F407323

General Info

Members Datasets Scaffolds Average Seq Length
324 148 510 553

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000082|Ga0105240_1000008217
Length 593
Sequence MFFAFIYPSLINFNTLTELTSLKMKLNRFLLILLGIFSLNAHAQLGQPKETFTKADTLRGNTHSPLRTCYDINYYHLDVKFDIDHKFISGSNLFKFTATQDFTKLQFDLFSNLKVEKVVYKGQEVPFKREFNAVFVTFPQPITKGSSDEFTVYYSGNPTEAVNAPWDGGVVFTTDSTGKPWVATACQGIGASIWWPNKDQQADEVDSALISISVPKGLKDVSNGRLRKVTNLKDGYTRFDWFVANPINNYDIEANIGDYTHFGDSYDGEKGKLTIDYWVLPYDLQKAKIHFGENVKRMLKSHEHWFGPYPFYEDGYKLIETPYLGMEHQSGTTYGNHFVNGYWTRDRGGIDLSNTGWGLKWDYIIIHESGHEWFGNNITSKDLADMWIHESFTDYSESLFVESYYGKQAGQEYVNGQRNGIANDRPIVGPYGVNKEGSEDMYAKGSVILNMIRTIINDDEKWRQVLRGLNKTFYHQTVTYNDITSYISKESGIDLSTVFEQYLRTASLPVLHIYQSRNKIYCMWTGCVPNFSMPVRIRVKGGEYKFFNPGSSNHNGVVRSRARAAEINLPGVNMDNIEVDTFNYYIGVLKNQM

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
133 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
134 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
135 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
136 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
137 2738541283 Pedobacter sp. OK701 Isolate Unclassified
138 2738541284 Pedobacter sp. YR016 Isolate Unclassified
139 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
140 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
141 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
142 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
143 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
144 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
145 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
146 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
147 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
148 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.83
Metatranscriptomes 0.31
Isolates 5.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.17
Nodule 0
Rhizoplane 0.93
Rhizosphere 83.02
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10000082 3300009093 Bacteria 195184
2 SwRhRL2b_contig_765205 2162886007 Bacteria 4740
3 JGI24739J22299_10009501 3300001989 Bacteria 3624
4 JGI24737J22298_10000884 3300001990 Bacteria 10697
5 JGI24735J21928_10000015 3300002067 Bacteria 167231
6 JGI25162J39368_1000299 3300002737 Bacteria 45585
7 JGI25162J39368_1002939 3300002737 Bacteria 5760
8 JGI25165J46597_1003110 3300003214 Bacteria 4443
9 rootH1_10025995 3300003316 Bacteria 6228
10 rootH2_10001535 3300003320 Bacteria 91957
11 rootL2_10108394 3300003322 Bacteria 4497
12 rootH1_10005241 3300003323 Bacteria 23232
13 rootH1_10097375 3300003323 Bacteria 4378
14 Ga0058863_10082638 3300004799 Bacteria 11326
15 Ga0065714_10003879 3300005288 Bacteria 5893
16 Ga0065714_10066602 3300005288 Bacteria 6560
17 Ga0065714_10067130 3300005288 Bacteria 5848
18 Ga0065704_10000276 3300005289 Bacteria 41922
19 Ga0065704_10000533 3300005289 Bacteria 17263
20 Ga0070658_10000027 3300005327 Bacteria 164254
21 Ga0070676_10028382 3300005328 Bacteria 3178
22 Ga0070676_10063143 3300005328 Bacteria 2205
23 Ga0070666_10017389 3300005335 Unclassified 4610
24 Ga0068868_100083161 3300005338 Bacteria 2569
25 Ga0070660_100071442 3300005339 Bacteria 2710
26 Ga0070669_100014214 3300005353 Bacteria 5665
27 Ga0070671_100010314 3300005355 Bacteria 7495
28 Ga0070673_100005531 3300005364 Bacteria 8098
29 Ga0070678_100031674 3300005456 Bacteria 3652
30 Ga0070662_100000281 3300005457 Bacteria 30079
31 Ga0070681_10016220 3300005458 Bacteria 7430
32 Ga0068867_100011623 3300005459 Bacteria 6215
33 Ga0070706_100040570 3300005467 Bacteria 4297
34 Ga0070698_100079240 3300005471 Bacteria 3282
35 Ga0070679_100030191 3300005530 Bacteria 5351
36 Ga0070679_100053041 3300005530 Bacteria 4037
37 Ga0068853_100012176 3300005539 Bacteria 6995
38 Ga0070665_100000178 3300005548 Bacteria 113002
39 Ga0068855_100000149 3300005563 Bacteria 89273
40 Ga0068855_100000279 3300005563 Bacteria 63112
41 Ga0068855_100009685 3300005563 Bacteria 11631
42 Ga0068855_100023352 3300005563 Bacteria 7406
43 Ga0068855_100046782 3300005563 Bacteria 5113
44 Ga0068855_100071204 3300005563 Bacteria 4044
45 Ga0068855_100259563 3300005563 Bacteria 1936
46 Ga0068856_100000398 3300005614 Bacteria 47604
47 Ga0068852_100006508 3300005616 Bacteria 8446
48 Ga0068858_100091793 3300005842 Bacteria 2826
49 Ga0081455_10017032 3300005937 Bacteria 6986
50 Ga0081539_10002105 3300005985 Bacteria 29514
51 Ga0075366_10000793 3300006195 Bacteria 15127
52 Ga0097621_100002043 3300006237 Bacteria 13804
53 Ga0068871_100011861 3300006358 Bacteria 6409
54 Ga0068865_100000129 3300006881 Bacteria 39057
55 Ga0105240_10007435 3300009093 Bacteria 15910
56 Ga0105240_10051370 3300009093 Bacteria 5188
57 Ga0105240_10068622 3300009093 Bacteria 4391
58 Ga0105240_10129529 3300009093 Bacteria 3028
59 Ga0105240_10185544 3300009093 Bacteria 2450
60 Ga0105240_10232893 3300009093 Bacteria 2139
61 Ga0114129_10110884 3300009147 Bacteria 3787
62 Ga0105243_10066605 3300009148 Bacteria 2897
63 Ga0105241_10012883 3300009174 Bacteria 6136
64 Ga0105237_10003216 3300009545 Bacteria 19562
65 Ga0105237_10003917 3300009545 Bacteria 17439
66 Ga0105237_10007226 3300009545 Bacteria 12185
67 Ga0105237_10007416 3300009545 Bacteria 12011
68 Ga0105237_10061250 3300009545 Bacteria 3763
69 Ga0105239_10000015 3300010375 Bacteria 319892
70 Ga0105239_10000115 3300010375 Bacteria 113217
71 Ga0105239_10003070 3300010375 Bacteria 20752
72 Ga0105239_10005378 3300010375 Bacteria 15038
73 Ga0105239_10016495 3300010375 Bacteria 8169
74 Ga0105239_10016997 3300010375 Bacteria 8042
75 Ga0105239_10140586 3300010375 Bacteria 2690
76 Ga0105239_10183439 3300010375 Bacteria 2342
77 Ga0157373_10000090 3300013100 Bacteria 78142
78 Ga0157373_10000532 3300013100 Bacteria 29743
79 Ga0157373_10092738 3300013100 Bacteria 2127
80 Ga0157371_10000229 3300013102 Bacteria 81458
81 Ga0157371_10002564 3300013102 Bacteria 17239
82 Ga0157371_10015460 3300013102 Bacteria 5723
83 Ga0157371_10125938 3300013102 Bacteria 1822
84 Ga0157370_10005172 3300013104 Bacteria 14712
85 Ga0157370_10045019 3300013104 Bacteria 4236
86 Ga0157370_10054151 3300013104 Bacteria 3825
87 Ga0157369_10008306 3300013105 Bacteria 11899
88 Ga0157369_10010929 3300013105 Bacteria 10335
89 Ga0157369_10063551 3300013105 Bacteria 3976
90 Ga0157369_10183663 3300013105 Bacteria 2200
91 Ga0157374_10005504 3300013296 Bacteria 10638
92 Ga0157374_10018760 3300013296 Bacteria 6112
93 Ga0157374_10034986 3300013296 Bacteria 4593
94 Ga0157374_10043185 3300013296 Bacteria 4163
95 Ga0163162_10000008 3300013306 Bacteria 316194
96 Ga0163162_10027685 3300013306 Bacteria 5607
97 Ga0157372_10000030 3300013307 Bacteria 179925
98 Ga0157372_10000051 3300013307 Bacteria 136437
99 Ga0157372_10005098 3300013307 Bacteria 13965
100 Ga0157372_10011192 3300013307 Bacteria 9541
101 Ga0157372_10063890 3300013307 Bacteria 4129
102 Ga0157375_10030864 3300013308 Bacteria 5059
103 Ga0182008_10000021 3300014497 Bacteria 227140
104 Ga0157377_10004775 3300014745 Bacteria 6281
105 Ga0182006_1008128 3300015261 Bacteria 4761
106 Ga0163161_10001003 3300017792 Bacteria 21495
107 Ga0163161_10040698 3300017792 Bacteria 3338
108 Ga0213872_10022635 3300021361 Bacteria 2894
109 Ga0207427_101581 3300025231 Bacteria 7846
110 Ga0209437_100134 3300025233 Bacteria 178305
111 Ga0209437_100526 3300025233 Bacteria 26615
112 Ga0209026_1000404 3300025250 Bacteria 38293
113 Ga0209026_1003477 3300025250 Bacteria 5129
114 Ga0209026_1003524 3300025250 Bacteria 5077
115 Ga0209233_1000457 3300025261 Bacteria 26631
116 Ga0209233_1000830 3300025261 Bacteria 13677
117 Ga0209455_1001675 3300025272 Bacteria 9530
118 Ga0207647_10000518 3300025904 Bacteria 30784
119 Ga0207647_10001675 3300025904 Bacteria 17061
120 Ga0207645_10000099 3300025907 Bacteria 64087
121 Ga0207705_10000053 3300025909 Bacteria 162124
122 Ga0207654_10052701 3300025911 Bacteria 2346
123 Ga0207707_10009683 3300025912 Bacteria 8359
124 Ga0207695_10000053 3300025913 Bacteria 396740
125 Ga0207695_10006779 3300025913 Bacteria 14762
126 Ga0207695_10024259 3300025913 Bacteria 6829
127 Ga0207695_10045882 3300025913 Bacteria 4635
128 Ga0207671_10003312 3300025914 Bacteria 16189
129 Ga0207671_10003479 3300025914 Bacteria 15662
130 Ga0207671_10006696 3300025914 Bacteria 10206
131 Ga0207671_10012793 3300025914 Bacteria 6726
132 Ga0207671_10052940 3300025914 Bacteria 3008
133 Ga0207671_10059378 3300025914 Bacteria 2836
134 Ga0207657_10158362 3300025919 Bacteria 1840
135 Ga0207652_10175629 3300025921 Bacteria 1924
136 Ga0207694_10013507 3300025924 Bacteria 6151
137 Ga0207694_10046711 3300025924 Bacteria 3347
138 Ga0207644_10014517 3300025931 Bacteria 5269
139 Ga0207706_10000138 3300025933 Bacteria 79643
140 Ga0207704_10000015 3300025938 Bacteria 163572
141 Ga0207667_10000346 3300025949 Bacteria 63247
142 Ga0207667_10000496 3300025949 Bacteria 51954
143 Ga0207667_10035193 3300025949 Bacteria 5373
144 Ga0207667_10120307 3300025949 Bacteria 2706
145 Ga0207667_10156859 3300025949 Bacteria 2342
146 Ga0207651_10005112 3300025960 Bacteria 6698
147 Ga0207703_10054719 3300026035 Bacteria 3246
148 Ga0207639_10031776 3300026041 Bacteria 3882
149 Ga0207702_10000601 3300026078 Bacteria 39835
150 Ga0207702_10082817 3300026078 Bacteria 2790
151 Ga0207648_10000888 3300026089 Bacteria 33713
152 Ga0207698_10013622 3300026142 Bacteria 5374
153 Ga0268266_10000098 3300028379 Bacteria 182784
154 Ga0307517_10001604 3300028786 Bacteria 37610
155 Ga0307515_10000938 3300028794 Bacteria 66865
156 Ga0307515_10002894 3300028794 Bacteria 36474
157 Ga0307515_10038572 3300028794 Bacteria 7636
158 Ga0307515_10128911 3300028794 Bacteria 2802
159 Ga0265338_10040496 3300028800 Bacteria 4376
160 Ga0307509_10069395 3300031507 Bacteria 3684
161 Ga0307408_100000839 3300031548 Bacteria 24299
162 Ga0307408_100002133 3300031548 Bacteria 14190
163 Ga0307408_100002139 3300031548 Bacteria 14161
164 Ga0307408_100002260 3300031548 Bacteria 13722
165 Ga0307408_100002335 3300031548 Bacteria 13423
166 Ga0307412_10000111 3300031911 Bacteria 64380
167 Ga0307412_10001501 3300031911 Bacteria 12959
168 Ga0307412_10002589 3300031911 Bacteria 10051
169 Ga0307414_10013579 3300032004 Bacteria 4854
170 Ga0307414_10015811 3300032004 Bacteria 4568
171 Ga0307414_10069849 3300032004 Bacteria 2527
172 Ga0307411_10092093 3300032005 Bacteria 2119
173 Ga0307507_10002401 3300033179 Bacteria 39546
174 Ga0307510_10004763 3300033180 Bacteria 16053
175 Ga0395899_0000034 3300037312 Bacteria 302623
176 Ga0395899_0000394 3300037312 Bacteria 51861
177 Ga0395899_0019464 3300037312 Bacteria 5156
178 Ga0395899_0044414 3300037312 Bacteria 3311
179 Ga0395900_0001213 3300037418 Bacteria 31865
180 Ga0395900_0007977 3300037418 Bacteria 10896
181 Ga0395898_0099480 3300037466 Bacteria 2793
182 Ga0395905_0033086 3300037471 Bacteria 4860
183 Ga0395905_0148607 3300037471 Bacteria 2204
184 Ga0395901_0001041 3300038443 Bacteria 29939
185 Ga0436361_0995481 3300039447 Bacteria 23100
186 Ga0466958_0100483 3300045836 Bacteria 1798
187 Ga0466967_0172284 3300045976 Unclassified 2037
188 Ga0495650_0000144 3300046471 Bacteria 165957
189 Ga0495650_0015368 3300046471 Bacteria 3928
190 Ga0495585_0001009 3300046492 Bacteria 23453
191 Ga0495585_0001555 3300046492 Bacteria 17794
192 Ga0495583_0032209 3300046506 Bacteria 2532
193 Ga0495606_0000926 3300046507 Bacteria 43259
194 Ga0495606_0034489 3300046507 Bacteria 3474
195 Ga0495606_0040445 3300046507 Bacteria 3134
196 Ga0495610_0010124 3300046512 Bacteria 5887
197 Ga0495616_0000800 3300046513 Bacteria 23049
198 Ga0495616_0003454 3300046513 Bacteria 10109
199 Ga0495631_0001962 3300046518 Bacteria 12054
200 Ga0495648_0003404 3300046524 Bacteria 13982
201 Ga0495648_0025906 3300046524 Bacteria 3960
202 Ga0495609_0011314 3300046538 Bacteria 4252
203 Ga0495609_0012270 3300046538 Bacteria 4064
204 Ga0495622_0026721 3300046557 Bacteria 2694
205 Ga0495633_0000026 3300046558 Bacteria 204722
206 Ga0495633_0007700 3300046558 Bacteria 6163
207 Ga0495668_0000179 3300046616 Bacteria 94559
208 Ga0495625_0000059 3300046660 Bacteria 180330
209 Ga0495625_0000261 3300046660 Bacteria 82028
210 Ga0495625_0007489 3300046660 Bacteria 9490
211 Ga0495625_0019504 3300046660 Bacteria 5259
212 Ga0495625_0020930 3300046660 Bacteria 5042
213 Ga0495625_0061361 3300046660 Bacteria 2661
214 Ga0495661_0001482 3300046665 Bacteria 19585
215 Ga0495661_0002941 3300046665 Bacteria 12871
216 Ga0495661_0033691 3300046665 Bacteria 3229
217 Ga0495658_0054605 3300046683 Bacteria 2273
218 Ga0495671_0085028 3300046692 Bacteria 1550
219 Ga0495649_0000031 3300046694 Bacteria 151547
220 Ga0495660_0017864 3300046810 Bacteria 4080
221 Ga0495683_0029439 3300047323 Bacteria 2807
222 Ga0495687_000233 3300047443 Bacteria 77056
223 Ga0495687_001478 3300047443 Bacteria 21499
224 Ga0495686_0000112 3300047472 Bacteria 168354
225 Ga0495686_0002835 3300047472 Bacteria 15667
226 Ga0495686_0020077 3300047472 Bacteria 4458
227 Ga0496104_0076734 3300048907 Bacteria 3183
228 Ga0496116_0004437 3300048919 Bacteria 13391
229 Ga0495678_032559 3300049459 Bacteria 2159
230 Ga0501034_0178050 3300049571 Bacteria 2092
231 Ga0501043_0059645 3300049579 Bacteria 2995
232 nmdc:mga0k408_624_c1 3300050493 Bacteria 19515
233 Ga0500635_0000830 3300053080 Bacteria 7626
234 Ga0500608_000300 3300053122 Bacteria 19116
235 Ga0500618_000424 3300053125 Bacteria 28474
236 Ga0500624_000133 3300053157 Bacteria 32143
237 2599481702 2599185184 Bacteria 6430550
238 2599481703 2599185184 Bacteria 6430550
239 2722727527 2721755487 Bacteria 6357185
240 2738759424 2738541283 Bacteria 7222293
241 2738764025 2738541284 Bacteria 5199923
242 2740031765 2739367866 Bacteria 4215900
243 2776616387 2775506987 Bacteria 5373360
244 2852625237 2852623160 Bacteria 4376875
245 2884934251 2884933994 Bacteria 4535041
246 2904781725 2904780799 Bacteria 5840761
247 2919440333 2919437846 Bacteria 6199444
248 2919440334 2919437846 Bacteria 6199444
249 2928082189 2928078545 Bacteria 6534839
250 2928082190 2928078545 Bacteria 6534839
251 2928149236 2928147474 Bacteria 6512076
252 2928149237 2928147474 Bacteria 6512076
253 2932087703 2932082852 Bacteria 6563563
254 2932087704 2932082852 Bacteria 6563563
255 2977234357 2977232053 Bacteria 5485925
256 Ga0105240_10000082
257 SwRhRL2b_contig_765205
258 JGI24739J22299_10009501
259 JGI24737J22298_10000884
260 JGI24735J21928_10000015
261 JGI25162J39368_1000299
262 JGI25162J39368_1002939
263 JGI25165J46597_1003110
264 rootH1_10025995
265 rootH2_10001535
266 rootL2_10108394
267 rootH1_10005241
268 rootH1_10097375
269 Ga0058863_10082638
270 Ga0065714_10003879
271 Ga0065714_10066602
272 Ga0065714_10067130
273 Ga0065704_10000276
274 Ga0065704_10000533
275 Ga0070658_10000027
276 Ga0070676_10028382
277 Ga0070676_10063143
278 Ga0070666_10017389
279 Ga0068868_100083161
280 Ga0070660_100071442
281 Ga0070669_100014214
282 Ga0070671_100010314
283 Ga0070673_100005531
284 Ga0070678_100031674
285 Ga0070662_100000281
286 Ga0070681_10016220
287 Ga0068867_100011623
288 Ga0070706_100040570
289 Ga0070698_100079240
290 Ga0070679_100030191
291 Ga0070679_100053041
292 Ga0068853_100012176
293 Ga0070665_100000178
294 Ga0068855_100000149
295 Ga0068855_100000279
296 Ga0068855_100009685
297 Ga0068855_100023352
298 Ga0068855_100046782
299 Ga0068855_100071204
300 Ga0068855_100259563
301 Ga0068856_100000398
302 Ga0068852_100006508
303 Ga0068858_100091793
304 Ga0081455_10017032
305 Ga0081539_10002105
306 Ga0075366_10000793
307 Ga0097621_100002043
308 Ga0068871_100011861
309 Ga0068865_100000129
310 Ga0105240_10007435
311 Ga0105240_10051370
312 Ga0105240_10068622
313 Ga0105240_10129529
314 Ga0105240_10185544
315 Ga0105240_10232893
316 Ga0114129_10110884
317 Ga0105243_10066605
318 Ga0105241_10012883
319 Ga0105237_10003216
320 Ga0105237_10003917
321 Ga0105237_10007226
322 Ga0105237_10007416
323 Ga0105237_10061250
324 Ga0105239_10000015
325 Ga0105239_10000115
326 Ga0105239_10003070
327 Ga0105239_10005378
328 Ga0105239_10016495
329 Ga0105239_10016997
330 Ga0105239_10140586
331 Ga0105239_10183439
332 Ga0157373_10000090
333 Ga0157373_10000532
334 Ga0157373_10092738
335 Ga0157371_10000229
336 Ga0157371_10002564
337 Ga0157371_10015460
338 Ga0157371_10125938
339 Ga0157370_10005172
340 Ga0157370_10045019
341 Ga0157370_10054151
342 Ga0157369_10008306
343 Ga0157369_10010929
344 Ga0157369_10063551
345 Ga0157369_10183663
346 Ga0157374_10005504
347 Ga0157374_10018760
348 Ga0157374_10034986
349 Ga0157374_10043185
350 Ga0163162_10000008
351 Ga0163162_10027685
352 Ga0157372_10000030
353 Ga0157372_10000051
354 Ga0157372_10005098
355 Ga0157372_10011192
356 Ga0157372_10063890
357 Ga0157375_10030864
358 Ga0182008_10000021
359 Ga0157377_10004775
360 Ga0182006_1008128
361 Ga0163161_10001003
362 Ga0163161_10040698
363 Ga0213872_10022635
364 Ga0207427_101581
365 Ga0209437_100134
366 Ga0209437_100526
367 Ga0209026_1000404
368 Ga0209026_1003477
369 Ga0209026_1003524
370 Ga0209233_1000457
371 Ga0209233_1000830
372 Ga0209455_1001675
373 Ga0207647_10000518
374 Ga0207647_10001675
375 Ga0207645_10000099
376 Ga0207705_10000053
377 Ga0207654_10052701
378 Ga0207707_10009683
379 Ga0207695_10000053
380 Ga0207695_10006779
381 Ga0207695_10024259
382 Ga0207695_10045882
383 Ga0207671_10003312
384 Ga0207671_10003479
385 Ga0207671_10006696
386 Ga0207671_10012793
387 Ga0207671_10052940
388 Ga0207671_10059378
389 Ga0207657_10158362
390 Ga0207652_10175629
391 Ga0207694_10013507
392 Ga0207694_10046711
393 Ga0207644_10014517
394 Ga0207706_10000138
395 Ga0207704_10000015
396 Ga0207667_10000346
397 Ga0207667_10000496
398 Ga0207667_10035193
399 Ga0207667_10120307
400 Ga0207667_10156859
401 Ga0207651_10005112
402 Ga0207703_10054719
403 Ga0207639_10031776
404 Ga0207702_10000601
405 Ga0207702_10082817
406 Ga0207648_10000888
407 Ga0207698_10013622
408 Ga0268266_10000098
409 Ga0307517_10001604
410 Ga0307515_10000938
411 Ga0307515_10002894
412 Ga0307515_10038572
413 Ga0307515_10128911
414 Ga0265338_10040496
415 Ga0307509_10069395
416 Ga0307408_100000839
417 Ga0307408_100002133
418 Ga0307408_100002139
419 Ga0307408_100002260
420 Ga0307408_100002335
421 Ga0307412_10000111
422 Ga0307412_10001501
423 Ga0307412_10002589
424 Ga0307414_10013579
425 Ga0307414_10015811
426 Ga0307414_10069849
427 Ga0307411_10092093
428 Ga0307507_10002401
429 Ga0307510_10004763
430 Ga0395899_0000034
431 Ga0395899_0000394
432 Ga0395899_0019464
433 Ga0395899_0044414
434 Ga0395900_0001213
435 Ga0395900_0007977
436 Ga0395898_0099480
437 Ga0395905_0033086
438 Ga0395905_0148607
439 Ga0395901_0001041
440 Ga0436361_0995481
441 Ga0466958_0100483
442 Ga0466967_0172284
443 Ga0495650_0000144
444 Ga0495650_0015368
445 Ga0495585_0001009
446 Ga0495585_0001555
447 Ga0495583_0032209
448 Ga0495606_0000926
449 Ga0495606_0034489
450 Ga0495606_0040445
451 Ga0495610_0010124
452 Ga0495616_0000800
453 Ga0495616_0003454
454 Ga0495631_0001962
455 Ga0495648_0003404
456 Ga0495648_0025906
457 Ga0495609_0011314
458 Ga0495609_0012270
459 Ga0495622_0026721
460 Ga0495633_0000026
461 Ga0495633_0007700
462 Ga0495668_0000179
463 Ga0495625_0000059
464 Ga0495625_0000261
465 Ga0495625_0007489
466 Ga0495625_0019504
467 Ga0495625_0020930
468 Ga0495625_0061361
469 Ga0495661_0001482
470 Ga0495661_0002941
471 Ga0495661_0033691
472 Ga0495658_0054605
473 Ga0495671_0085028
474 Ga0495649_0000031
475 Ga0495660_0017864
476 Ga0495683_0029439
477 Ga0495687_000233
478 Ga0495687_001478
479 Ga0495686_0000112
480 Ga0495686_0002835
481 Ga0495686_0020077
482 Ga0496104_0076734
483 Ga0496116_0004437
484 Ga0495678_032559
485 Ga0501034_0178050
486 Ga0501043_0059645
487 nmdc:mga0k408_624_c1
488 Ga0500635_0000830
489 Ga0500608_000300
490 Ga0500618_000424
491 Ga0500624_000133
492 2599481702
493 2599481703
494 2722727527
495 2738759424
496 2738764025
497 2740031765
498 2776616387
499 2852625237
500 2884934251
501 2904781725
502 2919440333
503 2919440334
504 2928082189
505 2928082190
506 2928149236
507 2928149237
508 2932087703
509 2932087704
510 2977234357

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01433

Peptidase_M1

Peptidase family M1 domain

293

502

0.87

PF17900

Peptidase_M1_N

Peptidase M1 N-terminal domain

71

250

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ifg-assembly1.cif.gz_A crystal structure of m1 zinc metallopeptidase e323a mutant bound to tyr-ser-ala substrate from deinococcus radiodurans 0.8623 35 479
6a8z-assembly2.cif.gz_B crystal structure of m1 zinc metallopeptidase from deinococcus radiodurans 0.8586 46 479
6kp0-assembly2.cif.gz_B crystal structure of two domain m1 zinc metallopeptidase e323a mutant bound to l-arginine 0.8564 32 474
6ifg-assembly2.cif.gz_B crystal structure of m1 zinc metallopeptidase e323a mutant bound to tyr-ser-ala substrate from deinococcus radiodurans 0.8555 35 479
6kp0-assembly1.cif.gz_A crystal structure of two domain m1 zinc metallopeptidase e323a mutant bound to l-arginine 0.8533 46 474
ID Description Score Start End Superfamily
4pj6B01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.8881 44 233 2.60.40.1730
1gw6A01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.8667 46 233 2.60.40.1730
1z5hA01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.8582 47 233 2.60.40.1730
af_Q55CY7_5_208_2.60.40.1730 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.8545 45 233 2.60.40.1730
af_P37898_2_201_2.60.40.1730 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.8433 45 234 2.60.40.1730
ID Description Score Start End GO Terms
AF-A0A350YSD3-F1-model_v4 Peptidase M1 0.9894 28 362 GO:0046872
AF-A0A7Y5L864-F1-model_v4 M1 family peptidase 0.9887 25 223
AF-A0A418N395-F1-model_v4 M1 family peptidase 0.9886 24 551 GO:0008237
GO:0008270
AF-A0A3C0IW86-F1-model_v4 Peptidase M1 0.9884 240 488 GO:0008237
GO:0008270
AF-A0A3D2S6U5-F1-model_v4 Peptidase M1 0.9876 66 457 GO:0005615
GO:0005737
GO:0008270
GO:0016020
GO:0042277
GO:0043171
GO:0070006

Map