F407584

General Info

Members Datasets Scaffolds Average Seq Length
324 235 648 197

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_583349_c1|nmdc:mga08x19_583349_c1_54_758
Length 222
Sequence VDRAWRGRRRHGRGNVLPHLTDFLAFLEQLPAGPLYALIAALAAAENIFPPVPADAAVALGAFLSGRGVMNPWLVFLLTWVANVSSGAGVYALARRHGETVTRGFLGRHIFTPNTVAHIAEQYRRHGTYGIFFSRLLPVWRGMVMPFAGIARVAPWRALVPMALASALYYGALTYLVHRLGTNLEDVLRILRRVNSVLAIVAGVLVVGIVLWIVRRRRHPPQ

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.09
Rhizosphere 96.91
Stem 0
Stem Tuber 0
Unclassified 13.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_583349_c1 3300050514 Bacteria 792
2 Ga0070658_10011273 3300005327 Bacteria 7164
3 Ga0070676_10075372 3300005328 Bacteria 2034
4 Ga0070683_100028453 3300005329 Bacteria 5051
5 Ga0070683_100049546 3300005329 Bacteria 3885
6 Ga0070683_100553851 3300005329 Bacteria 1100
7 Ga0070690_100979674 3300005330 Bacteria 665
8 Ga0070670_100215428 3300005331 Bacteria 1670
9 Ga0070680_100111238 3300005336 Bacteria 2280
10 Ga0070660_100337986 3300005339 Bacteria 1239
11 Ga0070691_10099092 3300005341 Bacteria 1445
12 Ga0070687_100007235 3300005343 Bacteria 4610
13 Ga0070668_100246869 3300005347 Bacteria 1480
14 Ga0070669_100001817 3300005353 Bacteria 15371
15 Ga0070669_100326590 3300005353 Bacteria 1240
16 Ga0070669_100417446 3300005353 Bacteria 1101
17 Ga0070675_100016790 3300005354 Bacteria 5813
18 Ga0070675_100202855 3300005354 Bacteria 1721
19 Ga0070671_100168973 3300005355 Bacteria 1849
20 Ga0070671_100231606 3300005355 Bacteria 1568
21 Ga0070673_100034241 3300005364 Bacteria 3841
22 Ga0070659_100024614 3300005366 Bacteria 4615
23 Ga0070667_100205249 3300005367 Bacteria 1749
24 Ga0070709_10029355 3300005434 Bacteria 3289
25 Ga0070709_10094394 3300005434 Bacteria 1979
26 Ga0070714_100117101 3300005435 Bacteria 2366
27 Ga0070714_100140531 3300005435 Bacteria 2167
28 Ga0070714_100444318 3300005435 Bacteria 1231
29 Ga0070713_100047470 3300005436 Bacteria 3530
30 Ga0070713_100075619 3300005436 Bacteria 2857
31 Ga0070710_10029963 3300005437 Bacteria 2924
32 Ga0070710_10118012 3300005437 Bacteria 1602
33 Ga0070701_10130858 3300005438 Bacteria 1425
34 Ga0070711_100169894 3300005439 Bacteria 1661
35 Ga0070700_100020129 3300005441 Bacteria 3860
36 Ga0070700_100476336 3300005441 Bacteria 955
37 Ga0070694_100021187 3300005444 Bacteria 4150
38 Ga0070694_100127448 3300005444 Bacteria 1834
39 Ga0070663_100107212 3300005455 Bacteria 2094
40 Ga0070662_100375800 3300005457 Unclassified 1169
41 Ga0070681_10016240 3300005458 Bacteria 7426
42 Ga0068867_100052577 3300005459 Bacteria 3006
43 Ga0068867_100583127 3300005459 Unclassified 973
44 Ga0070685_10019077 3300005466 Bacteria 3697
45 Ga0070698_100031770 3300005471 Bacteria 5472
46 Ga0070698_100325528 3300005471 Bacteria 1468
47 Ga0070699_100044702 3300005518 Bacteria 3834
48 Ga0070699_100149325 3300005518 Bacteria 2066
49 Ga0070679_100090240 3300005530 Bacteria 3053
50 Ga0070679_100176170 3300005530 Bacteria 2111
51 Ga0070679_100466723 3300005530 Bacteria 1207
52 Ga0070679_100736811 3300005530 Unclassified 928
53 Ga0070684_100009263 3300005535 Bacteria 7749
54 Ga0070684_100096163 3300005535 Bacteria 2640
55 Ga0070684_100268026 3300005535 Unclassified 1563
56 Ga0070697_100469036 3300005536 Bacteria 1098
57 Ga0068853_100163489 3300005539 Bacteria 2010
58 Ga0068853_100636180 3300005539 Bacteria 1015
59 Ga0070672_100031158 3300005543 Bacteria 4012
60 Ga0070672_100175647 3300005543 Bacteria 1783
61 Ga0070695_100933721 3300005545 Bacteria 702
62 Ga0070696_100064420 3300005546 Bacteria 2568
63 Ga0070693_100005500 3300005547 Bacteria 6093
64 Ga0070704_100022430 3300005549 Bacteria 4108
65 Ga0070704_100315594 3300005549 Bacteria 1307
66 Ga0070664_100028383 3300005564 Bacteria 4654
67 Ga0070664_100037137 3300005564 Bacteria 4093
68 Ga0070664_100182789 3300005564 Bacteria 1864
69 Ga0068857_100040232 3300005577 Bacteria 4145
70 Ga0068857_100176801 3300005577 Bacteria 1942
71 Ga0070702_100399172 3300005615 Bacteria 983
72 Ga0068852_100026584 3300005616 Bacteria 4707
73 Ga0068852_100331545 3300005616 Bacteria 1481
74 Ga0068852_100778506 3300005616 Unclassified 970
75 Ga0068859_100060831 3300005617 Bacteria 3806
76 Ga0068859_100339115 3300005617 Unclassified 1597
77 Ga0068866_10263196 3300005718 Unclassified 1061
78 Ga0068861_100089536 3300005719 Bacteria 2426
79 Ga0068851_10048003 3300005834 Bacteria 2163
80 Ga0068870_10118842 3300005840 Bacteria 1520
81 Ga0068860_100786238 3300005843 Bacteria 965
82 Ga0068862_100286707 3300005844 Bacteria 1511
83 Ga0070717_10000724 3300006028 Bacteria 21453
84 Ga0070717_10197289 3300006028 Bacteria 1761
85 Ga0070717_10567934 3300006028 Bacteria 1028
86 Ga0070717_10710403 3300006028 Bacteria 913
87 Ga0070716_100148694 3300006173 Bacteria 1504
88 Ga0070716_100345419 3300006173 Unclassified 1051
89 Ga0070712_100028920 3300006175 Bacteria 3712
90 Ga0075428_100089598 3300006844 Bacteria 3355
91 Ga0075428_100253525 3300006844 Bacteria 1896
92 Ga0075428_100418357 3300006844 Bacteria 1436
93 Ga0075431_100205668 3300006847 Bacteria 2013
94 Ga0075433_10035426 3300006852 Bacteria 4292
95 Ga0075433_10361253 3300006852 Unclassified 1283
96 Ga0075434_100017013 3300006871 Bacteria 6997
97 Ga0075434_100191766 3300006871 Bacteria 2064
98 Ga0075434_100283657 3300006871 Unclassified 1676
99 Ga0075429_100025902 3300006880 Bacteria 5091
100 Ga0075429_100046295 3300006880 Bacteria 3785
101 Ga0068865_100093124 3300006881 Bacteria 2190
102 Ga0075436_100040789 3300006914 Bacteria 3203
103 Ga0097620_100060832 3300006931 Bacteria 3806
104 Ga0097620_100339103 3300006931 Unclassified 1597
105 Ga0075435_100107670 3300007076 Bacteria 2315
106 Ga0111539_10034994 3300009094 Bacteria 6083
107 Ga0111539_10953401 3300009094 Bacteria 998
108 Ga0114129_10016339 3300009147 Bacteria 10565
109 Ga0114129_10127230 3300009147 Bacteria 3502
110 Ga0114129_11015606 3300009147 Unclassified 1043
111 Ga0114129_11107413 3300009147 Bacteria 991
112 Ga0105242_10030108 3300009176 Bacteria 4334
113 Ga0105248_10280077 3300009177 Bacteria 1877
114 Ga0157369_10563871 3300013105 Bacteria 1177
115 Ga0163162_10153432 3300013306 Bacteria 2422
116 Ga0163162_10393148 3300013306 Bacteria 1519
117 Ga0157372_11649118 3300013307 Bacteria 738
118 Ga0157375_10020295 3300013308 Bacteria 6066
119 Ga0157380_10013342 3300014326 Bacteria 5989
120 Ga0157380_10200542 3300014326 Bacteria 1770
121 Ga0157377_10101404 3300014745 Bacteria 1716
122 Ga0207692_10022106 3300025898 Bacteria 2923
123 Ga0207692_10081032 3300025898 Bacteria 1736
124 Ga0207692_10603544 3300025898 Unclassified 706
125 Ga0207642_10156599 3300025899 Unclassified 1218
126 Ga0207699_10000738 3300025906 Bacteria 15599
127 Ga0207699_10063283 3300025906 Bacteria 2234
128 Ga0207699_10096923 3300025906 Bacteria 1863
129 Ga0207645_10013280 3300025907 Bacteria 5556
130 Ga0207643_10014314 3300025908 Bacteria 4308
131 Ga0207705_10528936 3300025909 Unclassified 916
132 Ga0207707_10003507 3300025912 Bacteria 13889
133 Ga0207707_10404490 3300025912 Bacteria 1172
134 Ga0207693_10039218 3300025915 Bacteria 3730
135 Ga0207663_10177737 3300025916 Unclassified 1517
136 Ga0207663_10189812 3300025916 Bacteria 1474
137 Ga0207662_10002951 3300025918 Bacteria 8646
138 Ga0207657_10073710 3300025919 Bacteria 2884
139 Ga0207652_10021058 3300025921 Bacteria 5378
140 Ga0207646_10037597 3300025922 Bacteria 4364
141 Ga0207681_10769810 3300025923 Bacteria 803
142 Ga0207659_10002341 3300025926 Bacteria 11285
143 Ga0207659_10308310 3300025926 Bacteria 1302
144 Ga0207700_10113615 3300025928 Bacteria 2184
145 Ga0207664_10106571 3300025929 Bacteria 2324
146 Ga0207644_10252727 3300025931 Bacteria 1407
147 Ga0207644_10350573 3300025931 Bacteria 1198
148 Ga0207690_10022080 3300025932 Bacteria 3954
149 Ga0207706_10308701 3300025933 Unclassified 1378
150 Ga0207706_10579634 3300025933 Bacteria 965
151 Ga0207686_10133903 3300025934 Unclassified 1703
152 Ga0207704_10056620 3300025938 Bacteria 2403
153 Ga0207704_10490054 3300025938 Unclassified 988
154 Ga0207665_10102820 3300025939 Bacteria 1997
155 Ga0207691_10004269 3300025940 Bacteria 13882
156 Ga0207691_10174067 3300025940 Bacteria 1883
157 Ga0207691_10183838 3300025940 Bacteria 1825
158 Ga0207691_10304110 3300025940 Unclassified 1369
159 Ga0207711_10212773 3300025941 Bacteria 1766
160 Ga0207661_10135545 3300025944 Bacteria 2114
161 Ga0207679_10047977 3300025945 Bacteria 3106
162 Ga0207651_10063414 3300025960 Bacteria 2580
163 Ga0207668_10748339 3300025972 Bacteria 862
164 Ga0207677_10674698 3300026023 Bacteria 914
165 Ga0207703_10167847 3300026035 Unclassified 1928
166 Ga0207639_10500269 3300026041 Bacteria 1110
167 Ga0207678_10608966 3300026067 Bacteria 958
168 Ga0207708_10088115 3300026075 Unclassified 2391
169 Ga0207702_10226171 3300026078 Bacteria 1746
170 Ga0207702_10785283 3300026078 Bacteria 941
171 Ga0207648_10084889 3300026089 Bacteria 2762
172 Ga0207674_10102890 3300026116 Bacteria 2836
173 Ga0207674_10191871 3300026116 Bacteria 1993
174 Ga0207675_100119888 3300026118 Bacteria 2488
175 Ga0207683_10262664 3300026121 Unclassified 1576
176 Ga0207698_10018067 3300026142 Bacteria 4798
177 Ga0209966_1008950 3300027695 Unclassified 1784
178 Ga0207428_10021172 3300027907 Bacteria 5508
179 Ga0207428_10300529 3300027907 Bacteria 1188
180 Ga0268265_10031691 3300028380 Bacteria 3820
181 Ga0268264_11131288 3300028381 Bacteria 792
182 Ga0307408_100134189 3300031548 Bacteria 1935
183 Ga0307408_100192379 3300031548 Bacteria 1645
184 Ga0307405_10173574 3300031731 Bacteria 1540
185 Ga0316577_10203341 3300031733 Unclassified 1119
186 Ga0307413_10346277 3300031824 Bacteria 1145
187 Ga0307406_10194973 3300031901 Unclassified 1486
188 Ga0307406_10250067 3300031901 Bacteria 1335
189 Ga0307406_10570392 3300031901 Unclassified 929
190 Ga0307407_10493125 3300031903 Bacteria 897
191 Ga0307412_10139168 3300031911 Bacteria 1775
192 Ga0307409_100432594 3300031995 Bacteria 1265
193 Ga0307416_100476291 3300032002 Unclassified 1307
194 Ga0307414_10267412 3300032004 Bacteria 1430
195 Ga0307411_10348311 3300032005 Unclassified 1207
196 Ga0307411_11155274 3300032005 Unclassified 700
197 Ga0373926_0003535 3300035083 Bacteria 5056
198 Ga0373934_0000219 3300035086 Bacteria 20869
199 Ga0373944_0037014 3300035089 Bacteria 1493
200 Ga0373923_0263203 3300035111 Unclassified 809
201 Ga0373936_0069432 3300035113 Unclassified 1450
202 Ga0373936_0074930 3300035113 Unclassified 1401
203 Ga0373953_0013200 3300035117 Bacteria 2945
204 Ga0373954_0036756 3300035118 Bacteria 2274
205 Ga0373956_0000144 3300035119 Bacteria 25834
206 Ga0373957_0058137 3300035120 Unclassified 1493
207 Ga0373943_0011544 3300035170 Bacteria 3976
208 Ga0316574_0009405 3300035398 Bacteria 5475
209 Ga0373924_0051092 3300035410 Unclassified 1713
210 Ga0373935_0014901 3300035692 Bacteria 4695
211 Ga0373927_0004774 3300035695 Bacteria 9440
212 Ga0373933_0000353 3300035724 Bacteria 29440
213 Ga0373947_0004333 3300035725 Bacteria 8334
214 Ga0373937_0000450 3300036401 Bacteria 37946
215 Ga0373937_0123727 3300036401 Bacteria 2412
216 Ga0316582_0190480 3300036647 Bacteria 1397
217 Ga0316582_0646307 3300036647 Unclassified 727
218 Ga0316584_0194998 3300036712 Bacteria 1496
219 Ga0316584_0228504 3300036712 Bacteria 1365
220 Ga0373925_0017362 3300037068 Bacteria 5215
221 Ga0373925_0191019 3300037068 Bacteria 1625
222 Ga0453683_0045986 3300044673 Bacteria 2737
223 Ga0453684_0117108 3300044712 Bacteria 3225
224 Ga0451576_0067919 3300045051 Bacteria 3710
225 Ga0451576_0134470 3300045051 Bacteria 2578
226 Ga0466958_0306270 3300045836 Unclassified 1020
227 Ga0466967_0882679 3300045976 Unclassified 889
228 Ga0495592_0010684 3300046454 Bacteria 6922
229 Ga0495603_0026232 3300046455 Bacteria 3521
230 Ga0495629_0028864 3300046459 Bacteria 3938
231 Ga0495629_0048405 3300046459 Bacteria 2980
232 Ga0495641_0314296 3300046461 Bacteria 707
233 Ga0495651_0000050 3300046462 Bacteria 87816
234 Ga0495653_0000195 3300046463 Bacteria 49244
235 Ga0495580_0115366 3300046472 Bacteria 1865
236 Ga0495582_0018155 3300046473 Bacteria 3849
237 Ga0495639_0000903 3300046475 Bacteria 13407
238 Ga0495596_0102366 3300046500 Bacteria 1112
239 Ga0495608_0000787 3300046511 Bacteria 22269
240 Ga0495618_0165947 3300046514 Unclassified 1406
241 Ga0495628_0001915 3300046516 Bacteria 18878
242 Ga0495630_0027734 3300046517 Bacteria 4205
243 Ga0495630_0335989 3300046517 Bacteria 1155
244 Ga0495652_0001266 3300046529 Bacteria 28253
245 Ga0495654_0158650 3300046530 Bacteria 995
246 Ga0495665_0002117 3300046531 Bacteria 10750
247 Ga0495640_0257843 3300046533 Unclassified 1090
248 Ga0495586_0062954 3300046535 Bacteria 2020
249 Ga0495587_0000114 3300046536 Bacteria 61671
250 Ga0495645_0000144 3300046543 Bacteria 48490
251 Ga0495622_0124706 3300046557 Bacteria 1175
252 Ga0495667_0000241 3300046559 Bacteria 35516
253 Ga0495634_0093159 3300046642 Bacteria 1954
254 Ga0495635_0002069 3300046663 Bacteria 13601
255 Ga0495635_0158196 3300046663 Bacteria 1542
256 Ga0495588_0004435 3300046674 Bacteria 6205
257 Ga0495657_0000210 3300046675 Bacteria 52663
258 Ga0495599_0000754 3300046678 Bacteria 18240
259 Ga0495623_0002056 3300046679 Bacteria 13505
260 Ga0495623_0033505 3300046679 Bacteria 3296
261 Ga0495646_0013997 3300046680 Bacteria 5099
262 Ga0495647_0193642 3300046681 Unclassified 889
263 Ga0495658_0020957 3300046683 Bacteria 3439
264 Ga0495669_0210545 3300046684 Unclassified 931
265 Ga0495613_0008405 3300046689 Bacteria 7664
266 Ga0495600_0000023 3300046809 Bacteria 94401
267 Ga0495581_0001793 3300047315 Bacteria 11992
268 Ga0495604_0003267 3300047317 Bacteria 12953
269 Ga0495674_0000339 3300047319 Bacteria 41326
270 Ga0495676_0267568 3300047321 Bacteria 1161
271 Ga0495680_0001928 3300047322 Bacteria 21805
272 Ga0495675_0002320 3300047444 Bacteria 11370
273 Ga0495675_0011459 3300047444 Bacteria 5566
274 Ga0495684_0000037 3300047471 Bacteria 106933
275 Ga0495593_0001571 3300047673 Bacteria 13485
276 Ga0495602_0051511 3300048088 Bacteria 3665
277 Ga0495602_0057585 3300048088 Bacteria 3408
278 Ga0495614_0001483 3300048089 Bacteria 10159
279 Ga0495615_0015106 3300048090 Bacteria 1644
280 Ga0496100_0070239 3300048903 Bacteria 2335
281 Ga0496104_0149264 3300048907 Bacteria 2245
282 Ga0496105_0287240 3300048908 Bacteria 1325
283 Ga0496106_0096066 3300048909 Bacteria 2293
284 Ga0496107_0045540 3300048910 Bacteria 3156
285 Ga0496109_0159975 3300048912 Bacteria 2110
286 Ga0496109_0621282 3300048912 Unclassified 1017
287 Ga0496113_0040538 3300048916 Bacteria 3432
288 Ga0496114_0238567 3300048917 Bacteria 1598
289 Ga0496115_0006074 3300048918 Bacteria 8819
290 Ga0501032_0223496 3300049569 Bacteria 1225
291 Ga0501036_0161898 3300049572 Bacteria 1886
292 Ga0501038_0208122 3300049574 Bacteria 1567
293 Ga0501039_0077267 3300049575 Bacteria 2589
294 Ga0501041_0209223 3300049577 Bacteria 1223
295 Ga0501042_0013378 3300049578 Bacteria 5583
296 Ga0501048_0238511 3300049582 Bacteria 1290
297 Ga0501072_0017627 3300049588 Bacteria 5492
298 Ga0501073_0183775 3300049589 Bacteria 1447
299 Ga0501076_0136754 3300049592 Bacteria 1989
300 Ga0501230_060426 3300049667 Unclassified 767
301 Ga0501080_0035571 3300049742 Bacteria 4648
302 Ga0501035_0610224 3300049822 Bacteria 888
303 nmdc:mga05p37_236466_c1 3300050507 Bacteria 2199
304 nmdc:mga05p37_52664_c1 3300050507 Bacteria 5004
305 nmdc:mga05p37_577239_c1 3300050507 Bacteria 1274
306 nmdc:mga09592_22329_c1 3300050508 Bacteria 5222
307 nmdc:mga09592_49176_c1 3300050508 Bacteria 3555
308 nmdc:mga0qj67_743739_c1 3300050509 Bacteria 778
309 nmdc:mga06r32_353859_c1 3300050510 Unclassified 1453
310 nmdc:mga06r32_43927_c1 3300050510 Bacteria 4253
311 nmdc:mga06r32_623055_c1 3300050510 Bacteria 1048
312 nmdc:mga06r32_96145_c1 3300050510 Bacteria 2900
313 nmdc:mga08y16_213646_c1 3300050511 Bacteria 1997
314 nmdc:mga08y16_32749_c1 3300050511 Bacteria 5465
315 nmdc:mga0n895_137463_c1 3300050512 Bacteria 2471
316 nmdc:mga0n895_258320_c1 3300050512 Bacteria 1768
317 nmdc:mga0rr50_34226_c1 3300050513 Bacteria 3637
318 nmdc:mga08x19_34606_c1 3300050514 Bacteria 3194
319 nmdc:mga0a205_147384_c1 3300050515 Bacteria 2254
320 Ga0495601_0035424 3300053077 Bacteria 3115
321 Ga0495612_0000696 3300053078 Bacteria 13595
322 Ga0495595_0034955 3300053084 Bacteria 2275
323 Ga0495619_0009945 3300053085 Bacteria 5990
324 Ga0501084_0217768 3300054114 Bacteria 1611
325 nmdc:mga08x19_583349_c1
326 Ga0070658_10011273
327 Ga0070676_10075372
328 Ga0070683_100028453
329 Ga0070683_100049546
330 Ga0070683_100553851
331 Ga0070690_100979674
332 Ga0070670_100215428
333 Ga0070680_100111238
334 Ga0070660_100337986
335 Ga0070691_10099092
336 Ga0070687_100007235
337 Ga0070668_100246869
338 Ga0070669_100001817
339 Ga0070669_100326590
340 Ga0070669_100417446
341 Ga0070675_100016790
342 Ga0070675_100202855
343 Ga0070671_100168973
344 Ga0070671_100231606
345 Ga0070673_100034241
346 Ga0070659_100024614
347 Ga0070667_100205249
348 Ga0070709_10029355
349 Ga0070709_10094394
350 Ga0070714_100117101
351 Ga0070714_100140531
352 Ga0070714_100444318
353 Ga0070713_100047470
354 Ga0070713_100075619
355 Ga0070710_10029963
356 Ga0070710_10118012
357 Ga0070701_10130858
358 Ga0070711_100169894
359 Ga0070700_100020129
360 Ga0070700_100476336
361 Ga0070694_100021187
362 Ga0070694_100127448
363 Ga0070663_100107212
364 Ga0070662_100375800
365 Ga0070681_10016240
366 Ga0068867_100052577
367 Ga0068867_100583127
368 Ga0070685_10019077
369 Ga0070698_100031770
370 Ga0070698_100325528
371 Ga0070699_100044702
372 Ga0070699_100149325
373 Ga0070679_100090240
374 Ga0070679_100176170
375 Ga0070679_100466723
376 Ga0070679_100736811
377 Ga0070684_100009263
378 Ga0070684_100096163
379 Ga0070684_100268026
380 Ga0070697_100469036
381 Ga0068853_100163489
382 Ga0068853_100636180
383 Ga0070672_100031158
384 Ga0070672_100175647
385 Ga0070695_100933721
386 Ga0070696_100064420
387 Ga0070693_100005500
388 Ga0070704_100022430
389 Ga0070704_100315594
390 Ga0070664_100028383
391 Ga0070664_100037137
392 Ga0070664_100182789
393 Ga0068857_100040232
394 Ga0068857_100176801
395 Ga0070702_100399172
396 Ga0068852_100026584
397 Ga0068852_100331545
398 Ga0068852_100778506
399 Ga0068859_100060831
400 Ga0068859_100339115
401 Ga0068866_10263196
402 Ga0068861_100089536
403 Ga0068851_10048003
404 Ga0068870_10118842
405 Ga0068860_100786238
406 Ga0068862_100286707
407 Ga0070717_10000724
408 Ga0070717_10197289
409 Ga0070717_10567934
410 Ga0070717_10710403
411 Ga0070716_100148694
412 Ga0070716_100345419
413 Ga0070712_100028920
414 Ga0075428_100089598
415 Ga0075428_100253525
416 Ga0075428_100418357
417 Ga0075431_100205668
418 Ga0075433_10035426
419 Ga0075433_10361253
420 Ga0075434_100017013
421 Ga0075434_100191766
422 Ga0075434_100283657
423 Ga0075429_100025902
424 Ga0075429_100046295
425 Ga0068865_100093124
426 Ga0075436_100040789
427 Ga0097620_100060832
428 Ga0097620_100339103
429 Ga0075435_100107670
430 Ga0111539_10034994
431 Ga0111539_10953401
432 Ga0114129_10016339
433 Ga0114129_10127230
434 Ga0114129_11015606
435 Ga0114129_11107413
436 Ga0105242_10030108
437 Ga0105248_10280077
438 Ga0157369_10563871
439 Ga0163162_10153432
440 Ga0163162_10393148
441 Ga0157372_11649118
442 Ga0157375_10020295
443 Ga0157380_10013342
444 Ga0157380_10200542
445 Ga0157377_10101404
446 Ga0207692_10022106
447 Ga0207692_10081032
448 Ga0207692_10603544
449 Ga0207642_10156599
450 Ga0207699_10000738
451 Ga0207699_10063283
452 Ga0207699_10096923
453 Ga0207645_10013280
454 Ga0207643_10014314
455 Ga0207705_10528936
456 Ga0207707_10003507
457 Ga0207707_10404490
458 Ga0207693_10039218
459 Ga0207663_10177737
460 Ga0207663_10189812
461 Ga0207662_10002951
462 Ga0207657_10073710
463 Ga0207652_10021058
464 Ga0207646_10037597
465 Ga0207681_10769810
466 Ga0207659_10002341
467 Ga0207659_10308310
468 Ga0207700_10113615
469 Ga0207664_10106571
470 Ga0207644_10252727
471 Ga0207644_10350573
472 Ga0207690_10022080
473 Ga0207706_10308701
474 Ga0207706_10579634
475 Ga0207686_10133903
476 Ga0207704_10056620
477 Ga0207704_10490054
478 Ga0207665_10102820
479 Ga0207691_10004269
480 Ga0207691_10174067
481 Ga0207691_10183838
482 Ga0207691_10304110
483 Ga0207711_10212773
484 Ga0207661_10135545
485 Ga0207679_10047977
486 Ga0207651_10063414
487 Ga0207668_10748339
488 Ga0207677_10674698
489 Ga0207703_10167847
490 Ga0207639_10500269
491 Ga0207678_10608966
492 Ga0207708_10088115
493 Ga0207702_10226171
494 Ga0207702_10785283
495 Ga0207648_10084889
496 Ga0207674_10102890
497 Ga0207674_10191871
498 Ga0207675_100119888
499 Ga0207683_10262664
500 Ga0207698_10018067
501 Ga0209966_1008950
502 Ga0207428_10021172
503 Ga0207428_10300529
504 Ga0268265_10031691
505 Ga0268264_11131288
506 Ga0307408_100134189
507 Ga0307408_100192379
508 Ga0307405_10173574
509 Ga0316577_10203341
510 Ga0307413_10346277
511 Ga0307406_10194973
512 Ga0307406_10250067
513 Ga0307406_10570392
514 Ga0307407_10493125
515 Ga0307412_10139168
516 Ga0307409_100432594
517 Ga0307416_100476291
518 Ga0307414_10267412
519 Ga0307411_10348311
520 Ga0307411_11155274
521 Ga0373926_0003535
522 Ga0373934_0000219
523 Ga0373944_0037014
524 Ga0373923_0263203
525 Ga0373936_0069432
526 Ga0373936_0074930
527 Ga0373953_0013200
528 Ga0373954_0036756
529 Ga0373956_0000144
530 Ga0373957_0058137
531 Ga0373943_0011544
532 Ga0316574_0009405
533 Ga0373924_0051092
534 Ga0373935_0014901
535 Ga0373927_0004774
536 Ga0373933_0000353
537 Ga0373947_0004333
538 Ga0373937_0000450
539 Ga0373937_0123727
540 Ga0316582_0190480
541 Ga0316582_0646307
542 Ga0316584_0194998
543 Ga0316584_0228504
544 Ga0373925_0017362
545 Ga0373925_0191019
546 Ga0453683_0045986
547 Ga0453684_0117108
548 Ga0451576_0067919
549 Ga0451576_0134470
550 Ga0466958_0306270
551 Ga0466967_0882679
552 Ga0495592_0010684
553 Ga0495603_0026232
554 Ga0495629_0028864
555 Ga0495629_0048405
556 Ga0495641_0314296
557 Ga0495651_0000050
558 Ga0495653_0000195
559 Ga0495580_0115366
560 Ga0495582_0018155
561 Ga0495639_0000903
562 Ga0495596_0102366
563 Ga0495608_0000787
564 Ga0495618_0165947
565 Ga0495628_0001915
566 Ga0495630_0027734
567 Ga0495630_0335989
568 Ga0495652_0001266
569 Ga0495654_0158650
570 Ga0495665_0002117
571 Ga0495640_0257843
572 Ga0495586_0062954
573 Ga0495587_0000114
574 Ga0495645_0000144
575 Ga0495622_0124706
576 Ga0495667_0000241
577 Ga0495634_0093159
578 Ga0495635_0002069
579 Ga0495635_0158196
580 Ga0495588_0004435
581 Ga0495657_0000210
582 Ga0495599_0000754
583 Ga0495623_0002056
584 Ga0495623_0033505
585 Ga0495646_0013997
586 Ga0495647_0193642
587 Ga0495658_0020957
588 Ga0495669_0210545
589 Ga0495613_0008405
590 Ga0495600_0000023
591 Ga0495581_0001793
592 Ga0495604_0003267
593 Ga0495674_0000339
594 Ga0495676_0267568
595 Ga0495680_0001928
596 Ga0495675_0002320
597 Ga0495675_0011459
598 Ga0495684_0000037
599 Ga0495593_0001571
600 Ga0495602_0051511
601 Ga0495602_0057585
602 Ga0495614_0001483
603 Ga0495615_0015106
604 Ga0496100_0070239
605 Ga0496104_0149264
606 Ga0496105_0287240
607 Ga0496106_0096066
608 Ga0496107_0045540
609 Ga0496109_0159975
610 Ga0496109_0621282
611 Ga0496113_0040538
612 Ga0496114_0238567
613 Ga0496115_0006074
614 Ga0501032_0223496
615 Ga0501036_0161898
616 Ga0501038_0208122
617 Ga0501039_0077267
618 Ga0501041_0209223
619 Ga0501042_0013378
620 Ga0501048_0238511
621 Ga0501072_0017627
622 Ga0501073_0183775
623 Ga0501076_0136754
624 Ga0501230_060426
625 Ga0501080_0035571
626 Ga0501035_0610224
627 nmdc:mga05p37_236466_c1
628 nmdc:mga05p37_52664_c1
629 nmdc:mga05p37_577239_c1
630 nmdc:mga09592_22329_c1
631 nmdc:mga09592_49176_c1
632 nmdc:mga0qj67_743739_c1
633 nmdc:mga06r32_353859_c1
634 nmdc:mga06r32_43927_c1
635 nmdc:mga06r32_623055_c1
636 nmdc:mga06r32_96145_c1
637 nmdc:mga08y16_213646_c1
638 nmdc:mga08y16_32749_c1
639 nmdc:mga0n895_137463_c1
640 nmdc:mga0n895_258320_c1
641 nmdc:mga0rr50_34226_c1
642 nmdc:mga08x19_34606_c1
643 nmdc:mga0a205_147384_c1
644 Ga0495601_0035424
645 Ga0495612_0000696
646 Ga0495595_0034955
647 Ga0495619_0009945
648 Ga0501084_0217768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

51

179

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qcl-assembly2.cif.gz_B citryl-coa lyase core module of chlorobium limicola atp citrate lyase in complex with acetyl-coa and l-malate 0.3918 19 155
6qcl-assembly1.cif.gz_A citryl-coa lyase core module of chlorobium limicola atp citrate lyase in complex with acetyl-coa and l-malate 0.3831 19 155
7u2o-assembly1.cif.gz_A a novel compound mimics the structural and functional effects of the full agonist glycine on glycine channels-expanded-open state 0.3826 36 199
6hxo-assembly1.cif.gz_E structure of the citryl-coa lyase core module of chlorobium limicola atp citrate lyase (space group p21) 0.3739 13 155
6hxj-assembly1.cif.gz_H structure of atp citrate lyase from chlorobium limicola in complex with citrate and coenzyme a. 0.3656 13 155
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8486 36 157 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8015 36 157 1.10.1760.20
af_O49660_262_426_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3828 3 161 1.20.1250.20
af_Q8W488_267_429_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3594 2 160 1.20.1250.20
af_A0A0R0GV15_321_483_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3567 13 161 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3M1CXE0-F1-model_v4 DedA family protein 0.9085 14 161 GO:0005886
AF-A0A6V8LN71-F1-model_v4 VTT domain-containing protein 0.8809 1 162 GO:0005886
AF-A0A0A8X8A7-F1-model_v4 Alkaline phosphatase like protein 0.8805 6 197 GO:0005886
AF-A0A316C7Y8-F1-model_v4 Membrane protein DedA with SNARE-associated domain 0.8764 14 161 GO:0005886
AF-A0A2W5Y902-F1-model_v4 HTH arsR-type domain-containing protein 0.8745 14 161 GO:0003700
GO:0005886

Map