157370_10000054113 213
158 3300025245 Ga0207425_1000076 Ga0207425_100007672 213
159 3300025258 Ga0209129_1000295 Ga0209129_100029556 213
160 3300025292 Ga0209676_1002994 Ga0209676_10029949 213
161 3300025294 Ga0209025_1016194 Ga0209025_10161943 213
162 3300025297 Ga0209758_1000168 Ga0209758_1000168126 213
163 3300025297 Ga0209758_1000752 Ga0209758_100075256 213
164 3300025298 Ga0209050_1005678 Ga0209050_10056785 213
165 3300025303 Ga0209051_1000192 Ga0209051_10001922 213
166 3300025303 Ga0209051_1003167 Ga0209051_10031679 213
167 3300025304 Ga0209257_1000300 Ga0209257_1000300115 213
168 3300025304 Ga0209257_1000319 Ga0209257_100031936 213
169 3300025304 Ga0209257_1005001 Ga0209257_10050019 213
170 3300025304 Ga0209257_1031043 Ga0209257_10310433 213
171 3300031911 Ga0307412_10001590 Ga0307412_100015903 213
172 3300041413 Ga0439465_0001484 Ga0439465_0001484_1782_2426 213
173 3300041512 Ga0451853_0542393 Ga0451853_0542393_27_671 213
174 3300046515 Ga0495620_0012352 Ga0495620_0012352_3484_4128 213
175 3300046519 Ga0495632_0151687 Ga0495632_0151687_193_837 213
176 3300046522 Ga0495643_0007890 Ga0495643_0007890_4718_5362 213
177 3300046616 Ga0495668_0207585 Ga0495668_0207585_94_738 213
178 3300046660 Ga0495625_0012447 Ga0495625_0012447_5092_5736 213
179 3300046684 Ga0495669_0000160 Ga0495669_0000160_14056_14697 213
180 3300046810 Ga0495660_0010122 Ga0495660_0010122_525_1169 213
181 3300047323 Ga0495683_0082965 Ga0495683_0082965_724_1368 213
182 3300047472 Ga0495686_0010960 Ga0495686_0010960_4597_5241 213
183 3300048919 Ga0496116_0222095 Ga0496116_0222095_55_699 213
184 3300048920 Ga0496117_0000105 Ga0496117_0000105_48040_48684 213
185 3300048920 Ga0496117_0077470 Ga0496117_0077470_1037_1681 213
186 3300048921 Ga0496118_0000168 Ga0496118_0000168_50666_51310 213
187 3300048922 Ga0496119_0000443 Ga0496119_0000443_33166_33810 213
188 3300048923 Ga0496120_0000818 Ga0496120_0000818_3225_3869 213
189 3300048924 Ga0496121_0014288 Ga0496121_0014288_620_1264 213
190 3300048924 Ga0496121_0057953 Ga0496121_0057953_2003_2647 213
191 3300048924 Ga0496121_0153091 Ga0496121_0153091_448_1092 213
192 3300048924 Ga0496121_0280098 Ga0496121_0280098_306_950 213
193 3300048925 Ga0496122_0000426 Ga0496122_0000426_4076_4720 213
194 3300048925 Ga0496122_0000868 Ga0496122_0000868_18998_19642 213
195 3300048926 Ga0496123_0000682 Ga0496123_0000682_19078_19722 213
196 3300048926 Ga0496123_0008238 Ga0496123_0008238_1184_1828 213
197 3300048926 Ga0496123_0137952 Ga0496123_0137952_304_948 213
198 3300048928 Ga0496125_0010644 Ga0496125_0010644_8430_9074 213
199 3300048928 Ga0496125_0362199 Ga0496125_0362199_86_730 213
200 3300048928 Ga0496125_0369846 Ga0496125_0369846_60_704 213
201 3300048929 Ga0496126_0002217 Ga0496126_0002217_9895_10539 213
202 3300053086 Ga0500578_0069513 Ga0500578_0069513_716_1360 213
203 3300053109 Ga0500569_000750 Ga0500569_000750_827_1471 213
204 3300053118 Ga0500594_0046082 Ga0500594_0046082_455_1099 213
205 3300053134 Ga0500658_0012885 Ga0500658_0012885_2206_2850 213
206 3300053151 Ga0500604_0109169 Ga0500604_0109169_107_751 213
207 3300053153 Ga0500616_0000120 Ga0500616_0000120_111857_112501 213
208 3300053153 Ga0500616_0000716 Ga0500616_0000716_27733_28377 213
209 3300053153 Ga0500616_0017346 Ga0500616_0017346_1105_1749 213
210 3300003215 JGI25153J46596_10060106 JGI25153J46596_100601062 214
211 3300003316 rootH1_10077980 rootH1_100779803 214
212 3300003320 rootH2_10184542 rootH2_101845422 214
213 3300003775 Ga0055524_1001546 Ga0055524_10015466 214
214 3300003790 Ga0055528_1000018 Ga0055528_100001853 214
215 3300003790 Ga0055528_1003337 Ga0055528_10033375 214
216 3300003790 Ga0055528_1009476 Ga0055528_10094764 214
217 3300009093 Ga0105240_10014957 Ga0105240_100149576 214
218 3300009551 Ga0105238_10000077 Ga0105238_1000007745 214
219 3300017792 Ga0163161_10041908 Ga0163161_100419082 214
220 3300025258 Ga0209129_1000280 Ga0209129_10002802 214
221 3300025273 Ga0209673_1000055 Ga0209673_100005553 214
222 3300025273 Ga0209673_1000468 Ga0209673_100046831 214
223 3300025273 Ga0209673_1002034 Ga0209673_100203411 214
224 3300025297 Ga0209758_1006302 Ga0209758_10063029 214
225 3300025299 Ga0209256_1000147 Ga0209256_100014753 214
226 3300025299 Ga0209256_1031596 Ga0209256_10315962 214
227 3300025304 Ga0209257_1045806 Ga0209257_10458062 214
228 3300025913 Ga0207695_10145651 Ga0207695_101456512 214
229 3300025924 Ga0207694_10000282 Ga0207694_1000028212 214
230 3300026078 Ga0207702_10541710 Ga0207702_105417102 214
231 3300039437 Ga0436365_0943179 Ga0436365_0943179_351_995 214
232 3300048911 Ga0496108_0004624 Ga0496108_0004624_7654_8316 214
233 3300048924 Ga0496121_0172531 Ga0496121_0172531_505_1152 214
234 3300048924 Ga0496121_0341376 Ga0496121_0341376_30_674 214
235 3300048927 Ga0496124_0003197 Ga0496124_0003197_12218_12862 214
236 3300048929 Ga0496126_0007057 Ga0496126_0007057_10723_11367 214
237 3300049758 Ga0501241_000780 Ga0501241_000780_914_1558 214
238 3300003762 Ga0055542_1009568 Ga0055542_10095682 215
239 3300003763 Ga0055529_1004298 Ga0055529_10042982 215
240 3300005577 Ga0068857_100013959 Ga0068857_1000139597 215
241 3300005577 Ga0068857_100050479 Ga0068857_1000504792 215
242 3300005614 Ga0068856_100777289 Ga0068856_1007772892 215
243 3300005842 Ga0068858_100006756 Ga0068858_1000067566 215
244 3300009093 Ga0105240_10005423 Ga0105240_1000542316 215
245 3300009093 Ga0105240_11188227 Ga0105240_111882272 215
246 3300009177 Ga0105248_10010850 Ga0105248_100108504 215
247 3300009177 Ga0105248_10020012 Ga0105248_100200127 215
248 3300009545 Ga0105237_10184133 Ga0105237_101841333 215
249 3300013102 Ga0157371_10000011 Ga0157371_10000011148 215
250 3300025254 Ga0209148_1003492 Ga0209148_10034923 215
251 3300025272 Ga0209455_1000734 Ga0209455_100073411 215
252 3300025941 Ga0207711_10001781 Ga0207711_1000178112 215
253 3300025941 Ga0207711_10009739 Ga0207711_100097394 215
254 3300026035 Ga0207703_10005384 Ga0207703_100053845 215
255 3300026078 Ga0207702_10563243 Ga0207702_105632431 215
256 3300026116 Ga0207674_10030602 Ga0207674_100306029 215
257 3300031548 Ga0307408_100907785 Ga0307408_1009077851 215
258 3300047472 Ga0495686_0000162 Ga0495686_0000162_53051_53698 215
259 3300048921 Ga0496118_0021411 Ga0496118_0021411_1095_1742 215
260 3300048925 Ga0496122_0013447 Ga0496122_0013447_3172_3822 215
261 3300048925 Ga0496122_0225990 Ga0496122_0225990_52_702 215
262 3300048926 Ga0496123_0016571 Ga0496123_0016571_4137_4787 215
263 3300048926 Ga0496123_0076339 Ga0496123_0076339_907_1557 215
264 3300048928 Ga0496125_0000039 Ga0496125_0000039_13208_13858 215
265 3300048929 Ga0496126_0003249 Ga0496126_0003249_19042_19749 215
266 3300049574 Ga0501038_0460325 Ga0501038_0460325_180_827 215
267 3300053136 Ga0500559_0007035 Ga0500559_0007035_916_1563 215
268 3300053724 Ga0500570_000100 Ga0500570_000100_4788_5435 215
269 3300002075 JGI24738J21930_10001812 JGI24738J21930_100018123 216
270 3300003316 rootH1_10068002 rootH1_100680022 216
271 3300004625 Ga0055543_1018388 Ga0055543_10183883 216
272 3300005262 Ga0065165_1012488 Ga0065165_10124882 216
273 3300005327 Ga0070658_10039621 Ga0070658_100396212 216
274 3300005331 Ga0070670_100072816 Ga0070670_1000728163 216
275 3300005334 Ga0068869_100006884 Ga0068869_1000068845 216
276 3300005335 Ga0070666_10054890 Ga0070666_100548901 216
277 3300005339 Ga0070660_100082530 Ga0070660_1000825301 216
278 3300005347 Ga0070668_100002824 Ga0070668_1000028241 216
279 3300005353 Ga0070669_100013377 Ga0070669_1000133774 216
280 3300005367 Ga0070667_100000103 Ga0070667_10000010357 216
281 3300005536 Ga0070697_100422131 Ga0070697_1004221311 216
282 3300005548 Ga0070665_100003036 Ga0070665_1000030365 216
283 3300005563 Ga0068855_100351900 Ga0068855_1003519002 216
284 3300005563 Ga0068855_100626205 Ga0068855_1006262051 216
285 3300005578 Ga0068854_100000257 Ga0068854_10000025731 216
286 3300005617 Ga0068859_100760935 Ga0068859_1007609352 216
287 3300005841 Ga0068863_100000377 Ga0068863_10000037729 216
288 3300005843 Ga0068860_100179939 Ga0068860_1001799392 216
289 3300006358 Ga0068871_100034956 Ga0068871_1000349562 216
290 3300006931 Ga0097620_100760787 Ga0097620_1007607871 216
291 3300009093 Ga0105240_10004459 Ga0105240_1000445913 216
292 3300009545 Ga0105237_10000775 Ga0105237_1000077524 216
293 3300009551 Ga0105238_10002182 Ga0105238_1000218210 216
294 3300010375 Ga0105239_10664193 Ga0105239_106641932 216
295 3300013100 Ga0157373_10047682 Ga0157373_100476822 216
296 3300013296 Ga0157374_10007062 Ga0157374_100070624 216
297 3300013296 Ga0157374_10214709 Ga0157374_102147093 216
298 3300025315 Ga0207697_10189256 Ga0207697_101892561 216
299 3300025903 Ga0207680_10075863 Ga0207680_100758631 216
300 3300025904 Ga0207647_10052510 Ga0207647_100525103 216
301 3300025909 Ga0207705_10081349 Ga0207705_100813492 216
302 3300025913 Ga0207695_10006147 Ga0207695_1000614715 216
303 3300025914 Ga0207671_10001293 Ga0207671_1000129317 216
304 3300025919 Ga0207657_10193503 Ga0207657_101935032 216
305 3300025923 Ga0207681_10016719 Ga0207681_100167194 216
306 3300025924 Ga0207694_10007888 Ga0207694_100078885 216
307 3300025925 Ga0207650_10089787 Ga0207650_100897873 216
308 3300025942 Ga0207689_10000704 Ga0207689_100007045 216
309 3300025949 Ga0207667_10296486 Ga0207667_102964861 216
310 3300025961 Ga0207712_10002983 Ga0207712_1000298315 216
311 3300025972 Ga0207668_10000541 Ga0207668_1000054116 216
312 3300025972 Ga0207668_10012170 Ga0207668_100121705 216
313 3300025981 Ga0207640_10000369 Ga0207640_1000036927 216
314 3300025986 Ga0207658_10000080 Ga0207658_1000008049 216
315 3300026088 Ga0207641_10000014 Ga0207641_1000001414 216
316 3300028379 Ga0268266_10004368 Ga0268266_100043685 216
317 3300028381 Ga0268264_10140236 Ga0268264_101402363 216
318 3300035695 Ga0373927_0348907 Ga0373927_0348907_283_939 216
319 3300038443 Ga0395901_0348059 Ga0395901_0348059_679_1332 216
320 3300044693 Ga0466961_0012474 Ga0466961_0012474_3694_4344 216
321 3300047472 Ga0495686_0000836 Ga0495686_0000836_18926_19576 216
322 3300047472 Ga0495686_0010184 Ga0495686_0010184_5128_5856 216
323 3300047472 Ga0495686_0190166 Ga0495686_0190166_513_1163 216
324 3300053134 Ga0500658_0123043 Ga0500658_0123043_398_1141 216
325 3300053730 Ga0500645_000934 Ga0500645_000934_11255_11911 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02586

SRAP

SOS response associated peptidase (SRAP)

1

200

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d2m-assembly2.cif.gz_B covalent schiff base complex of yedk c2a and abasic dna 0.8139 3 196
1zn6-assembly1.cif.gz_A x-ray crystal structure of protein q7wlm8 from bordetella bronchiseptica. northeast structural genomics consortium target bor19. 0.8135 2 197
2f20-assembly2.cif.gz_B x-ray crystal structure of protein bt_1218 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr8. 0.8024 2 196
6kbz-assembly4.cif.gz_H crystal structure of yedk with ssdna containing a tetrahydrofuran abasic site 0.7968 2 196
8d2m-assembly1.cif.gz_A covalent schiff base complex of yedk c2a and abasic dna 0.7939 3 196
ID Description Score Start End Superfamily
af_I1KYZ5_1_237_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.7909 1 196 3.90.1680.10
1zn6A00 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.7839 2 197 3.90.1680.10
6nlcA00 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.7814 2 196 3.90.1680.10
af_O05872_1_242_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.7691 1 196 3.90.1680.10
af_Q04471_25_258_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.7619 22 196 3.90.1680.10
ID Description Score Start End GO Terms
AF-A0A2W4DQ42-F1-model_v4 deleted 0.9899 1 206
AF-A0A1E4J290-F1-model_v4 DUF159 family protein 0.9888 79 201 GO:0003697
GO:0106300
AF-A0A839XGK0-F1-model_v4 deleted 0.9873 83 175
AF-A0A2W4DQ42-F1-model_v4 deleted 0.9852 1 206
AF-A0A4Q3CMU9-F1-model_v4 deleted 0.9798 94 201

Feature Viewer

pLDDT pTM Quality
91.07 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map