F407637
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 199 | 289 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300002459|JGI24751J29686_10000487|JGI24751J29686_100004875 |
| Length | 210 |
| Sequence | MCNLYTIRKSAAEVAAHFGVSDPTQSNAPEEVYPGYPGLVVREQDGARVMQSMAWGFPLRLKGMSPTAKPKPVNNIADLAKPMWKGLACLVPVTHFAEAEGPKGAKTRTWFNVKDVPIFAWAGLWRISDEWGPVYSGAMTDCNEAIRPVHDRMPVLLHADEYDQWLHGTFEDTLAFQQRCFPDDLIELQRTSELWVKRKVAASAVEPSLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 4 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 5 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 6 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 7 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 8 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 9 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 10 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 11 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 12 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 13 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 14 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 15 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 16 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 17 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 18 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 19 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 20 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 21 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 22 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 23 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 24 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 25 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 26 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 27 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 28 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 29 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 30 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 31 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 32 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 33 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 34 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 35 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 36 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 37 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 137 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 138 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 139 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 142 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 143 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 144 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 145 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 146 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 147 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 148 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 162 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 163 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 164 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 165 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 166 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 167 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 168 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 169 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 170 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 171 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 172 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 173 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 174 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 175 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 176 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 179 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 180 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 181 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 182 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 183 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 185 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 186 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 187 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 188 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 189 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 190 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 191 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 192 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 193 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 194 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 195 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 196 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 197 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 198 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 199 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.92 |
| Metatranscriptomes | 0 |
| Isolates | 11.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.31 |
| Bulb | 0 |
| Endosphere | 18.77 |
| Nodule | 5.23 |
| Rhizoplane | 0.62 |
| Rhizosphere | 58.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10001812 | 3300002075 | Bacteria | 5797 |
| 2 | JGI24751J29686_10000487 | 3300002459 | Bacteria | 11754 |
| 3 | JGI25152J39213_1000158 | 3300002773 | Bacteria | 46003 |
| 4 | JGI25153J46596_10000242 | 3300003215 | Bacteria | 46003 |
| 5 | JGI25153J46596_10060106 | 3300003215 | Unclassified | 1037 |
| 6 | JGI25153J46596_10065305 | 3300003215 | Bacteria | 967 |
| 7 | rootH1_10068002 | 3300003316 | Bacteria | 2301 |
| 8 | rootH1_10077980 | 3300003316 | Unclassified | 2220 |
| 9 | rootH2_10184542 | 3300003320 | Bacteria | 1614 |
| 10 | Ga0055542_1000115 | 3300003762 | Bacteria | 106506 |
| 11 | Ga0055542_1009568 | 3300003762 | Bacteria | 1820 |
| 12 | Ga0055529_1000052 | 3300003763 | Bacteria | 203029 |
| 13 | Ga0055529_1004298 | 3300003763 | Bacteria | 2183 |
| 14 | Ga0055524_1001546 | 3300003775 | Bacteria | 12987 |
| 15 | Ga0055536_1006207 | 3300003781 | Bacteria | 5644 |
| 16 | Ga0055528_1000018 | 3300003790 | Bacteria | 155302 |
| 17 | Ga0055528_1003337 | 3300003790 | Bacteria | 8128 |
| 18 | Ga0055528_1009476 | 3300003790 | Bacteria | 4062 |
| 19 | Ga0055540_1002544 | 3300003792 | Bacteria | 9507 |
| 20 | Ga0055531_10002695 | 3300003794 | Bacteria | 11699 |
| 21 | Ga0055531_10003780 | 3300003794 | Bacteria | 9507 |
| 22 | Ga0055531_10005602 | 3300003794 | Bacteria | 7313 |
| 23 | Ga0055543_1018388 | 3300004625 | Bacteria | 1304 |
| 24 | Ga0065165_1012488 | 3300005262 | Bacteria | 3455 |
| 25 | Ga0070658_10039621 | 3300005327 | Bacteria | 3801 |
| 26 | Ga0070670_100004404 | 3300005331 | Bacteria | 11792 |
| 27 | Ga0070670_100072816 | 3300005331 | Bacteria | 2951 |
| 28 | Ga0068869_100006884 | 3300005334 | Bacteria | 7232 |
| 29 | Ga0070666_10054890 | 3300005335 | Bacteria | 2688 |
| 30 | Ga0070660_100082530 | 3300005339 | Bacteria | 2524 |
| 31 | Ga0070661_100457751 | 3300005344 | Bacteria | 1016 |
| 32 | Ga0070668_100002824 | 3300005347 | Bacteria | 12786 |
| 33 | Ga0070668_100032613 | 3300005347 | Bacteria | 3964 |
| 34 | Ga0070669_100013377 | 3300005353 | Bacteria | 5834 |
| 35 | Ga0070669_100024515 | 3300005353 | Bacteria | 4325 |
| 36 | Ga0070674_100000127 | 3300005356 | Bacteria | 34879 |
| 37 | Ga0070659_100109414 | 3300005366 | Bacteria | 2230 |
| 38 | Ga0070667_100000103 | 3300005367 | Bacteria | 107232 |
| 39 | Ga0070663_100169116 | 3300005455 | Bacteria | 1688 |
| 40 | Ga0070678_100000068 | 3300005456 | Bacteria | 38359 |
| 41 | Ga0070662_100271954 | 3300005457 | Bacteria | 1368 |
| 42 | Ga0070684_100215721 | 3300005535 | Bacteria | 1750 |
| 43 | Ga0070697_100422131 | 3300005536 | Bacteria | 1159 |
| 44 | Ga0070665_100003036 | 3300005548 | Bacteria | 18089 |
| 45 | Ga0068855_100001788 | 3300005563 | Bacteria | 26857 |
| 46 | Ga0068855_100002167 | 3300005563 | Bacteria | 24277 |
| 47 | Ga0068855_100023295 | 3300005563 | Bacteria | 7416 |
| 48 | Ga0068855_100351900 | 3300005563 | Bacteria | 1622 |
| 49 | Ga0068855_100531956 | 3300005563 | Bacteria | 1274 |
| 50 | Ga0068855_100626205 | 3300005563 | Bacteria | 1158 |
| 51 | Ga0068857_100013959 | 3300005577 | Bacteria | 6989 |
| 52 | Ga0068857_100050479 | 3300005577 | Bacteria | 3690 |
| 53 | Ga0068857_100067074 | 3300005577 | Bacteria | 3193 |
| 54 | Ga0068854_100000257 | 3300005578 | Bacteria | 36219 |
| 55 | Ga0068854_100002569 | 3300005578 | Bacteria | 11240 |
| 56 | Ga0068856_100777289 | 3300005614 | Bacteria | 977 |
| 57 | Ga0068852_100000494 | 3300005616 | Bacteria | 25800 |
| 58 | Ga0068852_100001573 | 3300005616 | Bacteria | 15503 |
| 59 | Ga0068852_100131495 | 3300005616 | Unclassified | 2305 |
| 60 | Ga0068859_100760935 | 3300005617 | Unclassified | 1057 |
| 61 | Ga0068864_100004245 | 3300005618 | Bacteria | 11792 |
| 62 | Ga0068863_100000377 | 3300005841 | Bacteria | 45378 |
| 63 | Ga0068863_100003498 | 3300005841 | Bacteria | 15499 |
| 64 | Ga0068858_100006756 | 3300005842 | Bacteria | 11164 |
| 65 | Ga0068860_100179939 | 3300005843 | Bacteria | 2044 |
| 66 | Ga0068862_100000135 | 3300005844 | Bacteria | 85248 |
| 67 | Ga0068862_100099969 | 3300005844 | Bacteria | 2536 |
| 68 | Ga0068871_100034956 | 3300006358 | Bacteria | 3991 |
| 69 | Ga0097620_100760787 | 3300006931 | Unclassified | 1057 |
| 70 | Ga0105240_10000052 | 3300009093 | Bacteria | 232583 |
| 71 | Ga0105240_10001137 | 3300009093 | Bacteria | 46577 |
| 72 | Ga0105240_10004459 | 3300009093 | Bacteria | 21343 |
| 73 | Ga0105240_10005423 | 3300009093 | Bacteria | 19011 |
| 74 | Ga0105240_10010628 | 3300009093 | Bacteria | 12931 |
| 75 | Ga0105240_10014957 | 3300009093 | Bacteria | 10572 |
| 76 | Ga0105240_10363701 | 3300009093 | Bacteria | 1638 |
| 77 | Ga0105240_11188227 | 3300009093 | Unclassified | 808 |
| 78 | Ga0105241_10514511 | 3300009174 | Bacteria | 1069 |
| 79 | Ga0105248_10010850 | 3300009177 | Bacteria | 10057 |
| 80 | Ga0105248_10020012 | 3300009177 | Bacteria | 7410 |
| 81 | Ga0105248_10141442 | 3300009177 | Plasmid | 2715 |
| 82 | Ga0105248_10340121 | 3300009177 | Bacteria | 1690 |
| 83 | Ga0105237_10000775 | 3300009545 | Bacteria | 43719 |
| 84 | Ga0105237_10016164 | 3300009545 | Bacteria | 7763 |
| 85 | Ga0105237_10019031 | 3300009545 | Bacteria | 7098 |
| 86 | Ga0105237_10184133 | 3300009545 | Bacteria | 2088 |
| 87 | Ga0105238_10000077 | 3300009551 | Bacteria | 110207 |
| 88 | Ga0105238_10002182 | 3300009551 | Bacteria | 19769 |
| 89 | Ga0105239_10000065 | 3300010375 | Bacteria | 151224 |
| 90 | Ga0105239_10000196 | 3300010375 | Bacteria | 88069 |
| 91 | Ga0105239_10004881 | 3300010375 | Bacteria | 15872 |
| 92 | Ga0105239_10019352 | 3300010375 | Bacteria | 7519 |
| 93 | Ga0105239_10085536 | 3300010375 | Bacteria | 3475 |
| 94 | Ga0105239_10664193 | 3300010375 | Bacteria | 1191 |
| 95 | Ga0157373_10037403 | 3300013100 | Bacteria | 3479 |
| 96 | Ga0157373_10047682 | 3300013100 | Bacteria | 3055 |
| 97 | Ga0157371_10000011 | 3300013102 | Bacteria | 377608 |
| 98 | Ga0157371_10000024 | 3300013102 | Bacteria | 281202 |
| 99 | Ga0157370_10000054 | 3300013104 | Bacteria | 118718 |
| 100 | Ga0157374_10007062 | 3300013296 | Bacteria | 9561 |
| 101 | Ga0157374_10214709 | 3300013296 | Bacteria | 1887 |
| 102 | Ga0157372_10004796 | 3300013307 | Bacteria | 14367 |
| 103 | Ga0163161_10041908 | 3300017792 | Bacteria | 3291 |
| 104 | Ga0209674_107571 | 3300025226 | Bacteria | 1358 |
| 105 | Ga0207425_1000076 | 3300025245 | Bacteria | 106313 |
| 106 | Ga0209677_107965 | 3300025253 | Bacteria | 2138 |
| 107 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 108 | Ga0209148_1003492 | 3300025254 | Bacteria | 4314 |
| 109 | Ga0209129_1000280 | 3300025258 | Bacteria | 48435 |
| 110 | Ga0209129_1000295 | 3300025258 | Bacteria | 46972 |
| 111 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 112 | Ga0209455_1000734 | 3300025272 | Bacteria | 18804 |
| 113 | Ga0209455_1007960 | 3300025272 | Bacteria | 2933 |
| 114 | Ga0209673_1000055 | 3300025273 | Bacteria | 272768 |
| 115 | Ga0209673_1000468 | 3300025273 | Bacteria | 68029 |
| 116 | Ga0209673_1002034 | 3300025273 | Bacteria | 15376 |
| 117 | Ga0209676_1002994 | 3300025292 | Bacteria | 10994 |
| 118 | Ga0209025_1016194 | 3300025294 | Bacteria | 4424 |
| 119 | Ga0209758_1000168 | 3300025297 | Bacteria | 150965 |
| 120 | Ga0209758_1000752 | 3300025297 | Bacteria | 46978 |
| 121 | Ga0209758_1006302 | 3300025297 | Bacteria | 8618 |
| 122 | Ga0209050_1005678 | 3300025298 | Bacteria | 7715 |
| 123 | Ga0209256_1000147 | 3300025299 | Bacteria | 149002 |
| 124 | Ga0209256_1031596 | 3300025299 | Bacteria | 1446 |
| 125 | Ga0209051_1000192 | 3300025303 | Bacteria | 108667 |
| 126 | Ga0209051_1003167 | 3300025303 | Bacteria | 11025 |
| 127 | Ga0209257_1000300 | 3300025304 | Bacteria | 108786 |
| 128 | Ga0209257_1000319 | 3300025304 | Bacteria | 100552 |
| 129 | Ga0209257_1005001 | 3300025304 | Bacteria | 9672 |
| 130 | Ga0209257_1031043 | 3300025304 | Bacteria | 1715 |
| 131 | Ga0209257_1045806 | 3300025304 | Bacteria | 1268 |
| 132 | Ga0207697_10189256 | 3300025315 | Bacteria | 903 |
| 133 | Ga0207710_10418797 | 3300025900 | Bacteria | 689 |
| 134 | Ga0207688_10334653 | 3300025901 | Bacteria | 931 |
| 135 | Ga0207680_10075863 | 3300025903 | Bacteria | 2098 |
| 136 | Ga0207647_10052510 | 3300025904 | Bacteria | 2516 |
| 137 | Ga0207705_10081349 | 3300025909 | Bacteria | 2361 |
| 138 | Ga0207695_10000122 | 3300025913 | Bacteria | 232677 |
| 139 | Ga0207695_10000383 | 3300025913 | Bacteria | 100354 |
| 140 | Ga0207695_10006147 | 3300025913 | Bacteria | 15657 |
| 141 | Ga0207695_10008640 | 3300025913 | Bacteria | 12714 |
| 142 | Ga0207695_10145651 | 3300025913 | Bacteria | 2313 |
| 143 | Ga0207671_10000861 | 3300025914 | Bacteria | 38444 |
| 144 | Ga0207671_10001293 | 3300025914 | Bacteria | 29404 |
| 145 | Ga0207657_10119644 | 3300025919 | Bacteria | 2167 |
| 146 | Ga0207657_10193503 | 3300025919 | Bacteria | 1639 |
| 147 | Ga0207649_10123595 | 3300025920 | Bacteria | 1748 |
| 148 | Ga0207681_10009741 | 3300025923 | Bacteria | 5879 |
| 149 | Ga0207681_10016719 | 3300025923 | Bacteria | 4596 |
| 150 | Ga0207694_10000282 | 3300025924 | Bacteria | 47859 |
| 151 | Ga0207694_10007888 | 3300025924 | Bacteria | 8063 |
| 152 | Ga0207650_10002916 | 3300025925 | Bacteria | 11806 |
| 153 | Ga0207650_10089787 | 3300025925 | Bacteria | 2346 |
| 154 | Ga0207706_10249026 | 3300025933 | Bacteria | 1552 |
| 155 | Ga0207669_10000035 | 3300025937 | Bacteria | 81855 |
| 156 | Ga0207711_10001781 | 3300025941 | Bacteria | 19721 |
| 157 | Ga0207711_10009739 | 3300025941 | Bacteria | 7995 |
| 158 | Ga0207711_10348268 | 3300025941 | Bacteria | 1371 |
| 159 | Ga0207689_10000704 | 3300025942 | Bacteria | 32031 |
| 160 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 161 | Ga0207667_10000220 | 3300025949 | Bacteria | 80179 |
| 162 | Ga0207667_10006009 | 3300025949 | Bacteria | 14774 |
| 163 | Ga0207667_10296486 | 3300025949 | Bacteria | 1652 |
| 164 | Ga0207712_10002983 | 3300025961 | Bacteria | 10805 |
| 165 | Ga0207668_10000541 | 3300025972 | Bacteria | 23747 |
| 166 | Ga0207668_10012170 | 3300025972 | Bacteria | 5258 |
| 167 | Ga0207668_10018668 | 3300025972 | Bacteria | 4370 |
| 168 | Ga0207640_10000369 | 3300025981 | Bacteria | 29179 |
| 169 | Ga0207640_10012298 | 3300025981 | Bacteria | 4870 |
| 170 | Ga0207658_10000080 | 3300025986 | Bacteria | 107226 |
| 171 | Ga0207703_10005384 | 3300026035 | Bacteria | 10306 |
| 172 | Ga0207639_10000381 | 3300026041 | Bacteria | 30545 |
| 173 | Ga0207678_10645720 | 3300026067 | Bacteria | 929 |
| 174 | Ga0207702_10541710 | 3300026078 | Bacteria | 1138 |
| 175 | Ga0207702_10563243 | 3300026078 | Bacteria | 1115 |
| 176 | Ga0207641_10000014 | 3300026088 | Bacteria | 336170 |
| 177 | Ga0207641_10004228 | 3300026088 | Bacteria | 12517 |
| 178 | Ga0207676_10000041 | 3300026095 | Bacteria | 166172 |
| 179 | Ga0207674_10000167 | 3300026116 | Bacteria | 78909 |
| 180 | Ga0207674_10030602 | 3300026116 | Bacteria | 5658 |
| 181 | Ga0207683_10001436 | 3300026121 | Bacteria | 21554 |
| 182 | Ga0207698_10001137 | 3300026142 | Bacteria | 15503 |
| 183 | Ga0207698_10029600 | 3300026142 | Bacteria | 3925 |
| 184 | Ga0207698_10083796 | 3300026142 | Bacteria | 2582 |
| 185 | Ga0268266_10004368 | 3300028379 | Bacteria | 13582 |
| 186 | Ga0268266_10050860 | 3300028379 | Bacteria | 3556 |
| 187 | Ga0268265_10000152 | 3300028380 | Bacteria | 85229 |
| 188 | Ga0268265_10352426 | 3300028380 | Bacteria | 1344 |
| 189 | Ga0268264_10140236 | 3300028381 | Bacteria | 2155 |
| 190 | Ga0307513_10053357 | 3300031456 | Bacteria | 4346 |
| 191 | Ga0307513_10099676 | 3300031456 | Bacteria | 2932 |
| 192 | Ga0307408_100907785 | 3300031548 | Bacteria | 807 |
| 193 | Ga0307412_10001590 | 3300031911 | Bacteria | 12505 |
| 194 | Ga0307412_10001831 | 3300031911 | Bacteria | 11787 |
| 195 | Ga0373927_0348907 | 3300035695 | Bacteria | 975 |
| 196 | Ga0395901_0348059 | 3300038443 | Bacteria | 1530 |
| 197 | Ga0436365_0943179 | 3300039437 | Bacteria | 1079 |
| 198 | Ga0439465_0001484 | 3300041413 | Bacteria | 7608 |
| 199 | Ga0451853_0542393 | 3300041512 | Bacteria | 849 |
| 200 | Ga0466966_0145512 | 3300044684 | Unclassified | 1447 |
| 201 | Ga0466961_0012474 | 3300044693 | Bacteria | 5438 |
| 202 | Ga0466970_0106185 | 3300044765 | Unclassified | 1532 |
| 203 | Ga0466958_0024894 | 3300045836 | Bacteria | 3524 |
| 204 | Ga0495650_0001705 | 3300046471 | Bacteria | 20193 |
| 205 | Ga0495620_0012352 | 3300046515 | Bacteria | 4418 |
| 206 | Ga0495632_0151687 | 3300046519 | Bacteria | 1071 |
| 207 | Ga0495643_0000336 | 3300046522 | Bacteria | 64049 |
| 208 | Ga0495643_0000557 | 3300046522 | Bacteria | 46202 |
| 209 | Ga0495643_0006596 | 3300046522 | Bacteria | 7629 |
| 210 | Ga0495643_0007890 | 3300046522 | Bacteria | 6800 |
| 211 | Ga0495668_0207585 | 3300046616 | Bacteria | 1072 |
| 212 | Ga0495611_0183910 | 3300046648 | Bacteria | 976 |
| 213 | Ga0495625_0004505 | 3300046660 | Bacteria | 13145 |
| 214 | Ga0495625_0012447 | 3300046660 | Bacteria | 6894 |
| 215 | Ga0495669_0000160 | 3300046684 | Bacteria | 42951 |
| 216 | Ga0495660_0010122 | 3300046810 | Bacteria | 5482 |
| 217 | Ga0495683_0082965 | 3300047323 | Bacteria | 1561 |
| 218 | Ga0495683_0143570 | 3300047323 | Bacteria | 1116 |
| 219 | Ga0495681_0064248 | 3300047470 | Unclassified | 1682 |
| 220 | Ga0495686_0000162 | 3300047472 | Bacteria | 126699 |
| 221 | Ga0495686_0000836 | 3300047472 | Bacteria | 39550 |
| 222 | Ga0495686_0010184 | 3300047472 | Bacteria | 6704 |
| 223 | Ga0495686_0010960 | 3300047472 | Bacteria | 6418 |
| 224 | Ga0495686_0190166 | 3300047472 | Bacteria | 1184 |
| 225 | Ga0496108_0004624 | 3300048911 | Bacteria | 11093 |
| 226 | Ga0496113_0121868 | 3300048916 | Bacteria | 2039 |
| 227 | Ga0496116_0222095 | 3300048919 | Bacteria | 967 |
| 228 | Ga0496117_0000105 | 3300048920 | Bacteria | 188970 |
| 229 | Ga0496117_0077470 | 3300048920 | Bacteria | 2200 |
| 230 | Ga0496118_0000168 | 3300048921 | Bacteria | 118938 |
| 231 | Ga0496118_0021411 | 3300048921 | Bacteria | 5691 |
| 232 | Ga0496119_0000443 | 3300048922 | Bacteria | 56795 |
| 233 | Ga0496120_0000818 | 3300048923 | Bacteria | 44506 |
| 234 | Ga0496121_0014288 | 3300048924 | Bacteria | 8442 |
| 235 | Ga0496121_0057953 | 3300048924 | Bacteria | 3206 |
| 236 | Ga0496121_0153091 | 3300048924 | Bacteria | 1694 |
| 237 | Ga0496121_0172531 | 3300048924 | Bacteria | 1569 |
| 238 | Ga0496121_0280098 | 3300048924 | Bacteria | 1141 |
| 239 | Ga0496121_0341376 | 3300048924 | Bacteria | 1001 |
| 240 | Ga0496122_0000426 | 3300048925 | Bacteria | 89190 |
| 241 | Ga0496122_0000868 | 3300048925 | Bacteria | 56966 |
| 242 | Ga0496122_0013447 | 3300048925 | Bacteria | 8010 |
| 243 | Ga0496122_0143500 | 3300048925 | Bacteria | 1489 |
| 244 | Ga0496122_0225990 | 3300048925 | Unclassified | 1069 |
| 245 | Ga0496123_0000682 | 3300048926 | Bacteria | 55995 |
| 246 | Ga0496123_0008238 | 3300048926 | Bacteria | 9608 |
| 247 | Ga0496123_0016571 | 3300048926 | Bacteria | 5975 |
| 248 | Ga0496123_0032108 | 3300048926 | Bacteria | 3809 |
| 249 | Ga0496123_0076339 | 3300048926 | Bacteria | 2063 |
| 250 | Ga0496123_0099323 | 3300048926 | Bacteria | 1699 |
| 251 | Ga0496123_0137952 | 3300048926 | Bacteria | 1339 |
| 252 | Ga0496124_0003197 | 3300048927 | Bacteria | 20225 |
| 253 | Ga0496124_0163874 | 3300048927 | Bacteria | 1730 |
| 254 | Ga0496124_0285766 | 3300048927 | Bacteria | 1200 |
| 255 | Ga0496125_0000039 | 3300048928 | Bacteria | 318665 |
| 256 | Ga0496125_0010644 | 3300048928 | Bacteria | 9287 |
| 257 | Ga0496125_0261256 | 3300048928 | Bacteria | 1085 |
| 258 | Ga0496125_0362199 | 3300048928 | Bacteria | 862 |
| 259 | Ga0496125_0369846 | 3300048928 | Bacteria | 849 |
| 260 | Ga0496126_0002217 | 3300048929 | Bacteria | 26907 |
| 261 | Ga0496126_0002653 | 3300048929 | Bacteria | 23704 |
| 262 | Ga0496126_0003249 | 3300048929 | Bacteria | 20773 |
| 263 | Ga0496126_0007057 | 3300048929 | Bacteria | 12377 |
| 264 | Ga0501290_007464 | 3300049513 | Bacteria | 1370 |
| 265 | Ga0501292_000073 | 3300049515 | Bacteria | 20076 |
| 266 | Ga0501299_076132 | 3300049522 | Bacteria | 737 |
| 267 | Ga0501038_0460325 | 3300049574 | Bacteria | 977 |
| 268 | Ga0501047_0157524 | 3300049581 | Bacteria | 2144 |
| 269 | Ga0501224_007590 | 3300049664 | Bacteria | 1581 |
| 270 | Ga0501227_047174 | 3300049665 | Bacteria | 1079 |
| 271 | Ga0501249_000114 | 3300049679 | Bacteria | 24796 |
| 272 | Ga0501241_000780 | 3300049758 | Bacteria | 6740 |
| 273 | Ga0501279_000025 | 3300049775 | Bacteria | 44341 |
| 274 | Ga0501044_0001201 | 3300049823 | Bacteria | 30718 |
| 275 | Ga0501204_000714 | 3300049850 | Bacteria | 3028 |
| 276 | Ga0500610_0000042 | 3300053079 | Bacteria | 41981 |
| 277 | Ga0500578_0069513 | 3300053086 | Bacteria | 2244 |
| 278 | Ga0500569_000750 | 3300053109 | Bacteria | 5675 |
| 279 | Ga0500594_0046082 | 3300053118 | Bacteria | 1212 |
| 280 | Ga0500658_0012885 | 3300053134 | Bacteria | 3089 |
| 281 | Ga0500658_0123043 | 3300053134 | Unclassified | 1151 |
| 282 | Ga0500559_0007035 | 3300053136 | Bacteria | 5025 |
| 283 | Ga0500604_0109169 | 3300053151 | Bacteria | 918 |
| 284 | Ga0500616_0000120 | 3300053153 | Bacteria | 142980 |
| 285 | Ga0500616_0000716 | 3300053153 | Bacteria | 38440 |
| 286 | Ga0500616_0017346 | 3300053153 | Bacteria | 4084 |
| 287 | Ga0500570_000100 | 3300053724 | Bacteria | 24572 |
| 288 | Ga0500645_000934 | 3300053730 | Bacteria | 16677 |
| 289 | Ga0500596_004265 | 3300053735 | Bacteria | 2642 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049513 | Ga0501290_007464 | Ga0501290_007464_48_623 | 189 |
| 2 | 3300005563 | Ga0068855_100531956 | Ga0068855_1005319562 | 190 |
| 3 | 3300009093 | Ga0105240_10010628 | Ga0105240_100106287 | 190 |
| 4 | 3300010375 | Ga0105239_10004881 | Ga0105239_1000488113 | 190 |
| 5 | 3300025913 | Ga0207695_10008640 | Ga0207695_1000864011 | 190 |
| 6 | iso_pu_bacteria | 2883577096 | 2883578593 | 194 |
| 7 | 3300044684 | Ga0466966_0145512 | Ga0466966_0145512_161_757 | 197 |
| 8 | 3300044765 | Ga0466970_0106185 | Ga0466970_0106185_921_1517 | 197 |
| 9 | 3300045836 | Ga0466958_0024894 | Ga0466958_0024894_1213_1809 | 197 |
| 10 | iso_pu_bacteria | 2512564014 | 2512645926 | 197 |
| 11 | 3300025949 | Ga0207667_10000002 | Ga0207667_10000002725 | 198 |
| 12 | 3300005356 | Ga0070674_100000127 | Ga0070674_10000012728 | 199 |
| 13 | 3300005456 | Ga0070678_100000068 | Ga0070678_10000006816 | 199 |
| 14 | 3300026121 | Ga0207683_10001436 | Ga0207683_1000143613 | 199 |
| 15 | 3300031456 | Ga0307513_10099676 | Ga0307513_100996761 | 200 |
| 16 | 3300046522 | Ga0495643_0000557 | Ga0495643_0000557_31182_31784 | 200 |
| 17 | 3300005347 | Ga0070668_100032613 | Ga0070668_1000326133 | 202 |
| 18 | 3300005844 | Ga0068862_100099969 | Ga0068862_1000999692 | 202 |
| 19 | 3300009177 | Ga0105248_10141442 | Ga0105248_101414422 | 202 |
| 20 | 3300025923 | Ga0207681_10009741 | Ga0207681_100097413 | 202 |
| 21 | 3300025941 | Ga0207711_10348268 | Ga0207711_103482682 | 202 |
| 22 | 3300025972 | Ga0207668_10018668 | Ga0207668_100186684 | 202 |
| 23 | 3300028380 | Ga0268265_10352426 | Ga0268265_103524262 | 202 |
| 24 | 3300048927 | Ga0496124_0285766 | Ga0496124_0285766_84_710 | 202 |
| 25 | 3300005455 | Ga0070663_100169116 | Ga0070663_1001691162 | 204 |
| 26 | 3300005457 | Ga0070662_100271954 | Ga0070662_1002719543 | 204 |
| 27 | 3300005535 | Ga0070684_100215721 | Ga0070684_1002157212 | 204 |
| 28 | 3300005563 | Ga0068855_100002167 | Ga0068855_1000021672 | 204 |
| 29 | 3300005578 | Ga0068854_100002569 | Ga0068854_10000256916 | 204 |
| 30 | 3300005616 | Ga0068852_100000494 | Ga0068852_10000049429 | 204 |
| 31 | 3300009093 | Ga0105240_10000052 | Ga0105240_10000052183 | 204 |
| 32 | 3300009093 | Ga0105240_10001137 | Ga0105240_1000113741 | 204 |
| 33 | 3300010375 | Ga0105239_10000196 | Ga0105239_1000019625 | 204 |
| 34 | 3300013100 | Ga0157373_10037403 | Ga0157373_100374033 | 204 |
| 35 | 3300025226 | Ga0209674_107571 | Ga0209674_1075712 | 204 |
| 36 | 3300025253 | Ga0209677_107965 | Ga0209677_1079653 | 204 |
| 37 | 3300025913 | Ga0207695_10000122 | Ga0207695_1000012235 | 204 |
| 38 | 3300025913 | Ga0207695_10000383 | Ga0207695_1000038358 | 204 |
| 39 | 3300025919 | Ga0207657_10119644 | Ga0207657_101196442 | 204 |
| 40 | 3300025933 | Ga0207706_10249026 | Ga0207706_102490261 | 204 |
| 41 | 3300025949 | Ga0207667_10000220 | Ga0207667_100002208 | 204 |
| 42 | 3300025981 | Ga0207640_10012298 | Ga0207640_100122983 | 204 |
| 43 | 3300026041 | Ga0207639_10000381 | Ga0207639_100003816 | 204 |
| 44 | 3300026067 | Ga0207678_10645720 | Ga0207678_106457202 | 204 |
| 45 | 3300026142 | Ga0207698_10029600 | Ga0207698_100296004 | 204 |
| 46 | 3300046522 | Ga0495643_0000336 | Ga0495643_0000336_1835_2449 | 204 |
| 47 | 3300046648 | Ga0495611_0183910 | Ga0495611_0183910_28_642 | 204 |
| 48 | 3300046660 | Ga0495625_0004505 | Ga0495625_0004505_9487_10101 | 204 |
| 49 | 3300048925 | Ga0496122_0143500 | Ga0496122_0143500_187_801 | 204 |
| 50 | 3300048926 | Ga0496123_0032108 | Ga0496123_0032108_461_1075 | 204 |
| 51 | 3300048927 | Ga0496124_0163874 | Ga0496124_0163874_604_1218 | 204 |
| 52 | 3300048928 | Ga0496125_0261256 | Ga0496125_0261256_166_780 | 204 |
| 53 | 3300049515 | Ga0501292_000073 | Ga0501292_000073_3060_3680 | 204 |
| 54 | 3300049522 | Ga0501299_076132 | Ga0501299_076132_83_715 | 204 |
| 55 | 3300049664 | Ga0501224_007590 | Ga0501224_007590_64_696 | 204 |
| 56 | 3300049665 | Ga0501227_047174 | Ga0501227_047174_57_689 | 204 |
| 57 | 3300049679 | Ga0501249_000114 | Ga0501249_000114_7665_8297 | 204 |
| 58 | 3300049775 | Ga0501279_000025 | Ga0501279_000025_27325_27945 | 204 |
| 59 | 3300049850 | Ga0501204_000714 | Ga0501204_000714_395_1027 | 204 |
| 60 | 3300005366 | Ga0070659_100109414 | Ga0070659_1001094143 | 205 |
| 61 | 3300005563 | Ga0068855_100023295 | Ga0068855_1000232959 | 205 |
| 62 | 3300005616 | Ga0068852_100001573 | Ga0068852_10000157313 | 205 |
| 63 | 3300010375 | Ga0105239_10085536 | Ga0105239_100855367 | 205 |
| 64 | 3300025901 | Ga0207688_10334653 | Ga0207688_103346531 | 205 |
| 65 | 3300025914 | Ga0207671_10000861 | Ga0207671_1000086123 | 205 |
| 66 | 3300025937 | Ga0207669_10000035 | Ga0207669_1000003558 | 205 |
| 67 | 3300025949 | Ga0207667_10006009 | Ga0207667_1000600918 | 205 |
| 68 | 3300026142 | Ga0207698_10001137 | Ga0207698_1000113711 | 205 |
| 69 | 3300047470 | Ga0495681_0064248 | Ga0495681_0064248_491_1108 | 205 |
| 70 | 3300049581 | Ga0501047_0157524 | Ga0501047_0157524_785_1408 | 206 |
| 71 | 3300049823 | Ga0501044_0001201 | Ga0501044_0001201_17186_17809 | 206 |
| 72 | 3300005841 | Ga0068863_100003498 | Ga0068863_10000349815 | 207 |
| 73 | 3300026088 | Ga0207641_10004228 | Ga0207641_100042288 | 207 |
| 74 | 3300005353 | Ga0070669_100024515 | Ga0070669_1000245154 | 208 |
| 75 | 3300005563 | Ga0068855_100001788 | Ga0068855_10000178816 | 208 |
| 76 | 3300005616 | Ga0068852_100131495 | Ga0068852_1001314952 | 208 |
| 77 | 3300025272 | Ga0209455_1007960 | Ga0209455_10079602 | 208 |
| 78 | 3300026142 | Ga0207698_10083796 | Ga0207698_100837962 | 208 |
| 79 | 3300047323 | Ga0495683_0143570 | Ga0495683_0143570_33_659 | 208 |
| 80 | 3300009545 | Ga0105237_10016164 | Ga0105237_100161643 | 209 |
| 81 | 3300010375 | Ga0105239_10019352 | Ga0105239_100193526 | 209 |
| 82 | 3300013102 | Ga0157371_10000024 | Ga0157371_1000002452 | 209 |
| 83 | 3300013307 | Ga0157372_10004796 | Ga0157372_100047968 | 209 |
| 84 | iso_pu_bacteria | 2510917026 | 2511170329 | 209 |
| 85 | iso_pu_bacteria | 2615840698 | 2616550834 | 209 |
| 86 | iso_pu_bacteria | 2643221643 | 2644238336 | 209 |
| 87 | iso_pu_bacteria | 2643221689 | 2644501555 | 209 |
| 88 | iso_pu_bacteria | 2643221718 | 2644651503 | 209 |
| 89 | iso_pu_bacteria | 2818991461 | 2819689133 | 209 |
| 90 | iso_pu_bacteria | 2821123053 | 2821129757 | 209 |
| 91 | iso_pu_bacteria | 2899845264 | 2899848184 | 209 |
| 92 | iso_pu_bacteria | 2933594066 | 2933598858 | 209 |
| 93 | iso_pu_bacteria | 2979089926 | 2979091904 | 209 |
| 94 | iso_pu_bacteria | 2979095461 | 2979100881 | 209 |
| 95 | iso_pu_bacteria | 2984587000 | 2984589014 | 209 |
| 96 | iso_pu_bacteria | 8005619151 | 8005626095 | 209 |
| 97 | iso_pu_bacteria | 8005688590 | 8005689597 | 209 |
| 98 | iso_pu_bacteria | 8024486573 | 8024486772 | 209 |
| 99 | 3300002459 | JGI24751J29686_10000487 | JGI24751J29686_100004875 | 210 |
| 100 | 3300003762 | Ga0055542_1000115 | Ga0055542_100011568 | 210 |
| 101 | 3300003763 | Ga0055529_1000052 | Ga0055529_1000052115 | 210 |
| 102 | 3300005331 | Ga0070670_100004404 | Ga0070670_1000044048 | 210 |
| 103 | 3300005344 | Ga0070661_100457751 | Ga0070661_1004577511 | 210 |
| 104 | 3300005577 | Ga0068857_100067074 | Ga0068857_1000670743 | 210 |
| 105 | 3300005618 | Ga0068864_100004245 | Ga0068864_1000042458 | 210 |
| 106 | 3300009174 | Ga0105241_10514511 | Ga0105241_105145112 | 210 |
| 107 | 3300009177 | Ga0105248_10340121 | Ga0105248_103401212 | 210 |
| 108 | 3300025254 | Ga0209148_1000011 | Ga0209148_1000011434 | 210 |
| 109 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006760 | 210 |
| 110 | 3300025920 | Ga0207649_10123595 | Ga0207649_101235953 | 210 |
| 111 | 3300025925 | Ga0207650_10002916 | Ga0207650_100029165 | 210 |
| 112 | 3300026095 | Ga0207676_10000041 | Ga0207676_10000041141 | 210 |
| 113 | 3300026116 | Ga0207674_10000167 | Ga0207674_1000016763 | 210 |
| 114 | 3300046471 | Ga0495650_0001705 | Ga0495650_0001705_14145_14777 | 210 |
| 115 | 3300053079 | Ga0500610_0000042 | Ga0500610_0000042_20759_21391 | 210 |
| 116 | 3300053735 | Ga0500596_004265 | Ga0500596_004265_715_1347 | 210 |
| 117 | iso_pu_bacteria | 2724679232 | 2725949110 | 210 |
| 118 | iso_pu_bacteria | 2775507266 | 2778179742 | 210 |
| 119 | iso_pu_bacteria | 2775507266 | 2778180048 | 210 |
| 120 | iso_pu_bacteria | 2838680041 | 2838683572 | 210 |
| 121 | iso_pu_bacteria | 2838694306 | 2838696162 | 210 |
| 122 | iso_pu_bacteria | 2838707686 | 2838710600 | 210 |
| 123 | iso_pu_bacteria | 2842077413 | 2842078773 | 210 |
| 124 | iso_pu_bacteria | 2842118031 | 2842118718 | 210 |
| 125 | iso_pu_bacteria | 2842237096 | 2842240628 | 210 |
| 126 | iso_pu_bacteria | 2842291075 | 2842292435 | 210 |
| 127 | iso_pu_bacteria | 2842370503 | 2842372158 | 210 |
| 128 | iso_pu_bacteria | 2842377471 | 2842378832 | 210 |
| 129 | iso_pu_bacteria | 2842384541 | 2842385228 | 210 |
| 130 | iso_pu_bacteria | 2919100787 | 2919105056 | 210 |
| 131 | iso_pu_bacteria | 2935894831 | 2935897131 | 210 |
| 132 | 3300005844 | Ga0068862_100000135 | Ga0068862_10000013566 | 211 |
| 133 | 3300009545 | Ga0105237_10019031 | Ga0105237_1001903112 | 211 |
| 134 | 3300028379 | Ga0268266_10050860 | Ga0268266_100508604 | 211 |
| 135 | 3300028380 | Ga0268265_10000152 | Ga0268265_1000015214 | 211 |
| 136 | 3300046522 | Ga0495643_0006596 | Ga0495643_0006596_6702_7337 | 211 |
| 137 | 3300048916 | Ga0496113_0121868 | Ga0496113_0121868_776_1423 | 211 |
| 138 | 3300048926 | Ga0496123_0099323 | Ga0496123_0099323_635_1282 | 211 |
| 139 | iso_pu_bacteria | 2582581305 | 2585263750 | 211 |
| 140 | iso_pu_bacteria | 3005416602 | 3005419143 | 211 |
| 141 | 3300009093 | Ga0105240_10363701 | Ga0105240_103637012 | 212 |
| 142 | 3300025900 | Ga0207710_10418797 | Ga0207710_104187971 | 212 |
| 143 | 3300031456 | Ga0307513_10053357 | Ga0307513_100533573 | 212 |
| 144 | 3300031911 | Ga0307412_10001831 | Ga0307412_100018318 | 212 |
| 145 | 3300048929 | Ga0496126_0002653 | Ga0496126_0002653_21516_22172 | 212 |
| 146 | iso_pu_bacteria | 2821123053 | 2821129912 | 212 |
| 147 | iso_pu_bacteria | 8057101203 | 8057104553 | 212 |
| 148 | 3300002773 | JGI25152J39213_1000158 | JGI25152J39213_100015855 | 213 |
| 149 | 3300003215 | JGI25153J46596_10000242 | JGI25153J46596_100002427 | 213 |
| 150 | 3300003215 | JGI25153J46596_10065305 | JGI25153J46596_100653052 | 213 |
| 151 | 3300003781 | Ga0055536_1006207 | Ga0055536_10062072 | 213 |
| 152 | 3300003792 | Ga0055540_1002544 | Ga0055540_10025442 | 213 |
| 153 | 3300003794 | Ga0055531_10002695 | Ga0055531_100026959 | 213 |
| 154 | 3300003794 | Ga0055531_10003780 | Ga0055531_100037802 | 213 |
| 155 | 3300003794 | Ga0055531_10005602 | Ga0055531_100056025 | 213 |
| 156 | 3300010375 | Ga0105239_10000065 | Ga0105239_10000065142 | 213 |
| 157 | 3300013104 | Ga0157370_10000054 | Ga0157370_10000054113 | 213 |
| 158 | 3300025245 | Ga0207425_1000076 | Ga0207425_100007672 | 213 |
| 159 | 3300025258 | Ga0209129_1000295 | Ga0209129_100029556 | 213 |
| 160 | 3300025292 | Ga0209676_1002994 | Ga0209676_10029949 | 213 |
| 161 | 3300025294 | Ga0209025_1016194 | Ga0209025_10161943 | 213 |
| 162 | 3300025297 | Ga0209758_1000168 | Ga0209758_1000168126 | 213 |
| 163 | 3300025297 | Ga0209758_1000752 | Ga0209758_100075256 | 213 |
| 164 | 3300025298 | Ga0209050_1005678 | Ga0209050_10056785 | 213 |
| 165 | 3300025303 | Ga0209051_1000192 | Ga0209051_10001922 | 213 |
| 166 | 3300025303 | Ga0209051_1003167 | Ga0209051_10031679 | 213 |
| 167 | 3300025304 | Ga0209257_1000300 | Ga0209257_1000300115 | 213 |
| 168 | 3300025304 | Ga0209257_1000319 | Ga0209257_100031936 | 213 |
| 169 | 3300025304 | Ga0209257_1005001 | Ga0209257_10050019 | 213 |
| 170 | 3300025304 | Ga0209257_1031043 | Ga0209257_10310433 | 213 |
| 171 | 3300031911 | Ga0307412_10001590 | Ga0307412_100015903 | 213 |
| 172 | 3300041413 | Ga0439465_0001484 | Ga0439465_0001484_1782_2426 | 213 |
| 173 | 3300041512 | Ga0451853_0542393 | Ga0451853_0542393_27_671 | 213 |
| 174 | 3300046515 | Ga0495620_0012352 | Ga0495620_0012352_3484_4128 | 213 |
| 175 | 3300046519 | Ga0495632_0151687 | Ga0495632_0151687_193_837 | 213 |
| 176 | 3300046522 | Ga0495643_0007890 | Ga0495643_0007890_4718_5362 | 213 |
| 177 | 3300046616 | Ga0495668_0207585 | Ga0495668_0207585_94_738 | 213 |
| 178 | 3300046660 | Ga0495625_0012447 | Ga0495625_0012447_5092_5736 | 213 |
| 179 | 3300046684 | Ga0495669_0000160 | Ga0495669_0000160_14056_14697 | 213 |
| 180 | 3300046810 | Ga0495660_0010122 | Ga0495660_0010122_525_1169 | 213 |
| 181 | 3300047323 | Ga0495683_0082965 | Ga0495683_0082965_724_1368 | 213 |
| 182 | 3300047472 | Ga0495686_0010960 | Ga0495686_0010960_4597_5241 | 213 |
| 183 | 3300048919 | Ga0496116_0222095 | Ga0496116_0222095_55_699 | 213 |
| 184 | 3300048920 | Ga0496117_0000105 | Ga0496117_0000105_48040_48684 | 213 |
| 185 | 3300048920 | Ga0496117_0077470 | Ga0496117_0077470_1037_1681 | 213 |
| 186 | 3300048921 | Ga0496118_0000168 | Ga0496118_0000168_50666_51310 | 213 |
| 187 | 3300048922 | Ga0496119_0000443 | Ga0496119_0000443_33166_33810 | 213 |
| 188 | 3300048923 | Ga0496120_0000818 | Ga0496120_0000818_3225_3869 | 213 |
| 189 | 3300048924 | Ga0496121_0014288 | Ga0496121_0014288_620_1264 | 213 |
| 190 | 3300048924 | Ga0496121_0057953 | Ga0496121_0057953_2003_2647 | 213 |
| 191 | 3300048924 | Ga0496121_0153091 | Ga0496121_0153091_448_1092 | 213 |
| 192 | 3300048924 | Ga0496121_0280098 | Ga0496121_0280098_306_950 | 213 |
| 193 | 3300048925 | Ga0496122_0000426 | Ga0496122_0000426_4076_4720 | 213 |
| 194 | 3300048925 | Ga0496122_0000868 | Ga0496122_0000868_18998_19642 | 213 |
| 195 | 3300048926 | Ga0496123_0000682 | Ga0496123_0000682_19078_19722 | 213 |
| 196 | 3300048926 | Ga0496123_0008238 | Ga0496123_0008238_1184_1828 | 213 |
| 197 | 3300048926 | Ga0496123_0137952 | Ga0496123_0137952_304_948 | 213 |
| 198 | 3300048928 | Ga0496125_0010644 | Ga0496125_0010644_8430_9074 | 213 |
| 199 | 3300048928 | Ga0496125_0362199 | Ga0496125_0362199_86_730 | 213 |
| 200 | 3300048928 | Ga0496125_0369846 | Ga0496125_0369846_60_704 | 213 |
| 201 | 3300048929 | Ga0496126_0002217 | Ga0496126_0002217_9895_10539 | 213 |
| 202 | 3300053086 | Ga0500578_0069513 | Ga0500578_0069513_716_1360 | 213 |
| 203 | 3300053109 | Ga0500569_000750 | Ga0500569_000750_827_1471 | 213 |
| 204 | 3300053118 | Ga0500594_0046082 | Ga0500594_0046082_455_1099 | 213 |
| 205 | 3300053134 | Ga0500658_0012885 | Ga0500658_0012885_2206_2850 | 213 |
| 206 | 3300053151 | Ga0500604_0109169 | Ga0500604_0109169_107_751 | 213 |
| 207 | 3300053153 | Ga0500616_0000120 | Ga0500616_0000120_111857_112501 | 213 |
| 208 | 3300053153 | Ga0500616_0000716 | Ga0500616_0000716_27733_28377 | 213 |
| 209 | 3300053153 | Ga0500616_0017346 | Ga0500616_0017346_1105_1749 | 213 |
| 210 | 3300003215 | JGI25153J46596_10060106 | JGI25153J46596_100601062 | 214 |
| 211 | 3300003316 | rootH1_10077980 | rootH1_100779803 | 214 |
| 212 | 3300003320 | rootH2_10184542 | rootH2_101845422 | 214 |
| 213 | 3300003775 | Ga0055524_1001546 | Ga0055524_10015466 | 214 |
| 214 | 3300003790 | Ga0055528_1000018 | Ga0055528_100001853 | 214 |
| 215 | 3300003790 | Ga0055528_1003337 | Ga0055528_10033375 | 214 |
| 216 | 3300003790 | Ga0055528_1009476 | Ga0055528_10094764 | 214 |
| 217 | 3300009093 | Ga0105240_10014957 | Ga0105240_100149576 | 214 |
| 218 | 3300009551 | Ga0105238_10000077 | Ga0105238_1000007745 | 214 |
| 219 | 3300017792 | Ga0163161_10041908 | Ga0163161_100419082 | 214 |
| 220 | 3300025258 | Ga0209129_1000280 | Ga0209129_10002802 | 214 |
| 221 | 3300025273 | Ga0209673_1000055 | Ga0209673_100005553 | 214 |
| 222 | 3300025273 | Ga0209673_1000468 | Ga0209673_100046831 | 214 |
| 223 | 3300025273 | Ga0209673_1002034 | Ga0209673_100203411 | 214 |
| 224 | 3300025297 | Ga0209758_1006302 | Ga0209758_10063029 | 214 |
| 225 | 3300025299 | Ga0209256_1000147 | Ga0209256_100014753 | 214 |
| 226 | 3300025299 | Ga0209256_1031596 | Ga0209256_10315962 | 214 |
| 227 | 3300025304 | Ga0209257_1045806 | Ga0209257_10458062 | 214 |
| 228 | 3300025913 | Ga0207695_10145651 | Ga0207695_101456512 | 214 |
| 229 | 3300025924 | Ga0207694_10000282 | Ga0207694_1000028212 | 214 |
| 230 | 3300026078 | Ga0207702_10541710 | Ga0207702_105417102 | 214 |
| 231 | 3300039437 | Ga0436365_0943179 | Ga0436365_0943179_351_995 | 214 |
| 232 | 3300048911 | Ga0496108_0004624 | Ga0496108_0004624_7654_8316 | 214 |
| 233 | 3300048924 | Ga0496121_0172531 | Ga0496121_0172531_505_1152 | 214 |
| 234 | 3300048924 | Ga0496121_0341376 | Ga0496121_0341376_30_674 | 214 |
| 235 | 3300048927 | Ga0496124_0003197 | Ga0496124_0003197_12218_12862 | 214 |
| 236 | 3300048929 | Ga0496126_0007057 | Ga0496126_0007057_10723_11367 | 214 |
| 237 | 3300049758 | Ga0501241_000780 | Ga0501241_000780_914_1558 | 214 |
| 238 | 3300003762 | Ga0055542_1009568 | Ga0055542_10095682 | 215 |
| 239 | 3300003763 | Ga0055529_1004298 | Ga0055529_10042982 | 215 |
| 240 | 3300005577 | Ga0068857_100013959 | Ga0068857_1000139597 | 215 |
| 241 | 3300005577 | Ga0068857_100050479 | Ga0068857_1000504792 | 215 |
| 242 | 3300005614 | Ga0068856_100777289 | Ga0068856_1007772892 | 215 |
| 243 | 3300005842 | Ga0068858_100006756 | Ga0068858_1000067566 | 215 |
| 244 | 3300009093 | Ga0105240_10005423 | Ga0105240_1000542316 | 215 |
| 245 | 3300009093 | Ga0105240_11188227 | Ga0105240_111882272 | 215 |
| 246 | 3300009177 | Ga0105248_10010850 | Ga0105248_100108504 | 215 |
| 247 | 3300009177 | Ga0105248_10020012 | Ga0105248_100200127 | 215 |
| 248 | 3300009545 | Ga0105237_10184133 | Ga0105237_101841333 | 215 |
| 249 | 3300013102 | Ga0157371_10000011 | Ga0157371_10000011148 | 215 |
| 250 | 3300025254 | Ga0209148_1003492 | Ga0209148_10034923 | 215 |
| 251 | 3300025272 | Ga0209455_1000734 | Ga0209455_100073411 | 215 |
| 252 | 3300025941 | Ga0207711_10001781 | Ga0207711_1000178112 | 215 |
| 253 | 3300025941 | Ga0207711_10009739 | Ga0207711_100097394 | 215 |
| 254 | 3300026035 | Ga0207703_10005384 | Ga0207703_100053845 | 215 |
| 255 | 3300026078 | Ga0207702_10563243 | Ga0207702_105632431 | 215 |
| 256 | 3300026116 | Ga0207674_10030602 | Ga0207674_100306029 | 215 |
| 257 | 3300031548 | Ga0307408_100907785 | Ga0307408_1009077851 | 215 |
| 258 | 3300047472 | Ga0495686_0000162 | Ga0495686_0000162_53051_53698 | 215 |
| 259 | 3300048921 | Ga0496118_0021411 | Ga0496118_0021411_1095_1742 | 215 |
| 260 | 3300048925 | Ga0496122_0013447 | Ga0496122_0013447_3172_3822 | 215 |
| 261 | 3300048925 | Ga0496122_0225990 | Ga0496122_0225990_52_702 | 215 |
| 262 | 3300048926 | Ga0496123_0016571 | Ga0496123_0016571_4137_4787 | 215 |
| 263 | 3300048926 | Ga0496123_0076339 | Ga0496123_0076339_907_1557 | 215 |
| 264 | 3300048928 | Ga0496125_0000039 | Ga0496125_0000039_13208_13858 | 215 |
| 265 | 3300048929 | Ga0496126_0003249 | Ga0496126_0003249_19042_19749 | 215 |
| 266 | 3300049574 | Ga0501038_0460325 | Ga0501038_0460325_180_827 | 215 |
| 267 | 3300053136 | Ga0500559_0007035 | Ga0500559_0007035_916_1563 | 215 |
| 268 | 3300053724 | Ga0500570_000100 | Ga0500570_000100_4788_5435 | 215 |
| 269 | 3300002075 | JGI24738J21930_10001812 | JGI24738J21930_100018123 | 216 |
| 270 | 3300003316 | rootH1_10068002 | rootH1_100680022 | 216 |
| 271 | 3300004625 | Ga0055543_1018388 | Ga0055543_10183883 | 216 |
| 272 | 3300005262 | Ga0065165_1012488 | Ga0065165_10124882 | 216 |
| 273 | 3300005327 | Ga0070658_10039621 | Ga0070658_100396212 | 216 |
| 274 | 3300005331 | Ga0070670_100072816 | Ga0070670_1000728163 | 216 |
| 275 | 3300005334 | Ga0068869_100006884 | Ga0068869_1000068845 | 216 |
| 276 | 3300005335 | Ga0070666_10054890 | Ga0070666_100548901 | 216 |
| 277 | 3300005339 | Ga0070660_100082530 | Ga0070660_1000825301 | 216 |
| 278 | 3300005347 | Ga0070668_100002824 | Ga0070668_1000028241 | 216 |
| 279 | 3300005353 | Ga0070669_100013377 | Ga0070669_1000133774 | 216 |
| 280 | 3300005367 | Ga0070667_100000103 | Ga0070667_10000010357 | 216 |
| 281 | 3300005536 | Ga0070697_100422131 | Ga0070697_1004221311 | 216 |
| 282 | 3300005548 | Ga0070665_100003036 | Ga0070665_1000030365 | 216 |
| 283 | 3300005563 | Ga0068855_100351900 | Ga0068855_1003519002 | 216 |
| 284 | 3300005563 | Ga0068855_100626205 | Ga0068855_1006262051 | 216 |
| 285 | 3300005578 | Ga0068854_100000257 | Ga0068854_10000025731 | 216 |
| 286 | 3300005617 | Ga0068859_100760935 | Ga0068859_1007609352 | 216 |
| 287 | 3300005841 | Ga0068863_100000377 | Ga0068863_10000037729 | 216 |
| 288 | 3300005843 | Ga0068860_100179939 | Ga0068860_1001799392 | 216 |
| 289 | 3300006358 | Ga0068871_100034956 | Ga0068871_1000349562 | 216 |
| 290 | 3300006931 | Ga0097620_100760787 | Ga0097620_1007607871 | 216 |
| 291 | 3300009093 | Ga0105240_10004459 | Ga0105240_1000445913 | 216 |
| 292 | 3300009545 | Ga0105237_10000775 | Ga0105237_1000077524 | 216 |
| 293 | 3300009551 | Ga0105238_10002182 | Ga0105238_1000218210 | 216 |
| 294 | 3300010375 | Ga0105239_10664193 | Ga0105239_106641932 | 216 |
| 295 | 3300013100 | Ga0157373_10047682 | Ga0157373_100476822 | 216 |
| 296 | 3300013296 | Ga0157374_10007062 | Ga0157374_100070624 | 216 |
| 297 | 3300013296 | Ga0157374_10214709 | Ga0157374_102147093 | 216 |
| 298 | 3300025315 | Ga0207697_10189256 | Ga0207697_101892561 | 216 |
| 299 | 3300025903 | Ga0207680_10075863 | Ga0207680_100758631 | 216 |
| 300 | 3300025904 | Ga0207647_10052510 | Ga0207647_100525103 | 216 |
| 301 | 3300025909 | Ga0207705_10081349 | Ga0207705_100813492 | 216 |
| 302 | 3300025913 | Ga0207695_10006147 | Ga0207695_1000614715 | 216 |
| 303 | 3300025914 | Ga0207671_10001293 | Ga0207671_1000129317 | 216 |
| 304 | 3300025919 | Ga0207657_10193503 | Ga0207657_101935032 | 216 |
| 305 | 3300025923 | Ga0207681_10016719 | Ga0207681_100167194 | 216 |
| 306 | 3300025924 | Ga0207694_10007888 | Ga0207694_100078885 | 216 |
| 307 | 3300025925 | Ga0207650_10089787 | Ga0207650_100897873 | 216 |
| 308 | 3300025942 | Ga0207689_10000704 | Ga0207689_100007045 | 216 |
| 309 | 3300025949 | Ga0207667_10296486 | Ga0207667_102964861 | 216 |
| 310 | 3300025961 | Ga0207712_10002983 | Ga0207712_1000298315 | 216 |
| 311 | 3300025972 | Ga0207668_10000541 | Ga0207668_1000054116 | 216 |
| 312 | 3300025972 | Ga0207668_10012170 | Ga0207668_100121705 | 216 |
| 313 | 3300025981 | Ga0207640_10000369 | Ga0207640_1000036927 | 216 |
| 314 | 3300025986 | Ga0207658_10000080 | Ga0207658_1000008049 | 216 |
| 315 | 3300026088 | Ga0207641_10000014 | Ga0207641_1000001414 | 216 |
| 316 | 3300028379 | Ga0268266_10004368 | Ga0268266_100043685 | 216 |
| 317 | 3300028381 | Ga0268264_10140236 | Ga0268264_101402363 | 216 |
| 318 | 3300035695 | Ga0373927_0348907 | Ga0373927_0348907_283_939 | 216 |
| 319 | 3300038443 | Ga0395901_0348059 | Ga0395901_0348059_679_1332 | 216 |
| 320 | 3300044693 | Ga0466961_0012474 | Ga0466961_0012474_3694_4344 | 216 |
| 321 | 3300047472 | Ga0495686_0000836 | Ga0495686_0000836_18926_19576 | 216 |
| 322 | 3300047472 | Ga0495686_0010184 | Ga0495686_0010184_5128_5856 | 216 |
| 323 | 3300047472 | Ga0495686_0190166 | Ga0495686_0190166_513_1163 | 216 |
| 324 | 3300053134 | Ga0500658_0123043 | Ga0500658_0123043_398_1141 | 216 |
| 325 | 3300053730 | Ga0500645_000934 | Ga0500645_000934_11255_11911 | 216 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8d2m-assembly2.cif.gz_B | covalent schiff base complex of yedk c2a and abasic dna | 0.8139 | 3 | 196 |
| 1zn6-assembly1.cif.gz_A | x-ray crystal structure of protein q7wlm8 from bordetella bronchiseptica. northeast structural genomics consortium target bor19. | 0.8135 | 2 | 197 |
| 2f20-assembly2.cif.gz_B | x-ray crystal structure of protein bt_1218 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr8. | 0.8024 | 2 | 196 |
| 6kbz-assembly4.cif.gz_H | crystal structure of yedk with ssdna containing a tetrahydrofuran abasic site | 0.7968 | 2 | 196 |
| 8d2m-assembly1.cif.gz_A | covalent schiff base complex of yedk c2a and abasic dna | 0.7939 | 3 | 196 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1KYZ5_1_237_3.90.1680.10 | Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like | 0.7909 | 1 | 196 | 3.90.1680.10 |
| 1zn6A00 | Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like | 0.7839 | 2 | 197 | 3.90.1680.10 |
| 6nlcA00 | Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like | 0.7814 | 2 | 196 | 3.90.1680.10 |
| af_O05872_1_242_3.90.1680.10 | Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like | 0.7691 | 1 | 196 | 3.90.1680.10 |
| af_Q04471_25_258_3.90.1680.10 | Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like | 0.7619 | 22 | 196 | 3.90.1680.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4DQ42-F1-model_v4 | deleted | 0.9899 | 1 | 206 |
|
| AF-A0A1E4J290-F1-model_v4 | DUF159 family protein | 0.9888 | 79 | 201 |
GO:0003697
GO:0106300 |
| AF-A0A839XGK0-F1-model_v4 | deleted | 0.9873 | 83 | 175 |
|
| AF-A0A2W4DQ42-F1-model_v4 | deleted | 0.9852 | 1 | 206 |
|
| AF-A0A4Q3CMU9-F1-model_v4 | deleted | 0.9798 | 94 | 201 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar