F407364

General Info

Members Datasets Scaffolds Average Seq Length
324 173 648 344

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10043962|Ga0157369_100439624
Length 370
Sequence MPLIAEHPKTHFSTIPIHSRMQAAVLYGQEDVRLETVPIPALAAGEMLVRVRTALTCGTDVKVYRRGYHAKMIQPPALFGHELAGDVVALGDGLVGFRPGDRVVAANSAPCDECFYCRRGQQNLCEDLLFNNGAYAEYIRLPERIVRKNTYRIPDALSYKDAALVEPLACALRGLDEANVRLGDSVVVLGLGPIGLMFVRLAKAVYGARVIAVARRREQIERALELGADEGALIDRSVDLLNDRALVRQIKAQTAGRGADVVFEAIGRPESWELSTQLVRKGGLINFFGGCPTGTKVGLDTGLLHYSEITCKASFHHTPFHIRRALQLLSDGYINAKHLVTHEQPLSELPHVLHEMAHRTNGQIKTAIIP

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
54 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 2.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.85
Rhizosphere 87.04
Stem 0
Stem Tuber 0
Unclassified 21.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10043962 3300013105 Bacteria 4865
2 Ga0058863_10015642 3300004799 Unclassified 2091
3 Ga0058862_10058674 3300004803 Unclassified 2437
4 Ga0070658_10023605 3300005327 Bacteria 4934
5 Ga0070658_10073164 3300005327 Unclassified 2810
6 Ga0070683_100000018 3300005329 Bacteria 193063
7 Ga0070683_100003290 3300005329 Bacteria 13062
8 Ga0070683_100435636 3300005329 Unclassified 1251
9 Ga0070680_100001126 3300005336 Bacteria 19201
10 Ga0070680_100012437 3300005336 Bacteria 6614
11 Ga0070680_100028411 3300005336 Bacteria 4486
12 Ga0070660_100061101 3300005339 Unclassified 2925
13 Ga0070660_100081386 3300005339 Bacteria 2542
14 Ga0070661_100027076 3300005344 Unclassified 4127
15 Ga0070671_100098418 3300005355 Bacteria 2454
16 Ga0070688_100021359 3300005365 Bacteria 3781
17 Ga0070659_100014567 3300005366 Bacteria 5877
18 Ga0070659_100081961 3300005366 Bacteria 2577
19 Ga0070709_10103042 3300005434 Bacteria 1905
20 Ga0070713_100000494 3300005436 Bacteria 25196
21 Ga0070711_100087660 3300005439 Unclassified 2235
22 Ga0070708_100243676 3300005445 Bacteria 1688
23 Ga0070681_10018946 3300005458 Bacteria 6888
24 Ga0070681_10019204 3300005458 Bacteria 6841
25 Ga0070681_10037828 3300005458 Bacteria 4840
26 Ga0070681_10179982 3300005458 Bacteria 2036
27 Ga0070679_100004343 3300005530 Bacteria 13093
28 Ga0070679_100057370 3300005530 Unclassified 3881
29 Ga0070679_100265699 3300005530 Bacteria 1671
30 Ga0070684_100000011 3300005535 Bacteria 170628
31 Ga0070684_100014287 3300005535 Bacteria 6427
32 Ga0070684_100130956 3300005535 Bacteria 2263
33 Ga0070684_100391450 3300005535 Bacteria 1281
34 Ga0068853_100011908 3300005539 Bacteria 7073
35 Ga0068853_100018229 3300005539 Bacteria 5808
36 Ga0070695_100092323 3300005545 Unclassified 2024
37 Ga0070665_100063111 3300005548 Bacteria 3715
38 Ga0070665_100283407 3300005548 Bacteria 1659
39 Ga0070665_100456436 3300005548 Bacteria 1288
40 Ga0068855_100001625 3300005563 Bacteria 28179
41 Ga0068855_100046594 3300005563 Bacteria 5124
42 Ga0068855_100053124 3300005563 Unclassified 4768
43 Ga0070664_100084562 3300005564 Unclassified 2739
44 Ga0068857_100032449 3300005577 Unclassified 4617
45 Ga0068857_100197042 3300005577 Bacteria 1835
46 Ga0068854_100008623 3300005578 Bacteria 6562
47 Ga0068856_100018986 3300005614 Bacteria 6671
48 Ga0068856_100037328 3300005614 Unclassified 4768
49 Ga0068856_100452868 3300005614 Unclassified 1304
50 Ga0068852_100005606 3300005616 Bacteria 9003
51 Ga0068863_100011553 3300005841 Bacteria 8543
52 Ga0081455_10015552 3300005937 Bacteria 7387
53 Ga0070717_10018160 3300006028 Bacteria 5488
54 Ga0070717_10068480 3300006028 Bacteria 2954
55 Ga0070717_10132459 3300006028 Bacteria 2145
56 Ga0097621_100073912 3300006237 Unclassified 2823
57 Ga0068871_100062338 3300006358 Unclassified 3047
58 Ga0075430_100025396 3300006846 Bacteria 5041
59 Ga0075430_100105389 3300006846 Bacteria 2353
60 Ga0075431_100083399 3300006847 Bacteria 3300
61 Ga0075431_100104210 3300006847 Unclassified 2927
62 Ga0068865_100229774 3300006881 Bacteria 1455
63 Ga0075436_100011912 3300006914 Bacteria 5965
64 Ga0105240_10000473 3300009093 Bacteria 74356
65 Ga0105240_10001273 3300009093 Bacteria 43600
66 Ga0105240_10042924 3300009093 Bacteria 5760
67 Ga0105240_10055969 3300009093 Unclassified 4937
68 Ga0105240_10146227 3300009093 Unclassified 2820
69 Ga0105240_10407259 3300009093 Bacteria 1530
70 Ga0111539_10077876 3300009094 Bacteria 3901
71 Ga0114129_10020339 3300009147 Bacteria 9442
72 Ga0114129_10122497 3300009147 Unclassified 3578
73 Ga0114129_10929762 3300009147 Bacteria 1100
74 Ga0105241_10292070 3300009174 Unclassified 1396
75 Ga0105248_10039772 3300009177 Bacteria 5270
76 Ga0105248_10274832 3300009177 Bacteria 1897
77 Ga0105237_10003358 3300009545 Bacteria 19053
78 Ga0105237_10021162 3300009545 Bacteria 6690
79 Ga0105237_10032149 3300009545 Bacteria 5314
80 Ga0105237_10083569 3300009545 Bacteria 3184
81 Ga0105238_10010209 3300009551 Bacteria 9415
82 Ga0105238_10040057 3300009551 Unclassified 4749
83 Ga0157373_10059144 3300013100 Unclassified 2716
84 Ga0157373_10106003 3300013100 Bacteria 1976
85 Ga0157373_10118192 3300013100 Unclassified 1863
86 Ga0157370_10000785 3300013104 Bacteria 39881
87 Ga0157370_10011029 3300013104 Bacteria 9478
88 Ga0157370_10094914 3300013104 Bacteria 2798
89 Ga0157370_10095126 3300013104 Bacteria 2795
90 Ga0157369_10012664 3300013105 Bacteria 9565
91 Ga0157369_10030816 3300013105 Bacteria 5913
92 Ga0157369_10049447 3300013105 Unclassified 4558
93 Ga0157369_10143924 3300013105 Bacteria 2521
94 Ga0157369_10148044 3300013105 Bacteria 2482
95 Ga0157369_10232928 3300013105 Unclassified 1925
96 Ga0157369_10496056 3300013105 Bacteria 1263
97 Ga0157374_10004515 3300013296 Bacteria 11696
98 Ga0157374_10293102 3300013296 Bacteria 1608
99 Ga0157378_10155693 3300013297 Bacteria 2133
100 Ga0163162_10259440 3300013306 Bacteria 1870
101 Ga0157372_10017240 3300013307 Bacteria 7752
102 Ga0157372_10023427 3300013307 Bacteria 6692
103 Ga0157372_10165145 3300013307 Unclassified 2560
104 Ga0163163_10230317 3300014325 Bacteria 1902
105 Ga0163163_10374536 3300014325 Bacteria 1481
106 Ga0157379_10043105 3300014968 Bacteria 4029
107 Ga0197907_10473752 3300020069 Bacteria 1603
108 Ga0206355_1444855 3300020076 Bacteria 1551
109 Ga0206352_10844879 3300020078 Bacteria 1784
110 Ga0206350_10180901 3300020080 Unclassified 1177
111 Ga0206350_10740947 3300020080 Bacteria 1351
112 Ga0206350_11375269 3300020080 Bacteria 2089
113 Ga0213873_10001852 3300021358 Bacteria 3582
114 Ga0213872_10000545 3300021361 Bacteria 29288
115 Ga0213876_10001829 3300021384 Bacteria 12838
116 Ga0213875_10000018 3300021388 Bacteria 233445
117 Ga0213875_10000029 3300021388 Bacteria 182973
118 Ga0213875_10001015 3300021388 Bacteria 19896
119 Ga0213875_10006463 3300021388 Bacteria 6148
120 Ga0213875_10006721 3300021388 Bacteria 6009
121 Ga0213875_10008667 3300021388 Bacteria 5193
122 Ga0207647_10001887 3300025904 Bacteria 16053
123 Ga0207699_10046527 3300025906 Bacteria 2538
124 Ga0207705_10000258 3300025909 Bacteria 51543
125 Ga0207654_10212865 3300025911 Unclassified 1278
126 Ga0207707_10039411 3300025912 Unclassified 4129
127 Ga0207707_10254728 3300025912 Bacteria 1524
128 Ga0207695_10004016 3300025913 Bacteria 20252
129 Ga0207695_10005354 3300025913 Bacteria 17067
130 Ga0207695_10005904 3300025913 Bacteria 16058
131 Ga0207671_10021423 3300025914 Bacteria 4904
132 Ga0207671_10028658 3300025914 Bacteria 4160
133 Ga0207671_10127199 3300025914 Unclassified 1953
134 Ga0207663_10008099 3300025916 Bacteria 5478
135 Ga0207663_10062896 3300025916 Bacteria 2361
136 Ga0207660_10002636 3300025917 Bacteria 11764
137 Ga0207660_10105075 3300025917 Unclassified 2115
138 Ga0207657_10001823 3300025919 Bacteria 22981
139 Ga0207657_10067286 3300025919 Bacteria 3046
140 Ga0207657_10106354 3300025919 Unclassified 2322
141 Ga0207652_10029902 3300025921 Unclassified 4559
142 Ga0207652_10052757 3300025921 Unclassified 3491
143 Ga0207652_10096702 3300025921 Bacteria 2602
144 Ga0207652_10124618 3300025921 Unclassified 2294
145 Ga0207652_10203892 3300025921 Bacteria 1780
146 Ga0207694_10038663 3300025924 Unclassified 3669
147 Ga0207700_10004455 3300025928 Bacteria 8259
148 Ga0207700_10056068 3300025928 Bacteria 2965
149 Ga0207664_10003316 3300025929 Bacteria 10706
150 Ga0207690_10137865 3300025932 Bacteria 1794
151 Ga0207661_10000025 3300025944 Bacteria 195900
152 Ga0207661_10048756 3300025944 Bacteria 3368
153 Ga0207667_10006171 3300025949 Bacteria 14552
154 Ga0207667_10007885 3300025949 Bacteria 12712
155 Ga0207667_10126756 3300025949 Unclassified 2630
156 Ga0207712_10067598 3300025961 Bacteria 2558
157 Ga0207640_10008657 3300025981 Bacteria 5657
158 Ga0207703_10216227 3300026035 Bacteria 1711
159 Ga0207639_10031601 3300026041 Unclassified 3892
160 Ga0207639_10043261 3300026041 Unclassified 3381
161 Ga0207678_10006466 3300026067 Bacteria 10397
162 Ga0207702_10009221 3300026078 Bacteria 8298
163 Ga0207702_10013070 3300026078 Bacteria 6902
164 Ga0207702_10177451 3300026078 Unclassified 1959
165 Ga0207641_10019696 3300026088 Bacteria 5540
166 Ga0207676_10079727 3300026095 Bacteria 2656
167 Ga0207674_10000568 3300026116 Bacteria 48415
168 Ga0207674_10100282 3300026116 Bacteria 2877
169 Ga0207698_10003530 3300026142 Bacteria 9431
170 Ga0268266_10234030 3300028379 Bacteria 1693
171 Ga0265323_10000176 3300028653 Bacteria 38367
172 Ga0265325_10042322 3300031241 Bacteria 2382
173 Ga0265329_10049646 3300031242 Bacteria 1337
174 Ga0265331_10021782 3300031250 Bacteria 3275
175 Ga0265316_10001474 3300031344 Bacteria 25216
176 Ga0265316_10002270 3300031344 Bacteria 20139
177 Ga0265316_10016398 3300031344 Bacteria 6427
178 Ga0265316_10033694 3300031344 Bacteria 4168
179 Ga0265316_10053299 3300031344 Bacteria 3170
180 Ga0265316_10108811 3300031344 Bacteria 2101
181 Ga0265314_10010128 3300031711 Bacteria 7901
182 Ga0373954_0024072 3300035118 Unclassified 2774
183 Ga0373954_0061658 3300035118 Bacteria 1770
184 Ga0373956_0029119 3300035119 Unclassified 2407
185 Ga0373943_0062386 3300035170 Unclassified 1866
186 Ga0373955_0147531 3300035172 Unclassified 1383
187 Ga0373935_0018118 3300035692 Bacteria 4280
188 Ga0373935_0032434 3300035692 Bacteria 3247
189 Ga0373935_0038843 3300035692 Unclassified 2982
190 Ga0373927_0000816 3300035695 Bacteria 23841
191 Ga0373927_0001796 3300035695 Bacteria 16009
192 Ga0373927_0009638 3300035695 Bacteria 6477
193 Ga0373927_0028605 3300035695 Unclassified 3635
194 Ga0373927_0039089 3300035695 Unclassified 3079
195 Ga0373933_0023447 3300035724 Unclassified 3526
196 Ga0373933_0037922 3300035724 Unclassified 2830
197 Ga0373947_0016469 3300035725 Unclassified 4247
198 Ga0373947_0028797 3300035725 Unclassified 3258
199 Ga0373937_0067766 3300036401 Unclassified 3289
200 Ga0373937_0217062 3300036401 Bacteria 1800
201 Ga0373937_0323605 3300036401 Bacteria 1459
202 Ga0373925_0000090 3300037068 Bacteria 97041
203 Ga0373925_0179746 3300037068 Bacteria 1674
204 Ga0373925_0494405 3300037068 Bacteria 1004
205 Ga0436364_0023988 3300037853 Unclassified 3565
206 Ga0436364_0029684 3300037853 Bacteria 2648
207 Ga0436364_0117983 3300037853 Bacteria 23036
208 Ga0436364_0158068 3300037853 Bacteria 183638
209 Ga0436364_0175627 3300037853 Bacteria 26156
210 Ga0436364_0269542 3300037853 Bacteria 4955
211 Ga0436364_0275147 3300037853 Unclassified 2453
212 Ga0436364_0327918 3300037853 Bacteria 5201
213 Ga0436364_0364416 3300037853 Bacteria 84577
214 Ga0436364_0481712 3300037853 Bacteria 5505
215 Ga0436364_0539343 3300037853 Bacteria 9051
216 Ga0436364_0563199 3300037853 Bacteria 4514
217 Ga0436364_0654147 3300037853 Bacteria 6244
218 Ga0436364_0681006 3300037853 Bacteria 6391
219 Ga0436364_0870787 3300037853 Bacteria 1187
220 Ga0436364_0922125 3300037853 Bacteria 53089
221 Ga0436364_1079487 3300037853 Bacteria 6790
222 Ga0436364_1134507 3300037853 Bacteria 1593
223 Ga0436364_1224210 3300037853 Bacteria 6140
224 Ga0436364_1365764 3300037853 Bacteria 1520
225 Ga0436364_1475620 3300037853 Unclassified 972
226 Ga0436365_0072197 3300039437 Bacteria 1232
227 Ga0436365_0106236 3300039437 Bacteria 4313
228 Ga0436365_0379800 3300039437 Bacteria 4828
229 Ga0436365_0992386 3300039437 Unclassified 1101
230 Ga0436365_1253405 3300039437 Unclassified 955
231 Ga0436365_1458373 3300039437 Bacteria 3303
232 Ga0436360_0169275 3300039438 Bacteria 11285
233 Ga0436360_0472578 3300039438 Unclassified 1611
234 Ga0436361_0419405 3300039447 Bacteria 103155
235 Ga0436363_0564752 3300039450 Bacteria 5370
236 Ga0436363_0744853 3300039450 Bacteria 5109
237 Ga0436362_0872453 3300039453 Unclassified 1949
238 Ga0436362_1116312 3300039453 Unclassified 2341
239 Ga0436362_1243584 3300039453 Bacteria 5300
240 Ga0436362_1255223 3300039453 Bacteria 2521
241 Ga0466966_0101723 3300044684 Bacteria 1777
242 Ga0466961_0162893 3300044693 Unclassified 1390
243 Ga0466959_0195241 3300045049 Bacteria 1411
244 Ga0451576_0048925 3300045051 Bacteria 4438
245 Ga0451576_0507637 3300045051 Bacteria 1267
246 Ga0466967_0042729 3300045976 Unclassified 3919
247 Ga0495651_0004332 3300046462 Bacteria 10871
248 Ga0495653_0140894 3300046463 Bacteria 1696
249 Ga0495580_0010843 3300046472 Bacteria 7071
250 Ga0495580_0014390 3300046472 Bacteria 6000
251 Ga0495662_0002180 3300046476 Bacteria 9847
252 Ga0495664_0007138 3300046477 Bacteria 6192
253 Ga0495594_0176135 3300046499 Unclassified 1217
254 Ga0495608_0036916 3300046511 Bacteria 3287
255 Ga0495618_0018002 3300046514 Bacteria 4336
256 Ga0495628_0030142 3300046516 Bacteria 4393
257 Ga0495630_0081818 3300046517 Bacteria 2437
258 Ga0495652_0044342 3300046529 Bacteria 3830
259 Ga0495665_0011742 3300046531 Unclassified 4746
260 Ga0495665_0150925 3300046531 Bacteria 1213
261 Ga0495640_0002714 3300046533 Bacteria 14237
262 Ga0495586_0056533 3300046535 Bacteria 2128
263 Ga0495587_0004938 3300046536 Bacteria 8741
264 Ga0495645_0000398 3300046543 Bacteria 30095
265 Ga0495667_0001850 3300046559 Bacteria 14036
266 Ga0495634_0044798 3300046642 Bacteria 2992
267 Ga0495635_0031875 3300046663 Bacteria 3657
268 Ga0495635_0069408 3300046663 Bacteria 2416
269 Ga0495599_0004196 3300046678 Bacteria 8506
270 Ga0495599_0220572 3300046678 Bacteria 1160
271 Ga0495623_0067757 3300046679 Bacteria 2227
272 Ga0495646_0002593 3300046680 Bacteria 11134
273 Ga0495613_0054217 3300046689 Bacteria 2948
274 Ga0495604_0013143 3300047317 Bacteria 6592
275 Ga0495604_0040678 3300047317 Bacteria 3649
276 Ga0495604_0178639 3300047317 Bacteria 1486
277 Ga0495674_0006451 3300047319 Bacteria 11248
278 Ga0495674_0367878 3300047319 Bacteria 1165
279 Ga0495684_0020924 3300047471 Bacteria 5040
280 Ga0495684_0023531 3300047471 Bacteria 4736
281 Ga0495602_0011203 3300048088 Bacteria 9272
282 Ga0495602_0015287 3300048088 Bacteria 7753
283 Ga0496112_0032474 3300048915 Bacteria 5069
284 Ga0496112_0258614 3300048915 Bacteria 1691
285 Ga0496112_0299830 3300048915 Bacteria 1553
286 Ga0496113_0040453 3300048916 Unclassified 3436
287 Ga0496115_0133911 3300048918 Unclassified 2043
288 Ga0496115_0443007 3300048918 Bacteria 1050
289 Ga0501031_0005688 3300049568 Bacteria 8126
290 Ga0501032_0005592 3300049569 Bacteria 9313
291 Ga0501033_0015695 3300049570 Bacteria 5743
292 Ga0501033_0150979 3300049570 Bacteria 1676
293 Ga0501034_0023029 3300049571 Bacteria 6347
294 Ga0501034_0150761 3300049571 Bacteria 2301
295 Ga0501036_0005264 3300049572 Bacteria 10466
296 Ga0501037_0001447 3300049573 Bacteria 17428
297 Ga0501038_0004930 3300049574 Bacteria 12395
298 Ga0501039_0011262 3300049575 Bacteria 6812
299 Ga0501043_0006162 3300049579 Bacteria 9632
300 Ga0501043_0287174 3300049579 Bacteria 1260
301 Ga0501046_0021080 3300049580 Bacteria 5381
302 Ga0501047_0223409 3300049581 Unclassified 1739
303 Ga0501048_0020488 3300049582 Bacteria 4846
304 Ga0501067_0034714 3300049583 Bacteria 2799
305 Ga0501068_0001975 3300049584 Bacteria 10913
306 Ga0501069_0001743 3300049585 Bacteria 10846
307 Ga0501070_0096942 3300049586 Bacteria 2439
308 Ga0501072_0001455 3300049588 Bacteria 17748
309 Ga0501076_0031228 3300049592 Bacteria 4153
310 Ga0501249_002329 3300049679 Bacteria 3839
311 Ga0501080_0000021 3300049742 Bacteria 91749
312 Ga0501083_0023023 3300049744 Bacteria 4323
313 nmdc:mga05p37_264827_c1 3300050507 Bacteria 2055
314 nmdc:mga05p37_361589_c1 3300050507 Unclassified 1706
315 nmdc:mga0qj67_136896_c1 3300050509 Bacteria 1984
316 nmdc:mga0qj67_4112_c1 3300050509 Bacteria 10544
317 nmdc:mga06r32_59943_c1 3300050510 Unclassified 2764
318 nmdc:mga06r32_77115_c1 3300050510 Bacteria 3237
319 nmdc:mga08x19_410_c1 3300050514 Bacteria 30075
320 Ga0501084_0000927 3300054114 Bacteria 22686
321 Ga0501082_0000272 3300060353 Bacteria 45665
322 Ga0501082_0003711 3300060353 Bacteria 13345
323 Ga0466962_0091250 3300061719 Bacteria 1460
324 Ga0530510_0302872 3300061734 Bacteria 1196
325 Ga0157369_10043962
326 Ga0058863_10015642
327 Ga0058862_10058674
328 Ga0070658_10023605
329 Ga0070658_10073164
330 Ga0070683_100000018
331 Ga0070683_100003290
332 Ga0070683_100435636
333 Ga0070680_100001126
334 Ga0070680_100012437
335 Ga0070680_100028411
336 Ga0070660_100061101
337 Ga0070660_100081386
338 Ga0070661_100027076
339 Ga0070671_100098418
340 Ga0070688_100021359
341 Ga0070659_100014567
342 Ga0070659_100081961
343 Ga0070709_10103042
344 Ga0070713_100000494
345 Ga0070711_100087660
346 Ga0070708_100243676
347 Ga0070681_10018946
348 Ga0070681_10019204
349 Ga0070681_10037828
350 Ga0070681_10179982
351 Ga0070679_100004343
352 Ga0070679_100057370
353 Ga0070679_100265699
354 Ga0070684_100000011
355 Ga0070684_100014287
356 Ga0070684_100130956
357 Ga0070684_100391450
358 Ga0068853_100011908
359 Ga0068853_100018229
360 Ga0070695_100092323
361 Ga0070665_100063111
362 Ga0070665_100283407
363 Ga0070665_100456436
364 Ga0068855_100001625
365 Ga0068855_100046594
366 Ga0068855_100053124
367 Ga0070664_100084562
368 Ga0068857_100032449
369 Ga0068857_100197042
370 Ga0068854_100008623
371 Ga0068856_100018986
372 Ga0068856_100037328
373 Ga0068856_100452868
374 Ga0068852_100005606
375 Ga0068863_100011553
376 Ga0081455_10015552
377 Ga0070717_10018160
378 Ga0070717_10068480
379 Ga0070717_10132459
380 Ga0097621_100073912
381 Ga0068871_100062338
382 Ga0075430_100025396
383 Ga0075430_100105389
384 Ga0075431_100083399
385 Ga0075431_100104210
386 Ga0068865_100229774
387 Ga0075436_100011912
388 Ga0105240_10000473
389 Ga0105240_10001273
390 Ga0105240_10042924
391 Ga0105240_10055969
392 Ga0105240_10146227
393 Ga0105240_10407259
394 Ga0111539_10077876
395 Ga0114129_10020339
396 Ga0114129_10122497
397 Ga0114129_10929762
398 Ga0105241_10292070
399 Ga0105248_10039772
400 Ga0105248_10274832
401 Ga0105237_10003358
402 Ga0105237_10021162
403 Ga0105237_10032149
404 Ga0105237_10083569
405 Ga0105238_10010209
406 Ga0105238_10040057
407 Ga0157373_10059144
408 Ga0157373_10106003
409 Ga0157373_10118192
410 Ga0157370_10000785
411 Ga0157370_10011029
412 Ga0157370_10094914
413 Ga0157370_10095126
414 Ga0157369_10012664
415 Ga0157369_10030816
416 Ga0157369_10049447
417 Ga0157369_10143924
418 Ga0157369_10148044
419 Ga0157369_10232928
420 Ga0157369_10496056
421 Ga0157374_10004515
422 Ga0157374_10293102
423 Ga0157378_10155693
424 Ga0163162_10259440
425 Ga0157372_10017240
426 Ga0157372_10023427
427 Ga0157372_10165145
428 Ga0163163_10230317
429 Ga0163163_10374536
430 Ga0157379_10043105
431 Ga0197907_10473752
432 Ga0206355_1444855
433 Ga0206352_10844879
434 Ga0206350_10180901
435 Ga0206350_10740947
436 Ga0206350_11375269
437 Ga0213873_10001852
438 Ga0213872_10000545
439 Ga0213876_10001829
440 Ga0213875_10000018
441 Ga0213875_10000029
442 Ga0213875_10001015
443 Ga0213875_10006463
444 Ga0213875_10006721
445 Ga0213875_10008667
446 Ga0207647_10001887
447 Ga0207699_10046527
448 Ga0207705_10000258
449 Ga0207654_10212865
450 Ga0207707_10039411
451 Ga0207707_10254728
452 Ga0207695_10004016
453 Ga0207695_10005354
454 Ga0207695_10005904
455 Ga0207671_10021423
456 Ga0207671_10028658
457 Ga0207671_10127199
458 Ga0207663_10008099
459 Ga0207663_10062896
460 Ga0207660_10002636
461 Ga0207660_10105075
462 Ga0207657_10001823
463 Ga0207657_10067286
464 Ga0207657_10106354
465 Ga0207652_10029902
466 Ga0207652_10052757
467 Ga0207652_10096702
468 Ga0207652_10124618
469 Ga0207652_10203892
470 Ga0207694_10038663
471 Ga0207700_10004455
472 Ga0207700_10056068
473 Ga0207664_10003316
474 Ga0207690_10137865
475 Ga0207661_10000025
476 Ga0207661_10048756
477 Ga0207667_10006171
478 Ga0207667_10007885
479 Ga0207667_10126756
480 Ga0207712_10067598
481 Ga0207640_10008657
482 Ga0207703_10216227
483 Ga0207639_10031601
484 Ga0207639_10043261
485 Ga0207678_10006466
486 Ga0207702_10009221
487 Ga0207702_10013070
488 Ga0207702_10177451
489 Ga0207641_10019696
490 Ga0207676_10079727
491 Ga0207674_10000568
492 Ga0207674_10100282
493 Ga0207698_10003530
494 Ga0268266_10234030
495 Ga0265323_10000176
496 Ga0265325_10042322
497 Ga0265329_10049646
498 Ga0265331_10021782
499 Ga0265316_10001474
500 Ga0265316_10002270
501 Ga0265316_10016398
502 Ga0265316_10033694
503 Ga0265316_10053299
504 Ga0265316_10108811
505 Ga0265314_10010128
506 Ga0373954_0024072
507 Ga0373954_0061658
508 Ga0373956_0029119
509 Ga0373943_0062386
510 Ga0373955_0147531
511 Ga0373935_0018118
512 Ga0373935_0032434
513 Ga0373935_0038843
514 Ga0373927_0000816
515 Ga0373927_0001796
516 Ga0373927_0009638
517 Ga0373927_0028605
518 Ga0373927_0039089
519 Ga0373933_0023447
520 Ga0373933_0037922
521 Ga0373947_0016469
522 Ga0373947_0028797
523 Ga0373937_0067766
524 Ga0373937_0217062
525 Ga0373937_0323605
526 Ga0373925_0000090
527 Ga0373925_0179746
528 Ga0373925_0494405
529 Ga0436364_0023988
530 Ga0436364_0029684
531 Ga0436364_0117983
532 Ga0436364_0158068
533 Ga0436364_0175627
534 Ga0436364_0269542
535 Ga0436364_0275147
536 Ga0436364_0327918
537 Ga0436364_0364416
538 Ga0436364_0481712
539 Ga0436364_0539343
540 Ga0436364_0563199
541 Ga0436364_0654147
542 Ga0436364_0681006
543 Ga0436364_0870787
544 Ga0436364_0922125
545 Ga0436364_1079487
546 Ga0436364_1134507
547 Ga0436364_1224210
548 Ga0436364_1365764
549 Ga0436364_1475620
550 Ga0436365_0072197
551 Ga0436365_0106236
552 Ga0436365_0379800
553 Ga0436365_0992386
554 Ga0436365_1253405
555 Ga0436365_1458373
556 Ga0436360_0169275
557 Ga0436360_0472578
558 Ga0436361_0419405
559 Ga0436363_0564752
560 Ga0436363_0744853
561 Ga0436362_0872453
562 Ga0436362_1116312
563 Ga0436362_1243584
564 Ga0436362_1255223
565 Ga0466966_0101723
566 Ga0466961_0162893
567 Ga0466959_0195241
568 Ga0451576_0048925
569 Ga0451576_0507637
570 Ga0466967_0042729
571 Ga0495651_0004332
572 Ga0495653_0140894
573 Ga0495580_0010843
574 Ga0495580_0014390
575 Ga0495662_0002180
576 Ga0495664_0007138
577 Ga0495594_0176135
578 Ga0495608_0036916
579 Ga0495618_0018002
580 Ga0495628_0030142
581 Ga0495630_0081818
582 Ga0495652_0044342
583 Ga0495665_0011742
584 Ga0495665_0150925
585 Ga0495640_0002714
586 Ga0495586_0056533
587 Ga0495587_0004938
588 Ga0495645_0000398
589 Ga0495667_0001850
590 Ga0495634_0044798
591 Ga0495635_0031875
592 Ga0495635_0069408
593 Ga0495599_0004196
594 Ga0495599_0220572
595 Ga0495623_0067757
596 Ga0495646_0002593
597 Ga0495613_0054217
598 Ga0495604_0013143
599 Ga0495604_0040678
600 Ga0495604_0178639
601 Ga0495674_0006451
602 Ga0495674_0367878
603 Ga0495684_0020924
604 Ga0495684_0023531
605 Ga0495602_0011203
606 Ga0495602_0015287
607 Ga0496112_0032474
608 Ga0496112_0258614
609 Ga0496112_0299830
610 Ga0496113_0040453
611 Ga0496115_0133911
612 Ga0496115_0443007
613 Ga0501031_0005688
614 Ga0501032_0005592
615 Ga0501033_0015695
616 Ga0501033_0150979
617 Ga0501034_0023029
618 Ga0501034_0150761
619 Ga0501036_0005264
620 Ga0501037_0001447
621 Ga0501038_0004930
622 Ga0501039_0011262
623 Ga0501043_0006162
624 Ga0501043_0287174
625 Ga0501046_0021080
626 Ga0501047_0223409
627 Ga0501048_0020488
628 Ga0501067_0034714
629 Ga0501068_0001975
630 Ga0501069_0001743
631 Ga0501070_0096942
632 Ga0501072_0001455
633 Ga0501076_0031228
634 Ga0501249_002329
635 Ga0501080_0000021
636 Ga0501083_0023023
637 nmdc:mga05p37_264827_c1
638 nmdc:mga05p37_361589_c1
639 nmdc:mga0qj67_136896_c1
640 nmdc:mga0qj67_4112_c1
641 nmdc:mga06r32_59943_c1
642 nmdc:mga06r32_77115_c1
643 nmdc:mga08x19_410_c1
644 Ga0501084_0000927
645 Ga0501082_0000272
646 Ga0501082_0003711
647 Ga0466962_0091250
648 Ga0530510_0302872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

43

155

0.88

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

193

331

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vm2-assembly1.cif.gz_A crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli 0.8986 7 311
4ejm-assembly1.cif.gz_A crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to nadp 0.8945 7 312
1llu-assembly1.cif.gz_A the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate 0.8941 3 312
4cpd-assembly2.cif.gz_C alcohol dehydrogenase tadh from thermus sp. atn1 0.8928 8 312
6iqd-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus 0.8919 8 312
ID Description Score Start End Superfamily
af_P77280_1_347_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.899 7 311 3.90.180.10
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8982 8 146 3.90.180.10
af_Q2G2C5_2_143_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8967 10 146 3.90.180.10
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8942 8 151 3.90.180.10
af_F1Q713_10_342_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8916 13 302 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A2V9HFH9-F1-model_v4 Alcohol dehydrogenase 0.9871 4 197 GO:0008270
GO:0016491
AF-A0A497K8A9-F1-model_v4 Alcohol dehydrogenase 0.9775 8 186 GO:0008270
GO:0016491
AF-A0A3B8PWS7-F1-model_v4 Alcohol dehydrogenase 0.9654 8 267 GO:0016491
AF-A0A497K8A9-F1-model_v4 Alcohol dehydrogenase 0.9616 8 186 GO:0008270
GO:0016491
AF-A0A383EZB2-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.96 7 146 GO:0008270
GO:0016491

Map