F407459

General Info

Members Datasets Scaffolds Average Seq Length
324 225 648 135

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0158625|Ga0373925_0158625_38_505
Length 155
Sequence MADPPSAFPGGDRQHRQKEFLMPAGSKGDPWQLTTPPGTSAYAMYRDADADPPALVCQVGSTTLKYHLRAIDDLHAWLKSQGDWVLLGAADESKPAAEETVEAWGRSPGNPVGGWYGLRKGYRGRFGMYLPPLLEALGLAEVTHDSRNNKMRAMP

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
135 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
136 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
137 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
140 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
141 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
142 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
220 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
225 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.93
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 6.48
Rhizosphere 86.73
Stem 0
Stem Tuber 0
Unclassified 8.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0158625 3300037068 Bacteria 1781
2 rootH2_10129908 3300003320 Bacteria 3174
3 Ga0070683_100003212 3300005329 Bacteria 13198
4 Ga0070683_100152331 3300005329 Bacteria 2192
5 Ga0070683_100885701 3300005329 Bacteria 856
6 Ga0068869_100180647 3300005334 Bacteria 1654
7 Ga0070692_10028432 3300005345 Bacteria 2778
8 Ga0070668_100075666 3300005347 Bacteria 2629
9 Ga0070669_100913725 3300005353 Bacteria 750
10 Ga0070675_100124123 3300005354 Bacteria 2196
11 Ga0070675_100551005 3300005354 Unclassified 1043
12 Ga0070674_100949277 3300005356 Bacteria 752
13 Ga0070674_101032101 3300005356 Bacteria 723
14 Ga0070673_100117095 3300005364 Bacteria 2217
15 Ga0070673_100196677 3300005364 Unclassified 1735
16 Ga0070673_100471345 3300005364 Bacteria 1132
17 Ga0070673_101765594 3300005364 Unclassified 586
18 Ga0070659_100358535 3300005366 Bacteria 1224
19 Ga0070659_101815983 3300005366 Unclassified 546
20 Ga0070709_10588023 3300005434 Bacteria 856
21 Ga0070714_100060758 3300005435 Unclassified 3244
22 Ga0070714_100656978 3300005435 Bacteria 1010
23 Ga0070713_100037741 3300005436 Bacteria 3907
24 Ga0070713_100047805 3300005436 Bacteria 3519
25 Ga0070713_100539577 3300005436 Bacteria 1104
26 Ga0070710_10041335 3300005437 Bacteria 2545
27 Ga0070711_100058861 3300005439 Unclassified 2666
28 Ga0070711_100682271 3300005439 Bacteria 864
29 Ga0070705_100455190 3300005440 Bacteria 961
30 Ga0070708_100004930 3300005445 Bacteria 10553
31 Ga0070708_100456016 3300005445 Bacteria 1206
32 Ga0070663_100234614 3300005455 Bacteria 1446
33 Ga0070678_100812327 3300005456 Bacteria 850
34 Ga0070678_101723182 3300005456 Bacteria 590
35 Ga0070681_11002399 3300005458 Bacteria 755
36 Ga0068867_100621054 3300005459 Bacteria 945
37 Ga0068867_101539723 3300005459 Bacteria 620
38 Ga0070707_100041000 3300005468 Bacteria 4430
39 Ga0070698_100006276 3300005471 Bacteria 12919
40 Ga0070698_100720041 3300005471 Bacteria 940
41 Ga0070699_100311783 3300005518 Bacteria 1413
42 Ga0070679_100542113 3300005530 Bacteria 1107
43 Ga0070679_101082943 3300005530 Unclassified 746
44 Ga0070684_100016377 3300005535 Bacteria 6057
45 Ga0070684_100032458 3300005535 Bacteria 4450
46 Ga0070684_100582291 3300005535 Bacteria 1040
47 Ga0070697_101169070 3300005536 Bacteria 685
48 Ga0070697_101681799 3300005536 Unclassified 568
49 Ga0070695_100003181 3300005545 Bacteria 9575
50 Ga0070696_100017524 3300005546 Bacteria 4835
51 Ga0070665_100289255 3300005548 Bacteria 1641
52 Ga0070704_100875124 3300005549 Bacteria 807
53 Ga0068855_100004156 3300005563 Bacteria 17664
54 Ga0070664_100255749 3300005564 Bacteria 1575
55 Ga0070702_100366559 3300005615 Unclassified 1020
56 Ga0068859_101008142 3300005617 Unclassified 914
57 Ga0068864_100154742 3300005618 Bacteria 2080
58 Ga0068864_100429752 3300005618 Unclassified 1260
59 Ga0068864_100706771 3300005618 Bacteria 985
60 Ga0068862_100142683 3300005844 Bacteria 2127
61 Ga0070717_10005500 3300006028 Bacteria 9248
62 Ga0070717_10023421 3300006028 Bacteria 4892
63 Ga0070717_10411277 3300006028 Bacteria 1216
64 Ga0075432_10407983 3300006058 Bacteria 588
65 Ga0070715_10008048 3300006163 Unclassified 3657
66 Ga0070716_100007581 3300006173 Bacteria 5353
67 Ga0070716_100026965 3300006173 Bacteria 3081
68 Ga0070712_100032220 3300006175 Unclassified 3537
69 Ga0070712_100157566 3300006175 Bacteria 1750
70 Ga0070712_100295722 3300006175 Bacteria 1309
71 Ga0068871_101225888 3300006358 Bacteria 704
72 Ga0075428_100120533 3300006844 Bacteria 2856
73 Ga0075428_100445174 3300006844 Bacteria 1388
74 Ga0075431_100069035 3300006847 Bacteria 3647
75 Ga0097620_101008194 3300006931 Unclassified 914
76 Ga0111539_10146504 3300009094 Bacteria 2764
77 Ga0105245_10000009 3300009098 Bacteria 279713
78 Ga0105245_10019183 3300009098 Bacteria 5989
79 Ga0105245_10838488 3300009098 Bacteria 959
80 Ga0105247_10764702 3300009101 Bacteria 734
81 Ga0105243_10128205 3300009148 Bacteria 2149
82 Ga0105243_10401938 3300009148 Unclassified 1273
83 Ga0105243_12539250 3300009148 Bacteria 552
84 Ga0105241_10566783 3300009174 Bacteria 1022
85 Ga0105242_12105266 3300009176 Bacteria 608
86 Ga0105242_12164378 3300009176 Bacteria 601
87 Ga0105248_10286501 3300009177 Bacteria 1855
88 Ga0105248_10350874 3300009177 Bacteria 1661
89 Ga0105237_10052289 3300009545 Bacteria 4101
90 Ga0105238_11040604 3300009551 Bacteria 840
91 Ga0105238_11127396 3300009551 Bacteria 808
92 Ga0105249_10066294 3300009553 Bacteria 3323
93 Ga0105246_10750808 3300011119 Unclassified 860
94 Ga0157378_10162429 3300013297 Bacteria 2090
95 Ga0157378_10645640 3300013297 Bacteria 1073
96 Ga0157378_12897083 3300013297 Unclassified 532
97 Ga0163162_12990535 3300013306 Bacteria 543
98 Ga0157372_11014675 3300013307 Bacteria 961
99 Ga0157375_10131357 3300013308 Bacteria 2624
100 Ga0157375_10209208 3300013308 Bacteria 2108
101 Ga0157375_10411485 3300013308 Bacteria 1519
102 Ga0163163_10189613 3300014325 Bacteria 2104
103 Ga0163163_10977039 3300014325 Bacteria 910
104 Ga0163163_11072280 3300014325 Bacteria 869
105 Ga0157380_10039593 3300014326 Bacteria 3667
106 Ga0182008_10330241 3300014497 Bacteria 804
107 Ga0157377_11621181 3300014745 Bacteria 519
108 Ga0157379_10198904 3300014968 Bacteria 1812
109 Ga0163161_10292111 3300017792 Bacteria 1281
110 Ga0206353_10830756 3300020082 Bacteria 1003
111 Ga0213871_10021953 3300021441 Bacteria 1596
112 Ga0207655_1132326 3300025728 Bacteria 811
113 Ga0207692_10011185 3300025898 Bacteria 3807
114 Ga0207699_10022246 3300025906 Unclassified 3432
115 Ga0207643_10029220 3300025908 Bacteria 3066
116 Ga0207684_10631115 3300025910 Bacteria 914
117 Ga0207693_10029653 3300025915 Bacteria 4319
118 Ga0207693_10079424 3300025915 Bacteria 2568
119 Ga0207693_10281172 3300025915 Bacteria 1304
120 Ga0207663_10030258 3300025916 Bacteria 3192
121 Ga0207663_10215970 3300025916 Bacteria 1393
122 Ga0207662_10686528 3300025918 Bacteria 717
123 Ga0207646_10055041 3300025922 Bacteria 3558
124 Ga0207681_10078725 3300025923 Bacteria 2321
125 Ga0207694_11508669 3300025924 Bacteria 567
126 Ga0207659_10079428 3300025926 Bacteria 2420
127 Ga0207659_10180376 3300025926 Bacteria 1673
128 Ga0207687_10000045 3300025927 Bacteria 99967
129 Ga0207687_10159321 3300025927 Unclassified 1730
130 Ga0207700_10002519 3300025928 Bacteria 10511
131 Ga0207700_10102200 3300025928 Bacteria 2289
132 Ga0207700_10246987 3300025928 Bacteria 1523
133 Ga0207664_10005401 3300025929 Bacteria 8726
134 Ga0207664_10126762 3300025929 Bacteria 2144
135 Ga0207664_11024703 3300025929 Bacteria 739
136 Ga0207669_10946613 3300025937 Bacteria 722
137 Ga0207665_10013700 3300025939 Bacteria 5333
138 Ga0207711_10235769 3300025941 Bacteria 1677
139 Ga0207689_10497326 3300025942 Unclassified 1021
140 Ga0207689_10624823 3300025942 Bacteria 907
141 Ga0207679_10318951 3300025945 Bacteria 1345
142 Ga0207667_10004658 3300025949 Bacteria 16805
143 Ga0207651_10274596 3300025960 Bacteria 1390
144 Ga0207651_10374788 3300025960 Bacteria 1205
145 Ga0207651_11505430 3300025960 Unclassified 606
146 Ga0207712_10110315 3300025961 Bacteria 2062
147 Ga0207712_11070391 3300025961 Bacteria 717
148 Ga0207658_10276962 3300025986 Bacteria 1437
149 Ga0207677_10758090 3300026023 Bacteria 866
150 Ga0207677_11241201 3300026023 Bacteria 683
151 Ga0207677_12071862 3300026023 Bacteria 529
152 Ga0207708_11528347 3300026075 Bacteria 586
153 Ga0207648_10744119 3300026089 Bacteria 910
154 Ga0207676_11343658 3300026095 Bacteria 710
155 Ga0207676_11923674 3300026095 Bacteria 590
156 Ga0207675_100052834 3300026118 Bacteria 3791
157 Ga0207675_100579204 3300026118 Bacteria 1124
158 Ga0207675_101941941 3300026118 Bacteria 607
159 Ga0207675_102431273 3300026118 Bacteria 536
160 Ga0207683_10168985 3300026121 Bacteria 1980
161 Ga0207683_10258331 3300026121 Bacteria 1590
162 Ga0268266_10301492 3300028379 Bacteria 1495
163 Ga0268266_10938975 3300028379 Bacteria 837
164 Ga0268265_10178667 3300028380 Bacteria 1822
165 Ga0268265_11998291 3300028380 Bacteria 587
166 Ga0265319_1230906 3300028563 Bacteria 565
167 Ga0265318_10085954 3300028577 Bacteria 1159
168 Ga0307515_10022378 3300028794 Bacteria 11140
169 Ga0265338_10000457 3300028800 Bacteria 72848
170 Ga0265760_10080179 3300031090 Bacteria 1011
171 Ga0265316_10611845 3300031344 Bacteria 772
172 Ga0265314_10061595 3300031711 Bacteria 2554
173 Ga0307410_10003688 3300031852 Bacteria 7742
174 Ga0307406_10008118 3300031901 Bacteria 5848
175 Ga0307406_10692801 3300031901 Bacteria 850
176 Ga0307407_10523449 3300031903 Bacteria 872
177 Ga0307412_10010564 3300031911 Bacteria 5320
178 Ga0307409_100005894 3300031995 Bacteria 7120
179 Ga0307416_100063363 3300032002 Bacteria 3027
180 Ga0307414_10126478 3300032004 Bacteria 1976
181 Ga0307414_11893039 3300032004 Bacteria 557
182 Ga0307411_10091114 3300032005 Bacteria 2129
183 Ga0307415_100002306 3300032126 Bacteria 9467
184 Ga0373934_0017787 3300035086 Bacteria 2716
185 Ga0373953_0040328 3300035117 Bacteria 1854
186 Ga0373954_0139490 3300035118 Bacteria 1182
187 Ga0373956_0033165 3300035119 Bacteria 2269
188 Ga0373957_0246397 3300035120 Bacteria 751
189 Ga0373955_0005821 3300035172 Bacteria 5567
190 Ga0373961_0045746 3300035241 Bacteria 1281
191 Ga0373924_0097945 3300035410 Bacteria 1260
192 Ga0373933_0009207 3300035724 Bacteria 5392
193 Ga0373937_0017125 3300036401 Bacteria 6447
194 Ga0373937_0278767 3300036401 Bacteria 1578
195 Ga0372808_005516 3300036459 Bacteria 1670
196 Ga0436360_0864192 3300039438 Bacteria 1188
197 Ga0436360_1242120 3300039438 Bacteria 6465
198 Ga0436363_0130141 3300039450 Bacteria 531
199 Ga0436363_0557714 3300039450 Bacteria 938
200 Ga0451791_0232638 3300041451 Bacteria 5835
201 Ga0451791_1126727 3300041451 Bacteria 644
202 Ga0451793_0091623 3300041452 Bacteria 22483
203 Ga0451797_0190032 3300041453 Bacteria 4459
204 Ga0451797_0220467 3300041453 Bacteria 520
205 Ga0451795_0497060 3300041456 Bacteria 3769
206 Ga0451802_0798452 3300041460 Bacteria 977
207 Ga0451804_0252740 3300041463 Bacteria 1924
208 Ga0451807_0375445 3300041486 Bacteria 1294
209 Ga0451833_0348358 3300041491 Bacteria 2878
210 Ga0451841_0307307 3300041498 Bacteria 576
211 Ga0451849_0852511 3300041505 Bacteria 2383
212 Ga0451843_1640403 3300041509 Bacteria 4530
213 Ga0451853_1323029 3300041512 Unclassified 939
214 Ga0451853_2887468 3300041512 Bacteria 5861
215 Ga0466967_0695557 3300045976 Bacteria 1007
216 Ga0495592_0213715 3300046454 Unclassified 1294
217 Ga0495592_0273508 3300046454 Bacteria 1107
218 Ga0495638_0083524 3300046460 Bacteria 1934
219 Ga0495651_0328106 3300046462 Unclassified 1018
220 Ga0495653_0065538 3300046463 Bacteria 2734
221 Ga0495653_0107636 3300046463 Bacteria 2009
222 Ga0495653_0141762 3300046463 Bacteria 1689
223 Ga0495664_0265571 3300046477 Bacteria 1037
224 Ga0495585_0308017 3300046492 Bacteria 777
225 Ga0495608_0141800 3300046511 Bacteria 1533
226 Ga0495608_0231243 3300046511 Bacteria 1157
227 Ga0495628_0509967 3300046516 Bacteria 867
228 Ga0495632_0056724 3300046519 Bacteria 1914
229 Ga0495652_0098220 3300046529 Bacteria 2381
230 Ga0495652_0256501 3300046529 Bacteria 1293
231 Ga0495652_0638411 3300046529 Bacteria 722
232 Ga0495640_0501351 3300046533 Bacteria 739
233 Ga0495667_0087266 3300046559 Bacteria 2023
234 Ga0495635_0053717 3300046663 Bacteria 2775
235 Ga0495657_0097383 3300046675 Bacteria 1878
236 Ga0495657_0102293 3300046675 Bacteria 1824
237 Ga0495657_0163663 3300046675 Bacteria 1375
238 Ga0495599_0905203 3300046678 Bacteria 500
239 Ga0495623_0452949 3300046679 Bacteria 683
240 Ga0495613_0347984 3300046689 Bacteria 1018
241 Ga0495670_0524643 3300046691 Bacteria 644
242 Ga0495600_0063503 3300046809 Bacteria 2413
243 Ga0495604_0078669 3300047317 Bacteria 2474
244 Ga0495604_0180202 3300047317 Bacteria 1479
245 Ga0495674_0787522 3300047319 Bacteria 740
246 Ga0495680_0224213 3300047322 Bacteria 1340
247 Ga0495680_0492479 3300047322 Bacteria 833
248 Ga0495680_0779099 3300047322 Bacteria 626
249 Ga0495675_0050432 3300047444 Bacteria 2646
250 Ga0495675_0141678 3300047444 Bacteria 1490
251 Ga0495673_0132847 3300047469 Bacteria 977
252 Ga0495684_0413942 3300047471 Unclassified 944
253 Ga0495602_0064652 3300048088 Bacteria 3161
254 Ga0495602_0124692 3300048088 Bacteria 2066
255 Ga0495602_0172736 3300048088 Unclassified 1676
256 Ga0496100_0607797 3300048903 Bacteria 849
257 Ga0496101_0073555 3300048904 Bacteria 2511
258 Ga0496102_0004646 3300048905 Bacteria 11623
259 Ga0496102_0160128 3300048905 Bacteria 2117
260 Ga0496103_0010329 3300048906 Bacteria 5524
261 Ga0496103_0373874 3300048906 Bacteria 916
262 Ga0496104_0246864 3300048907 Bacteria 1698
263 Ga0496104_1658634 3300048907 Unclassified 542
264 Ga0496107_0112780 3300048910 Bacteria 1999
265 Ga0496109_0256805 3300048912 Bacteria 1646
266 Ga0496109_0508032 3300048912 Bacteria 1138
267 Ga0496114_0529209 3300048917 Unclassified 1042
268 Ga0496119_0019869 3300048922 Bacteria 4924
269 Ga0496120_0092511 3300048923 Bacteria 1612
270 Ga0496122_0007941 3300048925 Bacteria 11608
271 Ga0496123_0021272 3300048926 Bacteria 5046
272 Ga0496126_0448136 3300048929 Bacteria 1039
273 Ga0501033_0141182 3300049570 Bacteria 1741
274 Ga0501037_0201032 3300049573 Bacteria 1408
275 Ga0501038_0142199 3300049574 Bacteria 1962
276 Ga0501039_0028687 3300049575 Bacteria 4285
277 Ga0501040_0008178 3300049576 Bacteria 6800
278 Ga0501041_0025859 3300049577 Bacteria 3529
279 Ga0501042_0009725 3300049578 Bacteria 6422
280 Ga0501042_0356932 3300049578 Bacteria 1058
281 Ga0501046_0035964 3300049580 Bacteria 3988
282 Ga0501048_0003614 3300049582 Bacteria 11783
283 Ga0501067_0142773 3300049583 Bacteria 1334
284 Ga0501068_0085558 3300049584 Bacteria 1940
285 Ga0501069_0114273 3300049585 Bacteria 1539
286 Ga0501070_0212774 3300049586 Bacteria 1586
287 Ga0501071_0256445 3300049587 Bacteria 1320
288 Ga0501071_0361357 3300049587 Bacteria 1106
289 Ga0501072_0051684 3300049588 Bacteria 3235
290 Ga0501073_0110528 3300049589 Bacteria 1907
291 Ga0501073_0129114 3300049589 Bacteria 1752
292 Ga0501074_0005090 3300049590 Bacteria 9440
293 Ga0501075_0025251 3300049591 Bacteria 4365
294 Ga0501076_0230055 3300049592 Bacteria 1515
295 Ga0501076_0357946 3300049592 Bacteria 1199
296 Ga0501077_0015403 3300049593 Bacteria 4814
297 Ga0501202_240469 3300049652 Bacteria 506
298 Ga0501079_0015419 3300049741 Bacteria 5831
299 Ga0501080_0019209 3300049742 Bacteria 6328
300 Ga0501081_0063188 3300049743 Bacteria 2569
301 Ga0501083_0296145 3300049744 Bacteria 1052
302 Ga0501035_0023824 3300049822 Bacteria 5617
303 Ga0501035_0043097 3300049822 Bacteria 4068
304 Ga0501044_0840675 3300049823 Bacteria 795
305 Ga0501045_0007314 3300049824 Bacteria 7671
306 nmdc:mga0qj67_1496740_c1 3300050509 Bacteria 519
307 nmdc:mga0qj67_207277_c1 3300050509 Bacteria 1592
308 nmdc:mga06r32_245911_c1 3300050510 Bacteria 1776
309 nmdc:mga08y16_505723_c1 3300050511 Bacteria 1227
310 Ga0495601_0431343 3300053077 Bacteria 853
311 Ga0495612_0011528 3300053078 Bacteria 3564
312 Ga0495612_0427104 3300053078 Bacteria 604
313 Ga0500635_0001339 3300053080 Bacteria 5894
314 Ga0495619_0227444 3300053085 Bacteria 1292
315 Ga0500646_0169087 3300053090 Bacteria 734
316 Ga0500588_0002353 3300053146 Bacteria 3826
317 Ga0500616_0000125 3300053153 Bacteria 135146
318 Ga0500616_0000126 3300053153 Bacteria 134967
319 Ga0501084_0185515 3300054114 Bacteria 1756
320 Ga0501084_0468024 3300054114 Bacteria 1065
321 Ga0501082_0104992 3300060353 Bacteria 2444
322 Ga0501082_0255086 3300060353 Bacteria 1526
323 Ga0530510_0097778 3300061734 Bacteria 2146
324 2758227158 2757320536 Bacteria 3629334
325 Ga0373925_0158625
326 rootH2_10129908
327 Ga0070683_100003212
328 Ga0070683_100152331
329 Ga0070683_100885701
330 Ga0068869_100180647
331 Ga0070692_10028432
332 Ga0070668_100075666
333 Ga0070669_100913725
334 Ga0070675_100124123
335 Ga0070675_100551005
336 Ga0070674_100949277
337 Ga0070674_101032101
338 Ga0070673_100117095
339 Ga0070673_100196677
340 Ga0070673_100471345
341 Ga0070673_101765594
342 Ga0070659_100358535
343 Ga0070659_101815983
344 Ga0070709_10588023
345 Ga0070714_100060758
346 Ga0070714_100656978
347 Ga0070713_100037741
348 Ga0070713_100047805
349 Ga0070713_100539577
350 Ga0070710_10041335
351 Ga0070711_100058861
352 Ga0070711_100682271
353 Ga0070705_100455190
354 Ga0070708_100004930
355 Ga0070708_100456016
356 Ga0070663_100234614
357 Ga0070678_100812327
358 Ga0070678_101723182
359 Ga0070681_11002399
360 Ga0068867_100621054
361 Ga0068867_101539723
362 Ga0070707_100041000
363 Ga0070698_100006276
364 Ga0070698_100720041
365 Ga0070699_100311783
366 Ga0070679_100542113
367 Ga0070679_101082943
368 Ga0070684_100016377
369 Ga0070684_100032458
370 Ga0070684_100582291
371 Ga0070697_101169070
372 Ga0070697_101681799
373 Ga0070695_100003181
374 Ga0070696_100017524
375 Ga0070665_100289255
376 Ga0070704_100875124
377 Ga0068855_100004156
378 Ga0070664_100255749
379 Ga0070702_100366559
380 Ga0068859_101008142
381 Ga0068864_100154742
382 Ga0068864_100429752
383 Ga0068864_100706771
384 Ga0068862_100142683
385 Ga0070717_10005500
386 Ga0070717_10023421
387 Ga0070717_10411277
388 Ga0075432_10407983
389 Ga0070715_10008048
390 Ga0070716_100007581
391 Ga0070716_100026965
392 Ga0070712_100032220
393 Ga0070712_100157566
394 Ga0070712_100295722
395 Ga0068871_101225888
396 Ga0075428_100120533
397 Ga0075428_100445174
398 Ga0075431_100069035
399 Ga0097620_101008194
400 Ga0111539_10146504
401 Ga0105245_10000009
402 Ga0105245_10019183
403 Ga0105245_10838488
404 Ga0105247_10764702
405 Ga0105243_10128205
406 Ga0105243_10401938
407 Ga0105243_12539250
408 Ga0105241_10566783
409 Ga0105242_12105266
410 Ga0105242_12164378
411 Ga0105248_10286501
412 Ga0105248_10350874
413 Ga0105237_10052289
414 Ga0105238_11040604
415 Ga0105238_11127396
416 Ga0105249_10066294
417 Ga0105246_10750808
418 Ga0157378_10162429
419 Ga0157378_10645640
420 Ga0157378_12897083
421 Ga0163162_12990535
422 Ga0157372_11014675
423 Ga0157375_10131357
424 Ga0157375_10209208
425 Ga0157375_10411485
426 Ga0163163_10189613
427 Ga0163163_10977039
428 Ga0163163_11072280
429 Ga0157380_10039593
430 Ga0182008_10330241
431 Ga0157377_11621181
432 Ga0157379_10198904
433 Ga0163161_10292111
434 Ga0206353_10830756
435 Ga0213871_10021953
436 Ga0207655_1132326
437 Ga0207692_10011185
438 Ga0207699_10022246
439 Ga0207643_10029220
440 Ga0207684_10631115
441 Ga0207693_10029653
442 Ga0207693_10079424
443 Ga0207693_10281172
444 Ga0207663_10030258
445 Ga0207663_10215970
446 Ga0207662_10686528
447 Ga0207646_10055041
448 Ga0207681_10078725
449 Ga0207694_11508669
450 Ga0207659_10079428
451 Ga0207659_10180376
452 Ga0207687_10000045
453 Ga0207687_10159321
454 Ga0207700_10002519
455 Ga0207700_10102200
456 Ga0207700_10246987
457 Ga0207664_10005401
458 Ga0207664_10126762
459 Ga0207664_11024703
460 Ga0207669_10946613
461 Ga0207665_10013700
462 Ga0207711_10235769
463 Ga0207689_10497326
464 Ga0207689_10624823
465 Ga0207679_10318951
466 Ga0207667_10004658
467 Ga0207651_10274596
468 Ga0207651_10374788
469 Ga0207651_11505430
470 Ga0207712_10110315
471 Ga0207712_11070391
472 Ga0207658_10276962
473 Ga0207677_10758090
474 Ga0207677_11241201
475 Ga0207677_12071862
476 Ga0207708_11528347
477 Ga0207648_10744119
478 Ga0207676_11343658
479 Ga0207676_11923674
480 Ga0207675_100052834
481 Ga0207675_100579204
482 Ga0207675_101941941
483 Ga0207675_102431273
484 Ga0207683_10168985
485 Ga0207683_10258331
486 Ga0268266_10301492
487 Ga0268266_10938975
488 Ga0268265_10178667
489 Ga0268265_11998291
490 Ga0265319_1230906
491 Ga0265318_10085954
492 Ga0307515_10022378
493 Ga0265338_10000457
494 Ga0265760_10080179
495 Ga0265316_10611845
496 Ga0265314_10061595
497 Ga0307410_10003688
498 Ga0307406_10008118
499 Ga0307406_10692801
500 Ga0307407_10523449
501 Ga0307412_10010564
502 Ga0307409_100005894
503 Ga0307416_100063363
504 Ga0307414_10126478
505 Ga0307414_11893039
506 Ga0307411_10091114
507 Ga0307415_100002306
508 Ga0373934_0017787
509 Ga0373953_0040328
510 Ga0373954_0139490
511 Ga0373956_0033165
512 Ga0373957_0246397
513 Ga0373955_0005821
514 Ga0373961_0045746
515 Ga0373924_0097945
516 Ga0373933_0009207
517 Ga0373937_0017125
518 Ga0373937_0278767
519 Ga0372808_005516
520 Ga0436360_0864192
521 Ga0436360_1242120
522 Ga0436363_0130141
523 Ga0436363_0557714
524 Ga0451791_0232638
525 Ga0451791_1126727
526 Ga0451793_0091623
527 Ga0451797_0190032
528 Ga0451797_0220467
529 Ga0451795_0497060
530 Ga0451802_0798452
531 Ga0451804_0252740
532 Ga0451807_0375445
533 Ga0451833_0348358
534 Ga0451841_0307307
535 Ga0451849_0852511
536 Ga0451843_1640403
537 Ga0451853_1323029
538 Ga0451853_2887468
539 Ga0466967_0695557
540 Ga0495592_0213715
541 Ga0495592_0273508
542 Ga0495638_0083524
543 Ga0495651_0328106
544 Ga0495653_0065538
545 Ga0495653_0107636
546 Ga0495653_0141762
547 Ga0495664_0265571
548 Ga0495585_0308017
549 Ga0495608_0141800
550 Ga0495608_0231243
551 Ga0495628_0509967
552 Ga0495632_0056724
553 Ga0495652_0098220
554 Ga0495652_0256501
555 Ga0495652_0638411
556 Ga0495640_0501351
557 Ga0495667_0087266
558 Ga0495635_0053717
559 Ga0495657_0097383
560 Ga0495657_0102293
561 Ga0495657_0163663
562 Ga0495599_0905203
563 Ga0495623_0452949
564 Ga0495613_0347984
565 Ga0495670_0524643
566 Ga0495600_0063503
567 Ga0495604_0078669
568 Ga0495604_0180202
569 Ga0495674_0787522
570 Ga0495680_0224213
571 Ga0495680_0492479
572 Ga0495680_0779099
573 Ga0495675_0050432
574 Ga0495675_0141678
575 Ga0495673_0132847
576 Ga0495684_0413942
577 Ga0495602_0064652
578 Ga0495602_0124692
579 Ga0495602_0172736
580 Ga0496100_0607797
581 Ga0496101_0073555
582 Ga0496102_0004646
583 Ga0496102_0160128
584 Ga0496103_0010329
585 Ga0496103_0373874
586 Ga0496104_0246864
587 Ga0496104_1658634
588 Ga0496107_0112780
589 Ga0496109_0256805
590 Ga0496109_0508032
591 Ga0496114_0529209
592 Ga0496119_0019869
593 Ga0496120_0092511
594 Ga0496122_0007941
595 Ga0496123_0021272
596 Ga0496126_0448136
597 Ga0501033_0141182
598 Ga0501037_0201032
599 Ga0501038_0142199
600 Ga0501039_0028687
601 Ga0501040_0008178
602 Ga0501041_0025859
603 Ga0501042_0009725
604 Ga0501042_0356932
605 Ga0501046_0035964
606 Ga0501048_0003614
607 Ga0501067_0142773
608 Ga0501068_0085558
609 Ga0501069_0114273
610 Ga0501070_0212774
611 Ga0501071_0256445
612 Ga0501071_0361357
613 Ga0501072_0051684
614 Ga0501073_0110528
615 Ga0501073_0129114
616 Ga0501074_0005090
617 Ga0501075_0025251
618 Ga0501076_0230055
619 Ga0501076_0357946
620 Ga0501077_0015403
621 Ga0501202_240469
622 Ga0501079_0015419
623 Ga0501080_0019209
624 Ga0501081_0063188
625 Ga0501083_0296145
626 Ga0501035_0023824
627 Ga0501035_0043097
628 Ga0501044_0840675
629 Ga0501045_0007314
630 nmdc:mga0qj67_1496740_c1
631 nmdc:mga0qj67_207277_c1
632 nmdc:mga06r32_245911_c1
633 nmdc:mga08y16_505723_c1
634 Ga0495601_0431343
635 Ga0495612_0011528
636 Ga0495612_0427104
637 Ga0500635_0001339
638 Ga0495619_0227444
639 Ga0500646_0169087
640 Ga0500588_0002353
641 Ga0500616_0000125
642 Ga0500616_0000126
643 Ga0501084_0185515
644 Ga0501084_0468024
645 Ga0501082_0104992
646 Ga0501082_0255086
647 Ga0530510_0097778
648 2758227158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21619

DUF6855

Family of unknown function (DUF6855)

23

154

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyb-assembly1.cif.gz_K2 cryo-em structure of the 6 hpf zebrafish embryo 80s ribosome 0.7662 106 136
7ytu-assembly1.cif.gz_A crystal structure of vaccinia virus g3/l5 sub-complex (semet-labeled, p31 space group) 0.7296 12 50
5h67-assembly1.cif.gz_C crystal structure of the bacillus subtilis smc head domain complexed with the cognate scpa c-terminal domain and soaked atp 0.702 53 135
8btd-assembly1.cif.gz_SL giardia ribosome in pre-t hybrid state (d1) 0.7013 115 136
3fm5-assembly3.cif.gz_C x-ray crystal structure of transcriptional regulator (marr family) from rhodococcus sp. rha1 0.6866 112 136
ID Description Score Start End Superfamily
af_Q8BWM0_87_178_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8606 35 47 3.40.30.10
af_Q58183_12_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7652 106 136 1.10.10.10
2gxbB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7561 112 135 1.10.10.10
af_Q9HGK2_5_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7518 48 136 1.10.10.10
af_O53773_1_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7488 115 136 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7G7LF11-F1-model_v4 DUF6855 domain-containing protein 0.9955 2 136
AF-A0A352MHI0-F1-model_v4 DUF6855 domain-containing protein 0.9929 53 136
AF-A0A7X9KHG0-F1-model_v4 DUF6855 domain-containing protein 0.9914 35 136
AF-A0A536HPS8-F1-model_v4 DUF6855 domain-containing protein 0.9886 1 136
AF-A0A535EL95-F1-model_v4 DUF6855 domain-containing protein 0.9869 7 121

Map