F407402

General Info

Members Datasets Scaffolds Average Seq Length
324 228 648 176

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10097288|Ga0207693_100972882
Length 212
Sequence MARNVIERSEATKQSIVSPSREMDCFASLAMTVGMNEMKVIGLAGWSGAGKTTLLTRVIPHLLKEGLRVSVIKHAHHAFDVDVPGKDSWVHRQAGATEVLVSSARRWALMHELRGAGEPRLPELLAKMSRVDLVIIEGFKREPHRKIEVHRAANAKPLLFPDDPGIVGIATDIAVETTLPVAHLDDVAAIAVMMQRSATSVEDLLAKSLSES

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
48 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
49 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
113 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
114 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
202 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
203 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
204 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
205 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
208 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
209 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
213 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
214 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
215 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
216 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
217 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
218 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
219 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 2841760612 Bosea sp. Tri-49 Isolate Nodule
222 2844104063 Bosea sp. Tri-39 Isolate Nodule
223 2851246043 Bosea sp. Tri-54 Isolate Nodule
224 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
225 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
226 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
227 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
228 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 0
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.04
Nodule 4.01
Rhizoplane 9.26
Rhizosphere 69.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10097288 3300025915 Bacteria 2308
2 JGI25406J46586_10000022 3300003203 Bacteria 79225
3 JGI25406J46586_10005227 3300003203 Bacteria 6017
4 JGI25404J52841_10002965 3300003659 Bacteria 3295
5 Ga0055542_1021690 3300003762 Bacteria 922
6 Ga0070658_10117012 3300005327 Bacteria 2213
7 Ga0070683_100088187 3300005329 Bacteria 2911
8 Ga0070680_100217148 3300005336 Bacteria 1614
9 Ga0070682_100859841 3300005337 Bacteria 742
10 Ga0068868_100012390 3300005338 Bacteria 6232
11 Ga0070675_100361650 3300005354 Bacteria 1289
12 Ga0070671_100244181 3300005355 Bacteria 1525
13 Ga0070674_100300341 3300005356 Bacteria 1280
14 Ga0070659_100140846 3300005366 Bacteria 1963
15 Ga0070709_10001601 3300005434 Bacteria 12213
16 Ga0070709_10009240 3300005434 Bacteria 5428
17 Ga0070709_10378544 3300005434 Bacteria 1052
18 Ga0070714_100049050 3300005435 Bacteria 3593
19 Ga0070714_100778445 3300005435 Bacteria 926
20 Ga0070713_100008549 3300005436 Bacteria 7264
21 Ga0070713_100084249 3300005436 Bacteria 2720
22 Ga0070713_100204260 3300005436 Bacteria 1786
23 Ga0070710_10001667 3300005437 Bacteria 10462
24 Ga0070711_100011007 3300005439 Bacteria 5610
25 Ga0070711_100019327 3300005439 Bacteria 4369
26 Ga0070711_101546381 3300005439 Bacteria 579
27 Ga0070708_100110326 3300005445 Bacteria 2528
28 Ga0070678_100146261 3300005456 Bacteria 1898
29 Ga0070678_100970486 3300005456 Bacteria 780
30 Ga0070681_10008310 3300005458 Bacteria 10165
31 Ga0070707_100380764 3300005468 Bacteria 1371
32 Ga0070698_100092754 3300005471 Bacteria 3001
33 Ga0070698_100317070 3300005471 Bacteria 1490
34 Ga0070679_100257961 3300005530 Bacteria 1699
35 Ga0070697_100221613 3300005536 Bacteria 1612
36 Ga0070672_100718075 3300005543 Bacteria 876
37 Ga0068855_100011850 3300005563 Bacteria 10543
38 Ga0068856_100080226 3300005614 Bacteria 3237
39 Ga0068856_100794927 3300005614 Bacteria 966
40 Ga0068852_100614172 3300005616 Bacteria 1092
41 Ga0068864_100023341 3300005618 Bacteria 5194
42 Ga0068851_10018844 3300005834 Bacteria 3330
43 Ga0068851_10166788 3300005834 Bacteria 1213
44 Ga0081540_1000183 3300005983 Bacteria 65356
45 Ga0081540_1018602 3300005983 Bacteria 4255
46 Ga0081540_1082383 3300005983 Bacteria 1443
47 Ga0081539_10000172 3300005985 Bacteria 151505
48 Ga0081539_10000945 3300005985 Bacteria 54444
49 Ga0081539_10015466 3300005985 Bacteria 5543
50 Ga0070717_10021111 3300006028 Bacteria 5130
51 Ga0070717_10023818 3300006028 Bacteria 4856
52 Ga0075368_10248440 3300006042 Bacteria 760
53 Ga0070715_10121028 3300006163 Bacteria 1248
54 Ga0070715_10229012 3300006163 Bacteria 960
55 Ga0070716_100017611 3300006173 Bacteria 3708
56 Ga0070716_100188462 3300006173 Bacteria 1361
57 Ga0070712_100694906 3300006175 Bacteria 867
58 Ga0070712_100844119 3300006175 Bacteria 788
59 Ga0075367_10208462 3300006178 Bacteria 1222
60 Ga0075369_10265719 3300006186 Bacteria 798
61 Ga0075366_10495666 3300006195 Bacteria 755
62 Ga0097621_100666760 3300006237 Bacteria 955
63 Ga0068871_100802642 3300006358 Bacteria 868
64 Ga0068871_101713287 3300006358 Bacteria 596
65 Ga0075433_10287706 3300006852 Bacteria 1456
66 Ga0075434_100329452 3300006871 Bacteria 1547
67 Ga0068865_100543631 3300006881 Bacteria 974
68 Ga0099825_1037589 3300006941 Bacteria 1590
69 Ga0099824_1011382 3300006942 Bacteria 10087
70 Ga0099822_1012272 3300006943 Bacteria 10273
71 Ga0075435_101356036 3300007076 Bacteria 623
72 Ga0099794_10116046 3300007265 Bacteria 1344
73 Ga0099795_10106482 3300007788 Bacteria 1106
74 Ga0105240_10742339 3300009093 Bacteria 1068
75 Ga0105245_10127546 3300009098 Bacteria 2383
76 Ga0105242_11805509 3300009176 Bacteria 650
77 Ga0105248_11296479 3300009177 Bacteria 824
78 Ga0105238_10238604 3300009551 Bacteria 1795
79 Ga0105249_10534556 3300009553 Bacteria 1221
80 Ga0105239_10106397 3300010375 Bacteria 3107
81 Ga0105239_10656748 3300010375 Bacteria 1198
82 Ga0157321_1013897 3300012487 Bacteria 661
83 Ga0157370_10020367 3300013104 Bacteria 6625
84 Ga0157370_11250184 3300013104 Bacteria 669
85 Ga0157369_10103410 3300013105 Bacteria 3034
86 Ga0157374_10026908 3300013296 Bacteria 5180
87 Ga0163162_10014185 3300013306 Bacteria 7788
88 Ga0163162_10364649 3300013306 Bacteria 1578
89 Ga0157372_11114549 3300013307 Bacteria 913
90 Ga0157375_10029979 3300013308 Bacteria 5123
91 Ga0157375_10844694 3300013308 Bacteria 1062
92 Ga0163163_10023168 3300014325 Bacteria 5891
93 Ga0157379_10403765 3300014968 Bacteria 1256
94 Ga0157379_11387924 3300014968 Bacteria 681
95 Ga0157376_10036268 3300014969 Bacteria 3994
96 Ga0157376_10748780 3300014969 Bacteria 986
97 Ga0163161_10454198 3300017792 Bacteria 1036
98 Ga0213874_10029433 3300021377 Bacteria 1576
99 Ga0213876_10231954 3300021384 Bacteria 981
100 Ga0213876_10391101 3300021384 Bacteria 739
101 Ga0213875_10052917 3300021388 Bacteria 1901
102 Ga0209026_1022054 3300025250 Bacteria 978
103 Ga0209148_1000769 3300025254 Bacteria 24248
104 Ga0209233_1004263 3300025261 Bacteria 4892
105 Ga0209455_1001474 3300025272 Bacteria 10580
106 Ga0209025_1001253 3300025294 Bacteria 35139
107 Ga0207656_10012253 3300025321 Bacteria 3257
108 Ga0207692_10018519 3300025898 Bacteria 3128
109 Ga0207692_10028361 3300025898 Bacteria 2647
110 Ga0207642_10023129 3300025899 Bacteria 2478
111 Ga0207688_10113310 3300025901 Bacteria 1576
112 Ga0207685_10003886 3300025905 Bacteria 3705
113 Ga0207699_10031090 3300025906 Bacteria 2994
114 Ga0207699_10032771 3300025906 Bacteria 2930
115 Ga0207699_10469756 3300025906 Bacteria 905
116 Ga0207684_10113540 3300025910 Bacteria 2319
117 Ga0207684_10219128 3300025910 Bacteria 1642
118 Ga0207695_10188583 3300025913 Bacteria 1980
119 Ga0207693_10001156 3300025915 Bacteria 23542
120 Ga0207693_10031462 3300025915 Bacteria 4192
121 Ga0207693_10057497 3300025915 Bacteria 3048
122 Ga0207693_10732980 3300025915 Bacteria 764
123 Ga0207663_10000774 3300025916 Bacteria 14300
124 Ga0207663_10322076 3300025916 Bacteria 1162
125 Ga0207663_10487150 3300025916 Bacteria 956
126 Ga0207660_10206977 3300025917 Bacteria 1535
127 Ga0207660_10284256 3300025917 Bacteria 1314
128 Ga0207657_10473242 3300025919 Bacteria 982
129 Ga0207652_10236465 3300025921 Bacteria 1647
130 Ga0207646_10567342 3300025922 Bacteria 1020
131 Ga0207659_10174518 3300025926 Bacteria 1698
132 Ga0207687_10040977 3300025927 Bacteria 3178
133 Ga0207700_10021956 3300025928 Bacteria 4371
134 Ga0207700_10070029 3300025928 Bacteria 2695
135 Ga0207664_10049044 3300025929 Bacteria 3323
136 Ga0207664_10052852 3300025929 Bacteria 3214
137 Ga0207664_10092461 3300025929 Bacteria 2483
138 Ga0207664_10109515 3300025929 Bacteria 2295
139 Ga0207690_10069524 3300025932 Bacteria 2423
140 Ga0207686_11096384 3300025934 Bacteria 649
141 Ga0207669_10184069 3300025937 Bacteria 1501
142 Ga0207665_10001062 3300025939 Bacteria 18496
143 Ga0207665_10381759 3300025939 Bacteria 1069
144 Ga0207691_10621117 3300025940 Bacteria 914
145 Ga0207661_10084952 3300025944 Bacteria 2623
146 Ga0207679_10155920 3300025945 Bacteria 1865
147 Ga0207667_10058380 3300025949 Bacteria 4047
148 Ga0207667_11248319 3300025949 Bacteria 721
149 Ga0207677_10009223 3300026023 Bacteria 5542
150 Ga0207678_10061951 3300026067 Bacteria 3217
151 Ga0207702_11226744 3300026078 Bacteria 744
152 Ga0207648_10501901 3300026089 Bacteria 1110
153 Ga0207648_11180333 3300026089 Bacteria 719
154 Ga0207676_10820452 3300026095 Bacteria 908
155 Ga0207674_10764567 3300026116 Bacteria 932
156 Ga0207683_10044240 3300026121 Bacteria 3893
157 Ga0207683_10062425 3300026121 Bacteria 3281
158 Ga0207698_11286018 3300026142 Bacteria 746
159 Ga0209589_1000007 3300027357 Bacteria 425699
160 Ga0209489_100008 3300027361 Bacteria 425699
161 Ga0209700_100009 3300027363 Bacteria 425699
162 Ga0209588_1050143 3300027671 Bacteria 1351
163 Ga0209813_10255104 3300027866 Bacteria 667
164 Ga0265339_10013152 3300031249 Bacteria 5023
165 Ga0265314_10053234 3300031711 Bacteria 2808
166 Ga0373926_0051585 3300035083 Bacteria 1485
167 Ga0373936_0015042 3300035113 Bacteria 2963
168 Ga0373945_0016860 3300035116 Bacteria 2469
169 Ga0373954_0248218 3300035118 Bacteria 876
170 Ga0373943_0008287 3300035170 Bacteria 4665
171 Ga0373931_0131048 3300035691 Bacteria 1443
172 Ga0373935_0001283 3300035692 Bacteria 13847
173 Ga0373935_0079222 3300035692 Bacteria 2132
174 Ga0373927_0000515 3300035695 Bacteria 29473
175 Ga0373927_0006135 3300035695 Bacteria 8224
176 Ga0373927_0047550 3300035695 Bacteria 2775
177 Ga0373933_0126778 3300035724 Bacteria 1602
178 Ga0373947_0004303 3300035725 Bacteria 8362
179 Ga0373947_0035085 3300035725 Bacteria 2969
180 Ga0373937_0042654 3300036401 Bacteria 4139
181 Ga0373937_0193793 3300036401 Bacteria 1910
182 Ga0373925_0001116 3300037068 Bacteria 23846
183 Ga0373925_0104549 3300037068 Bacteria 2180
184 Ga0395898_0441806 3300037466 Bacteria 1239
185 Ga0395905_0273590 3300037471 Bacteria 1575
186 Ga0436364_0968934 3300037853 Bacteria 907
187 Ga0395901_0053941 3300038443 Bacteria 4178
188 Ga0395901_0094599 3300038443 Bacteria 3130
189 Ga0395901_0392979 3300038443 Bacteria 1426
190 Ga0436365_0052671 3300039437 Bacteria 6408
191 Ga0436365_0474195 3300039437 Bacteria 5476
192 Ga0436365_0990149 3300039437 Bacteria 3178
193 Ga0436363_0945488 3300039450 Bacteria 861
194 Ga0436363_1343765 3300039450 Bacteria 5187
195 Ga0466968_0151592 3300044735 Bacteria 1066
196 Ga0495603_0000156 3300046455 Bacteria 34369
197 Ga0495603_0279982 3300046455 Bacteria 959
198 Ga0495629_0000297 3300046459 Bacteria 42433
199 Ga0495641_0016704 3300046461 Bacteria 3856
200 Ga0495580_0004564 3300046472 Bacteria 11624
201 Ga0495582_0000087 3300046473 Bacteria 47529
202 Ga0495639_0000153 3300046475 Bacteria 35461
203 Ga0495662_0004971 3300046476 Bacteria 6655
204 Ga0495662_0303857 3300046476 Bacteria 785
205 Ga0495664_0017781 3300046477 Bacteria 4065
206 Ga0495664_0122134 3300046477 Bacteria 1575
207 Ga0495594_0095234 3300046499 Bacteria 1671
208 Ga0495618_0506745 3300046514 Bacteria 727
209 Ga0495628_0039901 3300046516 Bacteria 3754
210 Ga0495630_0000735 3300046517 Bacteria 23119
211 Ga0495630_0210742 3300046517 Bacteria 1483
212 Ga0495666_0017403 3300046526 Bacteria 3580
213 Ga0495652_0003411 3300046529 Bacteria 15714
214 Ga0495665_0000117 3300046531 Bacteria 37802
215 Ga0495640_0002597 3300046533 Bacteria 14524
216 Ga0495640_0189758 3300046533 Bacteria 1307
217 Ga0495586_0108150 3300046535 Bacteria 1547
218 Ga0495645_0386658 3300046543 Bacteria 894
219 Ga0495634_0009937 3300046642 Bacteria 6992
220 Ga0495635_0011937 3300046663 Bacteria 6085
221 Ga0495588_0012608 3300046674 Bacteria 4001
222 Ga0495588_0049250 3300046674 Bacteria 2166
223 Ga0495588_0363953 3300046674 Bacteria 760
224 Ga0495657_0128446 3300046675 Bacteria 1590
225 Ga0495599_0141332 3300046678 Bacteria 1493
226 Ga0495647_0000365 3300046681 Bacteria 12760
227 Ga0495658_0000644 3300046683 Bacteria 18891
228 Ga0495613_0046869 3300046689 Bacteria 3195
229 Ga0495624_0001012 3300046690 Bacteria 22250
230 Ga0495600_0038444 3300046809 Bacteria 3114
231 Ga0495581_0000543 3300047315 Bacteria 19442
232 Ga0495581_0118366 3300047315 Bacteria 1541
233 Ga0495581_0138193 3300047315 Bacteria 1421
234 Ga0495581_0389198 3300047315 Bacteria 814
235 Ga0495604_0162158 3300047317 Bacteria 1579
236 Ga0495674_0000177 3300047319 Bacteria 50030
237 Ga0495674_0447155 3300047319 Bacteria 1039
238 Ga0495672_0022702 3300047320 Bacteria 4074
239 Ga0495676_0017162 3300047321 Bacteria 6406
240 Ga0495680_0050845 3300047322 Bacteria 3239
241 Ga0495673_0011890 3300047469 Bacteria 4650
242 Ga0495684_0002187 3300047471 Bacteria 15656
243 Ga0495686_0021609 3300047472 Bacteria 4269
244 Ga0495593_0000156 3300047673 Bacteria 34308
245 Ga0495602_0468383 3300048088 Bacteria 886
246 Ga0495614_0012177 3300048089 Bacteria 3776
247 Ga0496100_0008212 3300048903 Bacteria 5814
248 Ga0496100_0069060 3300048903 Bacteria 2352
249 Ga0496100_0072789 3300048903 Bacteria 2298
250 Ga0496100_0892247 3300048903 Bacteria 698
251 Ga0496101_0007180 3300048904 Bacteria 7207
252 Ga0496101_0452397 3300048904 Bacteria 1013
253 Ga0496102_0010384 3300048905 Bacteria 8013
254 Ga0496104_0032296 3300048907 Bacteria 4871
255 Ga0496104_0184337 3300048907 Bacteria 1998
256 Ga0496106_0006989 3300048909 Bacteria 8338
257 Ga0496106_0033779 3300048909 Bacteria 3818
258 Ga0496107_0044435 3300048910 Bacteria 3193
259 Ga0496107_0056443 3300048910 Bacteria 2837
260 Ga0496108_0013601 3300048911 Bacteria 6642
261 Ga0496109_0017335 3300048912 Bacteria 6311
262 Ga0496109_0369812 3300048912 Bacteria 1354
263 Ga0496109_0485497 3300048912 Bacteria 1166
264 Ga0496110_0006206 3300048913 Bacteria 9434
265 Ga0496110_0263963 3300048913 Bacteria 1567
266 Ga0496111_0248446 3300048914 Bacteria 1320
267 Ga0496111_0251473 3300048914 Bacteria 1312
268 Ga0496112_0020223 3300048915 Bacteria 6304
269 Ga0496113_0021724 3300048916 Bacteria 4530
270 Ga0496113_0197021 3300048916 Bacteria 1600
271 Ga0496114_0010492 3300048917 Bacteria 7372
272 Ga0496114_0174906 3300048917 Bacteria 1873
273 Ga0496114_0268589 3300048917 Bacteria 1503
274 Ga0496114_1382154 3300048917 Bacteria 591
275 Ga0496115_0003709 3300048918 Bacteria 10987
276 Ga0496115_0013946 3300048918 Bacteria 6081
277 Ga0496121_0000287 3300048924 Bacteria 104774
278 Ga0496126_0034253 3300048929 Bacteria 4771
279 Ga0496126_0079318 3300048929 Bacteria 2906
280 Ga0496126_0310323 3300048929 Bacteria 1299
281 nmdc:mga0k408_721264_c1 3300050493 Bacteria 583
282 nmdc:mga04h51_287165_c1 3300050495 Bacteria 667
283 nmdc:mga08y16_198846_c1 3300050511 Bacteria 2077
284 nmdc:mga0n895_258555_c1 3300050512 Bacteria 1767
285 nmdc:mga0sz30_137191_c1 3300050516 Bacteria 1079
286 Ga0495601_0220059 3300053077 Bacteria 1240
287 Ga0495601_0707740 3300053077 Bacteria 642
288 Ga0495619_0048238 3300053085 Bacteria 2806
289 Ga0495619_0219070 3300053085 Bacteria 1318
290 Ga0500647_0214323 3300053091 Bacteria 866
291 Ga0500566_0000035 3300053094 Bacteria 69457
292 Ga0500640_000054 3300053095 Bacteria 17851
293 Ga0500654_122960 3300053099 Bacteria 1013
294 Ga0500554_025947 3300053102 Bacteria 1678
295 Ga0500572_000122 3300053111 Bacteria 26114
296 Ga0500572_001570 3300053111 Bacteria 6081
297 Ga0500595_011238 3300053119 Bacteria 3515
298 Ga0500608_061148 3300053122 Bacteria 1800
299 Ga0500614_000431 3300053123 Bacteria 10919
300 Ga0500559_0001632 3300053136 Bacteria 12429
301 Ga0500559_0001963 3300053136 Bacteria 11120
302 Ga0500568_0004068 3300053139 Bacteria 7918
303 Ga0500568_0239263 3300053139 Bacteria 662
304 Ga0500603_001828 3300053150 Bacteria 4768
305 Ga0500603_008621 3300053150 Bacteria 2267
306 Ga0500630_000187 3300053159 Bacteria 23623
307 Ga0500638_018935 3300053162 Bacteria 3220
308 Ga0500638_228894 3300053162 Bacteria 765
309 Ga0500639_000038 3300053163 Bacteria 65317
310 Ga0500637_0000714 3300053178 Bacteria 13261
311 Ga0500637_0195706 3300053178 Bacteria 1153
312 Ga0500576_028447 3300053725 Bacteria 2547
313 Ga0500576_117513 3300053725 Bacteria 1054
314 Ga0500657_160557 3300053728 Bacteria 816
315 Ga0500596_001404 3300053735 Bacteria 4870
316 Ga0501082_0000027 3300060353 Bacteria 100915
317 2841763738 2841760612 Bacteria 6454112
318 2844109358 2844104063 Bacteria 6440972
319 2851251465 2851246043 Bacteria 6439203
320 2885375363 2885374607 Bacteria 8927485
321 2904698023 2904690495 Bacteria 9412302
322 2908763061 2908756301 Bacteria 8864324
323 3005477389 3005474847 Bacteria 9259049
324 8056694004 8056689827 Bacteria 6712655
325 Ga0207693_10097288
326 JGI25406J46586_10000022
327 JGI25406J46586_10005227
328 JGI25404J52841_10002965
329 Ga0055542_1021690
330 Ga0070658_10117012
331 Ga0070683_100088187
332 Ga0070680_100217148
333 Ga0070682_100859841
334 Ga0068868_100012390
335 Ga0070675_100361650
336 Ga0070671_100244181
337 Ga0070674_100300341
338 Ga0070659_100140846
339 Ga0070709_10001601
340 Ga0070709_10009240
341 Ga0070709_10378544
342 Ga0070714_100049050
343 Ga0070714_100778445
344 Ga0070713_100008549
345 Ga0070713_100084249
346 Ga0070713_100204260
347 Ga0070710_10001667
348 Ga0070711_100011007
349 Ga0070711_100019327
350 Ga0070711_101546381
351 Ga0070708_100110326
352 Ga0070678_100146261
353 Ga0070678_100970486
354 Ga0070681_10008310
355 Ga0070707_100380764
356 Ga0070698_100092754
357 Ga0070698_100317070
358 Ga0070679_100257961
359 Ga0070697_100221613
360 Ga0070672_100718075
361 Ga0068855_100011850
362 Ga0068856_100080226
363 Ga0068856_100794927
364 Ga0068852_100614172
365 Ga0068864_100023341
366 Ga0068851_10018844
367 Ga0068851_10166788
368 Ga0081540_1000183
369 Ga0081540_1018602
370 Ga0081540_1082383
371 Ga0081539_10000172
372 Ga0081539_10000945
373 Ga0081539_10015466
374 Ga0070717_10021111
375 Ga0070717_10023818
376 Ga0075368_10248440
377 Ga0070715_10121028
378 Ga0070715_10229012
379 Ga0070716_100017611
380 Ga0070716_100188462
381 Ga0070712_100694906
382 Ga0070712_100844119
383 Ga0075367_10208462
384 Ga0075369_10265719
385 Ga0075366_10495666
386 Ga0097621_100666760
387 Ga0068871_100802642
388 Ga0068871_101713287
389 Ga0075433_10287706
390 Ga0075434_100329452
391 Ga0068865_100543631
392 Ga0099825_1037589
393 Ga0099824_1011382
394 Ga0099822_1012272
395 Ga0075435_101356036
396 Ga0099794_10116046
397 Ga0099795_10106482
398 Ga0105240_10742339
399 Ga0105245_10127546
400 Ga0105242_11805509
401 Ga0105248_11296479
402 Ga0105238_10238604
403 Ga0105249_10534556
404 Ga0105239_10106397
405 Ga0105239_10656748
406 Ga0157321_1013897
407 Ga0157370_10020367
408 Ga0157370_11250184
409 Ga0157369_10103410
410 Ga0157374_10026908
411 Ga0163162_10014185
412 Ga0163162_10364649
413 Ga0157372_11114549
414 Ga0157375_10029979
415 Ga0157375_10844694
416 Ga0163163_10023168
417 Ga0157379_10403765
418 Ga0157379_11387924
419 Ga0157376_10036268
420 Ga0157376_10748780
421 Ga0163161_10454198
422 Ga0213874_10029433
423 Ga0213876_10231954
424 Ga0213876_10391101
425 Ga0213875_10052917
426 Ga0209026_1022054
427 Ga0209148_1000769
428 Ga0209233_1004263
429 Ga0209455_1001474
430 Ga0209025_1001253
431 Ga0207656_10012253
432 Ga0207692_10018519
433 Ga0207692_10028361
434 Ga0207642_10023129
435 Ga0207688_10113310
436 Ga0207685_10003886
437 Ga0207699_10031090
438 Ga0207699_10032771
439 Ga0207699_10469756
440 Ga0207684_10113540
441 Ga0207684_10219128
442 Ga0207695_10188583
443 Ga0207693_10001156
444 Ga0207693_10031462
445 Ga0207693_10057497
446 Ga0207693_10732980
447 Ga0207663_10000774
448 Ga0207663_10322076
449 Ga0207663_10487150
450 Ga0207660_10206977
451 Ga0207660_10284256
452 Ga0207657_10473242
453 Ga0207652_10236465
454 Ga0207646_10567342
455 Ga0207659_10174518
456 Ga0207687_10040977
457 Ga0207700_10021956
458 Ga0207700_10070029
459 Ga0207664_10049044
460 Ga0207664_10052852
461 Ga0207664_10092461
462 Ga0207664_10109515
463 Ga0207690_10069524
464 Ga0207686_11096384
465 Ga0207669_10184069
466 Ga0207665_10001062
467 Ga0207665_10381759
468 Ga0207691_10621117
469 Ga0207661_10084952
470 Ga0207679_10155920
471 Ga0207667_10058380
472 Ga0207667_11248319
473 Ga0207677_10009223
474 Ga0207678_10061951
475 Ga0207702_11226744
476 Ga0207648_10501901
477 Ga0207648_11180333
478 Ga0207676_10820452
479 Ga0207674_10764567
480 Ga0207683_10044240
481 Ga0207683_10062425
482 Ga0207698_11286018
483 Ga0209589_1000007
484 Ga0209489_100008
485 Ga0209700_100009
486 Ga0209588_1050143
487 Ga0209813_10255104
488 Ga0265339_10013152
489 Ga0265314_10053234
490 Ga0373926_0051585
491 Ga0373936_0015042
492 Ga0373945_0016860
493 Ga0373954_0248218
494 Ga0373943_0008287
495 Ga0373931_0131048
496 Ga0373935_0001283
497 Ga0373935_0079222
498 Ga0373927_0000515
499 Ga0373927_0006135
500 Ga0373927_0047550
501 Ga0373933_0126778
502 Ga0373947_0004303
503 Ga0373947_0035085
504 Ga0373937_0042654
505 Ga0373937_0193793
506 Ga0373925_0001116
507 Ga0373925_0104549
508 Ga0395898_0441806
509 Ga0395905_0273590
510 Ga0436364_0968934
511 Ga0395901_0053941
512 Ga0395901_0094599
513 Ga0395901_0392979
514 Ga0436365_0052671
515 Ga0436365_0474195
516 Ga0436365_0990149
517 Ga0436363_0945488
518 Ga0436363_1343765
519 Ga0466968_0151592
520 Ga0495603_0000156
521 Ga0495603_0279982
522 Ga0495629_0000297
523 Ga0495641_0016704
524 Ga0495580_0004564
525 Ga0495582_0000087
526 Ga0495639_0000153
527 Ga0495662_0004971
528 Ga0495662_0303857
529 Ga0495664_0017781
530 Ga0495664_0122134
531 Ga0495594_0095234
532 Ga0495618_0506745
533 Ga0495628_0039901
534 Ga0495630_0000735
535 Ga0495630_0210742
536 Ga0495666_0017403
537 Ga0495652_0003411
538 Ga0495665_0000117
539 Ga0495640_0002597
540 Ga0495640_0189758
541 Ga0495586_0108150
542 Ga0495645_0386658
543 Ga0495634_0009937
544 Ga0495635_0011937
545 Ga0495588_0012608
546 Ga0495588_0049250
547 Ga0495588_0363953
548 Ga0495657_0128446
549 Ga0495599_0141332
550 Ga0495647_0000365
551 Ga0495658_0000644
552 Ga0495613_0046869
553 Ga0495624_0001012
554 Ga0495600_0038444
555 Ga0495581_0000543
556 Ga0495581_0118366
557 Ga0495581_0138193
558 Ga0495581_0389198
559 Ga0495604_0162158
560 Ga0495674_0000177
561 Ga0495674_0447155
562 Ga0495672_0022702
563 Ga0495676_0017162
564 Ga0495680_0050845
565 Ga0495673_0011890
566 Ga0495684_0002187
567 Ga0495686_0021609
568 Ga0495593_0000156
569 Ga0495602_0468383
570 Ga0495614_0012177
571 Ga0496100_0008212
572 Ga0496100_0069060
573 Ga0496100_0072789
574 Ga0496100_0892247
575 Ga0496101_0007180
576 Ga0496101_0452397
577 Ga0496102_0010384
578 Ga0496104_0032296
579 Ga0496104_0184337
580 Ga0496106_0006989
581 Ga0496106_0033779
582 Ga0496107_0044435
583 Ga0496107_0056443
584 Ga0496108_0013601
585 Ga0496109_0017335
586 Ga0496109_0369812
587 Ga0496109_0485497
588 Ga0496110_0006206
589 Ga0496110_0263963
590 Ga0496111_0248446
591 Ga0496111_0251473
592 Ga0496112_0020223
593 Ga0496113_0021724
594 Ga0496113_0197021
595 Ga0496114_0010492
596 Ga0496114_0174906
597 Ga0496114_0268589
598 Ga0496114_1382154
599 Ga0496115_0003709
600 Ga0496115_0013946
601 Ga0496121_0000287
602 Ga0496126_0034253
603 Ga0496126_0079318
604 Ga0496126_0310323
605 nmdc:mga0k408_721264_c1
606 nmdc:mga04h51_287165_c1
607 nmdc:mga08y16_198846_c1
608 nmdc:mga0n895_258555_c1
609 nmdc:mga0sz30_137191_c1
610 Ga0495601_0220059
611 Ga0495601_0707740
612 Ga0495619_0048238
613 Ga0495619_0219070
614 Ga0500647_0214323
615 Ga0500566_0000035
616 Ga0500640_000054
617 Ga0500654_122960
618 Ga0500554_025947
619 Ga0500572_000122
620 Ga0500572_001570
621 Ga0500595_011238
622 Ga0500608_061148
623 Ga0500614_000431
624 Ga0500559_0001632
625 Ga0500559_0001963
626 Ga0500568_0004068
627 Ga0500568_0239263
628 Ga0500603_001828
629 Ga0500603_008621
630 Ga0500630_000187
631 Ga0500638_018935
632 Ga0500638_228894
633 Ga0500639_000038
634 Ga0500637_0000714
635 Ga0500637_0195706
636 Ga0500576_028447
637 Ga0500576_117513
638 Ga0500657_160557
639 Ga0500596_001404
640 Ga0501082_0000027
641 2841763738
642 2844109358
643 2851251465
644 2885375363
645 2904698023
646 2908763061
647 3005477389
648 8056694004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03205

MobB

Molybdopterin guanine dinucleotide synthesis protein B

40

172

0.97

PF03308

MeaB

Methylmalonyl Co-A mutase-associated GTPase MeaB

17

75

0.9

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

39

143

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e2g-assembly1.cif.gz_A-2 human thymidylate kinase complexed with adp, tdp and a magnesium-ion 0.851 2 36
5hci-assembly2.cif.gz_B-3 gpn-loop gtpase npa3 in complex with gdp 0.8473 3 36
1e9f-assembly1.cif.gz_A-2 mutant human thymidylate kinase complexed with tmp and adp 0.8364 3 36
3pg5-assembly6.cif.gz_D crystal structure of protein dip2308 from corynebacterium diphtheriae, northeast structural genomics consortium target cdr78 0.7838 1 36
8elf-assembly1.cif.gz_A structure of get3d, a homolog of get3, from arabidopsis thaliana 0.7744 1 40
ID Description Score Start End Superfamily
af_Q4DE18_126_348_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8599 2 36 3.40.50.300
af_P36590_1_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8594 2 36 3.40.50.300
af_O01426_2_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8406 3 36 3.40.50.300
af_Q4DHD0_245_454_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8321 4 36 3.40.50.300
af_A0A1D6E955_51_382_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8309 2 36 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7C4BS80-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9759 1 64 GO:0005525
GO:0006777
AF-A0A1F8P987-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.971 7 66 GO:0005525
GO:0006777
AF-A0A378B2L3-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein MobB 0.9644 7 71 GO:0005525
GO:0006777
AF-X1CHC5-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B (MobB) domain-containing protein 0.9587 7 71 GO:0005525
GO:0006777
AF-A0A7V3JPE1-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9555 7 64 GO:0005525
GO:0006777

Map