F407323
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 324 | 148 | 510 | 553 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10000082|Ga0105240_1000008217 |
| Length | 593 |
| Sequence | MFFAFIYPSLINFNTLTELTSLKMKLNRFLLILLGIFSLNAHAQLGQPKETFTKADTLRGNTHSPLRTCYDINYYHLDVKFDIDHKFISGSNLFKFTATQDFTKLQFDLFSNLKVEKVVYKGQEVPFKREFNAVFVTFPQPITKGSSDEFTVYYSGNPTEAVNAPWDGGVVFTTDSTGKPWVATACQGIGASIWWPNKDQQADEVDSALISISVPKGLKDVSNGRLRKVTNLKDGYTRFDWFVANPINNYDIEANIGDYTHFGDSYDGEKGKLTIDYWVLPYDLQKAKIHFGENVKRMLKSHEHWFGPYPFYEDGYKLIETPYLGMEHQSGTTYGNHFVNGYWTRDRGGIDLSNTGWGLKWDYIIIHESGHEWFGNNITSKDLADMWIHESFTDYSESLFVESYYGKQAGQEYVNGQRNGIANDRPIVGPYGVNKEGSEDMYAKGSVILNMIRTIINDDEKWRQVLRGLNKTFYHQTVTYNDITSYISKESGIDLSTVFEQYLRTASLPVLHIYQSRNKIYCMWTGCVPNFSMPVRIRVKGGEYKFFNPGSSNHNGVVRSRARAAEINLPGVNMDNIEVDTFNYYIGVLKNQM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 56 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 60 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 87 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 88 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 90 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 91 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 92 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 93 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 94 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 95 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 96 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 97 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 98 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 99 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 100 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 101 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 102 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 103 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 104 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 126 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 127 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 131 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 132 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 133 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 134 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 135 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 136 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 137 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 138 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 139 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 140 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 141 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 142 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 143 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 144 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 145 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 146 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 147 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 148 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.83 |
| Metatranscriptomes | 0.31 |
| Isolates | 5.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.17 |
| Nodule | 0 |
| Rhizoplane | 0.93 |
| Rhizosphere | 83.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10000082 | 3300009093 | Bacteria | 195184 |
| 2 | SwRhRL2b_contig_765205 | 2162886007 | Bacteria | 4740 |
| 3 | JGI24739J22299_10009501 | 3300001989 | Bacteria | 3624 |
| 4 | JGI24737J22298_10000884 | 3300001990 | Bacteria | 10697 |
| 5 | JGI24735J21928_10000015 | 3300002067 | Bacteria | 167231 |
| 6 | JGI25162J39368_1000299 | 3300002737 | Bacteria | 45585 |
| 7 | JGI25162J39368_1002939 | 3300002737 | Bacteria | 5760 |
| 8 | JGI25165J46597_1003110 | 3300003214 | Bacteria | 4443 |
| 9 | rootH1_10025995 | 3300003316 | Bacteria | 6228 |
| 10 | rootH2_10001535 | 3300003320 | Bacteria | 91957 |
| 11 | rootL2_10108394 | 3300003322 | Bacteria | 4497 |
| 12 | rootH1_10005241 | 3300003323 | Bacteria | 23232 |
| 13 | rootH1_10097375 | 3300003323 | Bacteria | 4378 |
| 14 | Ga0058863_10082638 | 3300004799 | Bacteria | 11326 |
| 15 | Ga0065714_10003879 | 3300005288 | Bacteria | 5893 |
| 16 | Ga0065714_10066602 | 3300005288 | Bacteria | 6560 |
| 17 | Ga0065714_10067130 | 3300005288 | Bacteria | 5848 |
| 18 | Ga0065704_10000276 | 3300005289 | Bacteria | 41922 |
| 19 | Ga0065704_10000533 | 3300005289 | Bacteria | 17263 |
| 20 | Ga0070658_10000027 | 3300005327 | Bacteria | 164254 |
| 21 | Ga0070676_10028382 | 3300005328 | Bacteria | 3178 |
| 22 | Ga0070676_10063143 | 3300005328 | Bacteria | 2205 |
| 23 | Ga0070666_10017389 | 3300005335 | Unclassified | 4610 |
| 24 | Ga0068868_100083161 | 3300005338 | Bacteria | 2569 |
| 25 | Ga0070660_100071442 | 3300005339 | Bacteria | 2710 |
| 26 | Ga0070669_100014214 | 3300005353 | Bacteria | 5665 |
| 27 | Ga0070671_100010314 | 3300005355 | Bacteria | 7495 |
| 28 | Ga0070673_100005531 | 3300005364 | Bacteria | 8098 |
| 29 | Ga0070678_100031674 | 3300005456 | Bacteria | 3652 |
| 30 | Ga0070662_100000281 | 3300005457 | Bacteria | 30079 |
| 31 | Ga0070681_10016220 | 3300005458 | Bacteria | 7430 |
| 32 | Ga0068867_100011623 | 3300005459 | Bacteria | 6215 |
| 33 | Ga0070706_100040570 | 3300005467 | Bacteria | 4297 |
| 34 | Ga0070698_100079240 | 3300005471 | Bacteria | 3282 |
| 35 | Ga0070679_100030191 | 3300005530 | Bacteria | 5351 |
| 36 | Ga0070679_100053041 | 3300005530 | Bacteria | 4037 |
| 37 | Ga0068853_100012176 | 3300005539 | Bacteria | 6995 |
| 38 | Ga0070665_100000178 | 3300005548 | Bacteria | 113002 |
| 39 | Ga0068855_100000149 | 3300005563 | Bacteria | 89273 |
| 40 | Ga0068855_100000279 | 3300005563 | Bacteria | 63112 |
| 41 | Ga0068855_100009685 | 3300005563 | Bacteria | 11631 |
| 42 | Ga0068855_100023352 | 3300005563 | Bacteria | 7406 |
| 43 | Ga0068855_100046782 | 3300005563 | Bacteria | 5113 |
| 44 | Ga0068855_100071204 | 3300005563 | Bacteria | 4044 |
| 45 | Ga0068855_100259563 | 3300005563 | Bacteria | 1936 |
| 46 | Ga0068856_100000398 | 3300005614 | Bacteria | 47604 |
| 47 | Ga0068852_100006508 | 3300005616 | Bacteria | 8446 |
| 48 | Ga0068858_100091793 | 3300005842 | Bacteria | 2826 |
| 49 | Ga0081455_10017032 | 3300005937 | Bacteria | 6986 |
| 50 | Ga0081539_10002105 | 3300005985 | Bacteria | 29514 |
| 51 | Ga0075366_10000793 | 3300006195 | Bacteria | 15127 |
| 52 | Ga0097621_100002043 | 3300006237 | Bacteria | 13804 |
| 53 | Ga0068871_100011861 | 3300006358 | Bacteria | 6409 |
| 54 | Ga0068865_100000129 | 3300006881 | Bacteria | 39057 |
| 55 | Ga0105240_10007435 | 3300009093 | Bacteria | 15910 |
| 56 | Ga0105240_10051370 | 3300009093 | Bacteria | 5188 |
| 57 | Ga0105240_10068622 | 3300009093 | Bacteria | 4391 |
| 58 | Ga0105240_10129529 | 3300009093 | Bacteria | 3028 |
| 59 | Ga0105240_10185544 | 3300009093 | Bacteria | 2450 |
| 60 | Ga0105240_10232893 | 3300009093 | Bacteria | 2139 |
| 61 | Ga0114129_10110884 | 3300009147 | Bacteria | 3787 |
| 62 | Ga0105243_10066605 | 3300009148 | Bacteria | 2897 |
| 63 | Ga0105241_10012883 | 3300009174 | Bacteria | 6136 |
| 64 | Ga0105237_10003216 | 3300009545 | Bacteria | 19562 |
| 65 | Ga0105237_10003917 | 3300009545 | Bacteria | 17439 |
| 66 | Ga0105237_10007226 | 3300009545 | Bacteria | 12185 |
| 67 | Ga0105237_10007416 | 3300009545 | Bacteria | 12011 |
| 68 | Ga0105237_10061250 | 3300009545 | Bacteria | 3763 |
| 69 | Ga0105239_10000015 | 3300010375 | Bacteria | 319892 |
| 70 | Ga0105239_10000115 | 3300010375 | Bacteria | 113217 |
| 71 | Ga0105239_10003070 | 3300010375 | Bacteria | 20752 |
| 72 | Ga0105239_10005378 | 3300010375 | Bacteria | 15038 |
| 73 | Ga0105239_10016495 | 3300010375 | Bacteria | 8169 |
| 74 | Ga0105239_10016997 | 3300010375 | Bacteria | 8042 |
| 75 | Ga0105239_10140586 | 3300010375 | Bacteria | 2690 |
| 76 | Ga0105239_10183439 | 3300010375 | Bacteria | 2342 |
| 77 | Ga0157373_10000090 | 3300013100 | Bacteria | 78142 |
| 78 | Ga0157373_10000532 | 3300013100 | Bacteria | 29743 |
| 79 | Ga0157373_10092738 | 3300013100 | Bacteria | 2127 |
| 80 | Ga0157371_10000229 | 3300013102 | Bacteria | 81458 |
| 81 | Ga0157371_10002564 | 3300013102 | Bacteria | 17239 |
| 82 | Ga0157371_10015460 | 3300013102 | Bacteria | 5723 |
| 83 | Ga0157371_10125938 | 3300013102 | Bacteria | 1822 |
| 84 | Ga0157370_10005172 | 3300013104 | Bacteria | 14712 |
| 85 | Ga0157370_10045019 | 3300013104 | Bacteria | 4236 |
| 86 | Ga0157370_10054151 | 3300013104 | Bacteria | 3825 |
| 87 | Ga0157369_10008306 | 3300013105 | Bacteria | 11899 |
| 88 | Ga0157369_10010929 | 3300013105 | Bacteria | 10335 |
| 89 | Ga0157369_10063551 | 3300013105 | Bacteria | 3976 |
| 90 | Ga0157369_10183663 | 3300013105 | Bacteria | 2200 |
| 91 | Ga0157374_10005504 | 3300013296 | Bacteria | 10638 |
| 92 | Ga0157374_10018760 | 3300013296 | Bacteria | 6112 |
| 93 | Ga0157374_10034986 | 3300013296 | Bacteria | 4593 |
| 94 | Ga0157374_10043185 | 3300013296 | Bacteria | 4163 |
| 95 | Ga0163162_10000008 | 3300013306 | Bacteria | 316194 |
| 96 | Ga0163162_10027685 | 3300013306 | Bacteria | 5607 |
| 97 | Ga0157372_10000030 | 3300013307 | Bacteria | 179925 |
| 98 | Ga0157372_10000051 | 3300013307 | Bacteria | 136437 |
| 99 | Ga0157372_10005098 | 3300013307 | Bacteria | 13965 |
| 100 | Ga0157372_10011192 | 3300013307 | Bacteria | 9541 |
| 101 | Ga0157372_10063890 | 3300013307 | Bacteria | 4129 |
| 102 | Ga0157375_10030864 | 3300013308 | Bacteria | 5059 |
| 103 | Ga0182008_10000021 | 3300014497 | Bacteria | 227140 |
| 104 | Ga0157377_10004775 | 3300014745 | Bacteria | 6281 |
| 105 | Ga0182006_1008128 | 3300015261 | Bacteria | 4761 |
| 106 | Ga0163161_10001003 | 3300017792 | Bacteria | 21495 |
| 107 | Ga0163161_10040698 | 3300017792 | Bacteria | 3338 |
| 108 | Ga0213872_10022635 | 3300021361 | Bacteria | 2894 |
| 109 | Ga0207427_101581 | 3300025231 | Bacteria | 7846 |
| 110 | Ga0209437_100134 | 3300025233 | Bacteria | 178305 |
| 111 | Ga0209437_100526 | 3300025233 | Bacteria | 26615 |
| 112 | Ga0209026_1000404 | 3300025250 | Bacteria | 38293 |
| 113 | Ga0209026_1003477 | 3300025250 | Bacteria | 5129 |
| 114 | Ga0209026_1003524 | 3300025250 | Bacteria | 5077 |
| 115 | Ga0209233_1000457 | 3300025261 | Bacteria | 26631 |
| 116 | Ga0209233_1000830 | 3300025261 | Bacteria | 13677 |
| 117 | Ga0209455_1001675 | 3300025272 | Bacteria | 9530 |
| 118 | Ga0207647_10000518 | 3300025904 | Bacteria | 30784 |
| 119 | Ga0207647_10001675 | 3300025904 | Bacteria | 17061 |
| 120 | Ga0207645_10000099 | 3300025907 | Bacteria | 64087 |
| 121 | Ga0207705_10000053 | 3300025909 | Bacteria | 162124 |
| 122 | Ga0207654_10052701 | 3300025911 | Bacteria | 2346 |
| 123 | Ga0207707_10009683 | 3300025912 | Bacteria | 8359 |
| 124 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 125 | Ga0207695_10006779 | 3300025913 | Bacteria | 14762 |
| 126 | Ga0207695_10024259 | 3300025913 | Bacteria | 6829 |
| 127 | Ga0207695_10045882 | 3300025913 | Bacteria | 4635 |
| 128 | Ga0207671_10003312 | 3300025914 | Bacteria | 16189 |
| 129 | Ga0207671_10003479 | 3300025914 | Bacteria | 15662 |
| 130 | Ga0207671_10006696 | 3300025914 | Bacteria | 10206 |
| 131 | Ga0207671_10012793 | 3300025914 | Bacteria | 6726 |
| 132 | Ga0207671_10052940 | 3300025914 | Bacteria | 3008 |
| 133 | Ga0207671_10059378 | 3300025914 | Bacteria | 2836 |
| 134 | Ga0207657_10158362 | 3300025919 | Bacteria | 1840 |
| 135 | Ga0207652_10175629 | 3300025921 | Bacteria | 1924 |
| 136 | Ga0207694_10013507 | 3300025924 | Bacteria | 6151 |
| 137 | Ga0207694_10046711 | 3300025924 | Bacteria | 3347 |
| 138 | Ga0207644_10014517 | 3300025931 | Bacteria | 5269 |
| 139 | Ga0207706_10000138 | 3300025933 | Bacteria | 79643 |
| 140 | Ga0207704_10000015 | 3300025938 | Bacteria | 163572 |
| 141 | Ga0207667_10000346 | 3300025949 | Bacteria | 63247 |
| 142 | Ga0207667_10000496 | 3300025949 | Bacteria | 51954 |
| 143 | Ga0207667_10035193 | 3300025949 | Bacteria | 5373 |
| 144 | Ga0207667_10120307 | 3300025949 | Bacteria | 2706 |
| 145 | Ga0207667_10156859 | 3300025949 | Bacteria | 2342 |
| 146 | Ga0207651_10005112 | 3300025960 | Bacteria | 6698 |
| 147 | Ga0207703_10054719 | 3300026035 | Bacteria | 3246 |
| 148 | Ga0207639_10031776 | 3300026041 | Bacteria | 3882 |
| 149 | Ga0207702_10000601 | 3300026078 | Bacteria | 39835 |
| 150 | Ga0207702_10082817 | 3300026078 | Bacteria | 2790 |
| 151 | Ga0207648_10000888 | 3300026089 | Bacteria | 33713 |
| 152 | Ga0207698_10013622 | 3300026142 | Bacteria | 5374 |
| 153 | Ga0268266_10000098 | 3300028379 | Bacteria | 182784 |
| 154 | Ga0307517_10001604 | 3300028786 | Bacteria | 37610 |
| 155 | Ga0307515_10000938 | 3300028794 | Bacteria | 66865 |
| 156 | Ga0307515_10002894 | 3300028794 | Bacteria | 36474 |
| 157 | Ga0307515_10038572 | 3300028794 | Bacteria | 7636 |
| 158 | Ga0307515_10128911 | 3300028794 | Bacteria | 2802 |
| 159 | Ga0265338_10040496 | 3300028800 | Bacteria | 4376 |
| 160 | Ga0307509_10069395 | 3300031507 | Bacteria | 3684 |
| 161 | Ga0307408_100000839 | 3300031548 | Bacteria | 24299 |
| 162 | Ga0307408_100002133 | 3300031548 | Bacteria | 14190 |
| 163 | Ga0307408_100002139 | 3300031548 | Bacteria | 14161 |
| 164 | Ga0307408_100002260 | 3300031548 | Bacteria | 13722 |
| 165 | Ga0307408_100002335 | 3300031548 | Bacteria | 13423 |
| 166 | Ga0307412_10000111 | 3300031911 | Bacteria | 64380 |
| 167 | Ga0307412_10001501 | 3300031911 | Bacteria | 12959 |
| 168 | Ga0307412_10002589 | 3300031911 | Bacteria | 10051 |
| 169 | Ga0307414_10013579 | 3300032004 | Bacteria | 4854 |
| 170 | Ga0307414_10015811 | 3300032004 | Bacteria | 4568 |
| 171 | Ga0307414_10069849 | 3300032004 | Bacteria | 2527 |
| 172 | Ga0307411_10092093 | 3300032005 | Bacteria | 2119 |
| 173 | Ga0307507_10002401 | 3300033179 | Bacteria | 39546 |
| 174 | Ga0307510_10004763 | 3300033180 | Bacteria | 16053 |
| 175 | Ga0395899_0000034 | 3300037312 | Bacteria | 302623 |
| 176 | Ga0395899_0000394 | 3300037312 | Bacteria | 51861 |
| 177 | Ga0395899_0019464 | 3300037312 | Bacteria | 5156 |
| 178 | Ga0395899_0044414 | 3300037312 | Bacteria | 3311 |
| 179 | Ga0395900_0001213 | 3300037418 | Bacteria | 31865 |
| 180 | Ga0395900_0007977 | 3300037418 | Bacteria | 10896 |
| 181 | Ga0395898_0099480 | 3300037466 | Bacteria | 2793 |
| 182 | Ga0395905_0033086 | 3300037471 | Bacteria | 4860 |
| 183 | Ga0395905_0148607 | 3300037471 | Bacteria | 2204 |
| 184 | Ga0395901_0001041 | 3300038443 | Bacteria | 29939 |
| 185 | Ga0436361_0995481 | 3300039447 | Bacteria | 23100 |
| 186 | Ga0466958_0100483 | 3300045836 | Bacteria | 1798 |
| 187 | Ga0466967_0172284 | 3300045976 | Unclassified | 2037 |
| 188 | Ga0495650_0000144 | 3300046471 | Bacteria | 165957 |
| 189 | Ga0495650_0015368 | 3300046471 | Bacteria | 3928 |
| 190 | Ga0495585_0001009 | 3300046492 | Bacteria | 23453 |
| 191 | Ga0495585_0001555 | 3300046492 | Bacteria | 17794 |
| 192 | Ga0495583_0032209 | 3300046506 | Bacteria | 2532 |
| 193 | Ga0495606_0000926 | 3300046507 | Bacteria | 43259 |
| 194 | Ga0495606_0034489 | 3300046507 | Bacteria | 3474 |
| 195 | Ga0495606_0040445 | 3300046507 | Bacteria | 3134 |
| 196 | Ga0495610_0010124 | 3300046512 | Bacteria | 5887 |
| 197 | Ga0495616_0000800 | 3300046513 | Bacteria | 23049 |
| 198 | Ga0495616_0003454 | 3300046513 | Bacteria | 10109 |
| 199 | Ga0495631_0001962 | 3300046518 | Bacteria | 12054 |
| 200 | Ga0495648_0003404 | 3300046524 | Bacteria | 13982 |
| 201 | Ga0495648_0025906 | 3300046524 | Bacteria | 3960 |
| 202 | Ga0495609_0011314 | 3300046538 | Bacteria | 4252 |
| 203 | Ga0495609_0012270 | 3300046538 | Bacteria | 4064 |
| 204 | Ga0495622_0026721 | 3300046557 | Bacteria | 2694 |
| 205 | Ga0495633_0000026 | 3300046558 | Bacteria | 204722 |
| 206 | Ga0495633_0007700 | 3300046558 | Bacteria | 6163 |
| 207 | Ga0495668_0000179 | 3300046616 | Bacteria | 94559 |
| 208 | Ga0495625_0000059 | 3300046660 | Bacteria | 180330 |
| 209 | Ga0495625_0000261 | 3300046660 | Bacteria | 82028 |
| 210 | Ga0495625_0007489 | 3300046660 | Bacteria | 9490 |
| 211 | Ga0495625_0019504 | 3300046660 | Bacteria | 5259 |
| 212 | Ga0495625_0020930 | 3300046660 | Bacteria | 5042 |
| 213 | Ga0495625_0061361 | 3300046660 | Bacteria | 2661 |
| 214 | Ga0495661_0001482 | 3300046665 | Bacteria | 19585 |
| 215 | Ga0495661_0002941 | 3300046665 | Bacteria | 12871 |
| 216 | Ga0495661_0033691 | 3300046665 | Bacteria | 3229 |
| 217 | Ga0495658_0054605 | 3300046683 | Bacteria | 2273 |
| 218 | Ga0495671_0085028 | 3300046692 | Bacteria | 1550 |
| 219 | Ga0495649_0000031 | 3300046694 | Bacteria | 151547 |
| 220 | Ga0495660_0017864 | 3300046810 | Bacteria | 4080 |
| 221 | Ga0495683_0029439 | 3300047323 | Bacteria | 2807 |
| 222 | Ga0495687_000233 | 3300047443 | Bacteria | 77056 |
| 223 | Ga0495687_001478 | 3300047443 | Bacteria | 21499 |
| 224 | Ga0495686_0000112 | 3300047472 | Bacteria | 168354 |
| 225 | Ga0495686_0002835 | 3300047472 | Bacteria | 15667 |
| 226 | Ga0495686_0020077 | 3300047472 | Bacteria | 4458 |
| 227 | Ga0496104_0076734 | 3300048907 | Bacteria | 3183 |
| 228 | Ga0496116_0004437 | 3300048919 | Bacteria | 13391 |
| 229 | Ga0495678_032559 | 3300049459 | Bacteria | 2159 |
| 230 | Ga0501034_0178050 | 3300049571 | Bacteria | 2092 |
| 231 | Ga0501043_0059645 | 3300049579 | Bacteria | 2995 |
| 232 | nmdc:mga0k408_624_c1 | 3300050493 | Bacteria | 19515 |
| 233 | Ga0500635_0000830 | 3300053080 | Bacteria | 7626 |
| 234 | Ga0500608_000300 | 3300053122 | Bacteria | 19116 |
| 235 | Ga0500618_000424 | 3300053125 | Bacteria | 28474 |
| 236 | Ga0500624_000133 | 3300053157 | Bacteria | 32143 |
| 237 | 2599481702 | 2599185184 | Bacteria | 6430550 |
| 238 | 2599481703 | 2599185184 | Bacteria | 6430550 |
| 239 | 2722727527 | 2721755487 | Bacteria | 6357185 |
| 240 | 2738759424 | 2738541283 | Bacteria | 7222293 |
| 241 | 2738764025 | 2738541284 | Bacteria | 5199923 |
| 242 | 2740031765 | 2739367866 | Bacteria | 4215900 |
| 243 | 2776616387 | 2775506987 | Bacteria | 5373360 |
| 244 | 2852625237 | 2852623160 | Bacteria | 4376875 |
| 245 | 2884934251 | 2884933994 | Bacteria | 4535041 |
| 246 | 2904781725 | 2904780799 | Bacteria | 5840761 |
| 247 | 2919440333 | 2919437846 | Bacteria | 6199444 |
| 248 | 2919440334 | 2919437846 | Bacteria | 6199444 |
| 249 | 2928082189 | 2928078545 | Bacteria | 6534839 |
| 250 | 2928082190 | 2928078545 | Bacteria | 6534839 |
| 251 | 2928149236 | 2928147474 | Bacteria | 6512076 |
| 252 | 2928149237 | 2928147474 | Bacteria | 6512076 |
| 253 | 2932087703 | 2932082852 | Bacteria | 6563563 |
| 254 | 2932087704 | 2932082852 | Bacteria | 6563563 |
| 255 | 2977234357 | 2977232053 | Bacteria | 5485925 |
| 256 | Ga0105240_10000082 | |||
| 257 | SwRhRL2b_contig_765205 | |||
| 258 | JGI24739J22299_10009501 | |||
| 259 | JGI24737J22298_10000884 | |||
| 260 | JGI24735J21928_10000015 | |||
| 261 | JGI25162J39368_1000299 | |||
| 262 | JGI25162J39368_1002939 | |||
| 263 | JGI25165J46597_1003110 | |||
| 264 | rootH1_10025995 | |||
| 265 | rootH2_10001535 | |||
| 266 | rootL2_10108394 | |||
| 267 | rootH1_10005241 | |||
| 268 | rootH1_10097375 | |||
| 269 | Ga0058863_10082638 | |||
| 270 | Ga0065714_10003879 | |||
| 271 | Ga0065714_10066602 | |||
| 272 | Ga0065714_10067130 | |||
| 273 | Ga0065704_10000276 | |||
| 274 | Ga0065704_10000533 | |||
| 275 | Ga0070658_10000027 | |||
| 276 | Ga0070676_10028382 | |||
| 277 | Ga0070676_10063143 | |||
| 278 | Ga0070666_10017389 | |||
| 279 | Ga0068868_100083161 | |||
| 280 | Ga0070660_100071442 | |||
| 281 | Ga0070669_100014214 | |||
| 282 | Ga0070671_100010314 | |||
| 283 | Ga0070673_100005531 | |||
| 284 | Ga0070678_100031674 | |||
| 285 | Ga0070662_100000281 | |||
| 286 | Ga0070681_10016220 | |||
| 287 | Ga0068867_100011623 | |||
| 288 | Ga0070706_100040570 | |||
| 289 | Ga0070698_100079240 | |||
| 290 | Ga0070679_100030191 | |||
| 291 | Ga0070679_100053041 | |||
| 292 | Ga0068853_100012176 | |||
| 293 | Ga0070665_100000178 | |||
| 294 | Ga0068855_100000149 | |||
| 295 | Ga0068855_100000279 | |||
| 296 | Ga0068855_100009685 | |||
| 297 | Ga0068855_100023352 | |||
| 298 | Ga0068855_100046782 | |||
| 299 | Ga0068855_100071204 | |||
| 300 | Ga0068855_100259563 | |||
| 301 | Ga0068856_100000398 | |||
| 302 | Ga0068852_100006508 | |||
| 303 | Ga0068858_100091793 | |||
| 304 | Ga0081455_10017032 | |||
| 305 | Ga0081539_10002105 | |||
| 306 | Ga0075366_10000793 | |||
| 307 | Ga0097621_100002043 | |||
| 308 | Ga0068871_100011861 | |||
| 309 | Ga0068865_100000129 | |||
| 310 | Ga0105240_10007435 | |||
| 311 | Ga0105240_10051370 | |||
| 312 | Ga0105240_10068622 | |||
| 313 | Ga0105240_10129529 | |||
| 314 | Ga0105240_10185544 | |||
| 315 | Ga0105240_10232893 | |||
| 316 | Ga0114129_10110884 | |||
| 317 | Ga0105243_10066605 | |||
| 318 | Ga0105241_10012883 | |||
| 319 | Ga0105237_10003216 | |||
| 320 | Ga0105237_10003917 | |||
| 321 | Ga0105237_10007226 | |||
| 322 | Ga0105237_10007416 | |||
| 323 | Ga0105237_10061250 | |||
| 324 | Ga0105239_10000015 | |||
| 325 | Ga0105239_10000115 | |||
| 326 | Ga0105239_10003070 | |||
| 327 | Ga0105239_10005378 | |||
| 328 | Ga0105239_10016495 | |||
| 329 | Ga0105239_10016997 | |||
| 330 | Ga0105239_10140586 | |||
| 331 | Ga0105239_10183439 | |||
| 332 | Ga0157373_10000090 | |||
| 333 | Ga0157373_10000532 | |||
| 334 | Ga0157373_10092738 | |||
| 335 | Ga0157371_10000229 | |||
| 336 | Ga0157371_10002564 | |||
| 337 | Ga0157371_10015460 | |||
| 338 | Ga0157371_10125938 | |||
| 339 | Ga0157370_10005172 | |||
| 340 | Ga0157370_10045019 | |||
| 341 | Ga0157370_10054151 | |||
| 342 | Ga0157369_10008306 | |||
| 343 | Ga0157369_10010929 | |||
| 344 | Ga0157369_10063551 | |||
| 345 | Ga0157369_10183663 | |||
| 346 | Ga0157374_10005504 | |||
| 347 | Ga0157374_10018760 | |||
| 348 | Ga0157374_10034986 | |||
| 349 | Ga0157374_10043185 | |||
| 350 | Ga0163162_10000008 | |||
| 351 | Ga0163162_10027685 | |||
| 352 | Ga0157372_10000030 | |||
| 353 | Ga0157372_10000051 | |||
| 354 | Ga0157372_10005098 | |||
| 355 | Ga0157372_10011192 | |||
| 356 | Ga0157372_10063890 | |||
| 357 | Ga0157375_10030864 | |||
| 358 | Ga0182008_10000021 | |||
| 359 | Ga0157377_10004775 | |||
| 360 | Ga0182006_1008128 | |||
| 361 | Ga0163161_10001003 | |||
| 362 | Ga0163161_10040698 | |||
| 363 | Ga0213872_10022635 | |||
| 364 | Ga0207427_101581 | |||
| 365 | Ga0209437_100134 | |||
| 366 | Ga0209437_100526 | |||
| 367 | Ga0209026_1000404 | |||
| 368 | Ga0209026_1003477 | |||
| 369 | Ga0209026_1003524 | |||
| 370 | Ga0209233_1000457 | |||
| 371 | Ga0209233_1000830 | |||
| 372 | Ga0209455_1001675 | |||
| 373 | Ga0207647_10000518 | |||
| 374 | Ga0207647_10001675 | |||
| 375 | Ga0207645_10000099 | |||
| 376 | Ga0207705_10000053 | |||
| 377 | Ga0207654_10052701 | |||
| 378 | Ga0207707_10009683 | |||
| 379 | Ga0207695_10000053 | |||
| 380 | Ga0207695_10006779 | |||
| 381 | Ga0207695_10024259 | |||
| 382 | Ga0207695_10045882 | |||
| 383 | Ga0207671_10003312 | |||
| 384 | Ga0207671_10003479 | |||
| 385 | Ga0207671_10006696 | |||
| 386 | Ga0207671_10012793 | |||
| 387 | Ga0207671_10052940 | |||
| 388 | Ga0207671_10059378 | |||
| 389 | Ga0207657_10158362 | |||
| 390 | Ga0207652_10175629 | |||
| 391 | Ga0207694_10013507 | |||
| 392 | Ga0207694_10046711 | |||
| 393 | Ga0207644_10014517 | |||
| 394 | Ga0207706_10000138 | |||
| 395 | Ga0207704_10000015 | |||
| 396 | Ga0207667_10000346 | |||
| 397 | Ga0207667_10000496 | |||
| 398 | Ga0207667_10035193 | |||
| 399 | Ga0207667_10120307 | |||
| 400 | Ga0207667_10156859 | |||
| 401 | Ga0207651_10005112 | |||
| 402 | Ga0207703_10054719 | |||
| 403 | Ga0207639_10031776 | |||
| 404 | Ga0207702_10000601 | |||
| 405 | Ga0207702_10082817 | |||
| 406 | Ga0207648_10000888 | |||
| 407 | Ga0207698_10013622 | |||
| 408 | Ga0268266_10000098 | |||
| 409 | Ga0307517_10001604 | |||
| 410 | Ga0307515_10000938 | |||
| 411 | Ga0307515_10002894 | |||
| 412 | Ga0307515_10038572 | |||
| 413 | Ga0307515_10128911 | |||
| 414 | Ga0265338_10040496 | |||
| 415 | Ga0307509_10069395 | |||
| 416 | Ga0307408_100000839 | |||
| 417 | Ga0307408_100002133 | |||
| 418 | Ga0307408_100002139 | |||
| 419 | Ga0307408_100002260 | |||
| 420 | Ga0307408_100002335 | |||
| 421 | Ga0307412_10000111 | |||
| 422 | Ga0307412_10001501 | |||
| 423 | Ga0307412_10002589 | |||
| 424 | Ga0307414_10013579 | |||
| 425 | Ga0307414_10015811 | |||
| 426 | Ga0307414_10069849 | |||
| 427 | Ga0307411_10092093 | |||
| 428 | Ga0307507_10002401 | |||
| 429 | Ga0307510_10004763 | |||
| 430 | Ga0395899_0000034 | |||
| 431 | Ga0395899_0000394 | |||
| 432 | Ga0395899_0019464 | |||
| 433 | Ga0395899_0044414 | |||
| 434 | Ga0395900_0001213 | |||
| 435 | Ga0395900_0007977 | |||
| 436 | Ga0395898_0099480 | |||
| 437 | Ga0395905_0033086 | |||
| 438 | Ga0395905_0148607 | |||
| 439 | Ga0395901_0001041 | |||
| 440 | Ga0436361_0995481 | |||
| 441 | Ga0466958_0100483 | |||
| 442 | Ga0466967_0172284 | |||
| 443 | Ga0495650_0000144 | |||
| 444 | Ga0495650_0015368 | |||
| 445 | Ga0495585_0001009 | |||
| 446 | Ga0495585_0001555 | |||
| 447 | Ga0495583_0032209 | |||
| 448 | Ga0495606_0000926 | |||
| 449 | Ga0495606_0034489 | |||
| 450 | Ga0495606_0040445 | |||
| 451 | Ga0495610_0010124 | |||
| 452 | Ga0495616_0000800 | |||
| 453 | Ga0495616_0003454 | |||
| 454 | Ga0495631_0001962 | |||
| 455 | Ga0495648_0003404 | |||
| 456 | Ga0495648_0025906 | |||
| 457 | Ga0495609_0011314 | |||
| 458 | Ga0495609_0012270 | |||
| 459 | Ga0495622_0026721 | |||
| 460 | Ga0495633_0000026 | |||
| 461 | Ga0495633_0007700 | |||
| 462 | Ga0495668_0000179 | |||
| 463 | Ga0495625_0000059 | |||
| 464 | Ga0495625_0000261 | |||
| 465 | Ga0495625_0007489 | |||
| 466 | Ga0495625_0019504 | |||
| 467 | Ga0495625_0020930 | |||
| 468 | Ga0495625_0061361 | |||
| 469 | Ga0495661_0001482 | |||
| 470 | Ga0495661_0002941 | |||
| 471 | Ga0495661_0033691 | |||
| 472 | Ga0495658_0054605 | |||
| 473 | Ga0495671_0085028 | |||
| 474 | Ga0495649_0000031 | |||
| 475 | Ga0495660_0017864 | |||
| 476 | Ga0495683_0029439 | |||
| 477 | Ga0495687_000233 | |||
| 478 | Ga0495687_001478 | |||
| 479 | Ga0495686_0000112 | |||
| 480 | Ga0495686_0002835 | |||
| 481 | Ga0495686_0020077 | |||
| 482 | Ga0496104_0076734 | |||
| 483 | Ga0496116_0004437 | |||
| 484 | Ga0495678_032559 | |||
| 485 | Ga0501034_0178050 | |||
| 486 | Ga0501043_0059645 | |||
| 487 | nmdc:mga0k408_624_c1 | |||
| 488 | Ga0500635_0000830 | |||
| 489 | Ga0500608_000300 | |||
| 490 | Ga0500618_000424 | |||
| 491 | Ga0500624_000133 | |||
| 492 | 2599481702 | |||
| 493 | 2599481703 | |||
| 494 | 2722727527 | |||
| 495 | 2738759424 | |||
| 496 | 2738764025 | |||
| 497 | 2740031765 | |||
| 498 | 2776616387 | |||
| 499 | 2852625237 | |||
| 500 | 2884934251 | |||
| 501 | 2904781725 | |||
| 502 | 2919440333 | |||
| 503 | 2919440334 | |||
| 504 | 2928082189 | |||
| 505 | 2928082190 | |||
| 506 | 2928149236 | |||
| 507 | 2928149237 | |||
| 508 | 2932087703 | |||
| 509 | 2932087704 | |||
| 510 | 2977234357 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ifg-assembly1.cif.gz_A | crystal structure of m1 zinc metallopeptidase e323a mutant bound to tyr-ser-ala substrate from deinococcus radiodurans | 0.8623 | 35 | 479 |
| 6a8z-assembly2.cif.gz_B | crystal structure of m1 zinc metallopeptidase from deinococcus radiodurans | 0.8586 | 46 | 479 |
| 6kp0-assembly2.cif.gz_B | crystal structure of two domain m1 zinc metallopeptidase e323a mutant bound to l-arginine | 0.8564 | 32 | 474 |
| 6ifg-assembly2.cif.gz_B | crystal structure of m1 zinc metallopeptidase e323a mutant bound to tyr-ser-ala substrate from deinococcus radiodurans | 0.8555 | 35 | 479 |
| 6kp0-assembly1.cif.gz_A | crystal structure of two domain m1 zinc metallopeptidase e323a mutant bound to l-arginine | 0.8533 | 46 | 474 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pj6B01 | Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain | 0.8881 | 44 | 233 | 2.60.40.1730 |
| 1gw6A01 | Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain | 0.8667 | 46 | 233 | 2.60.40.1730 |
| 1z5hA01 | Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain | 0.8582 | 47 | 233 | 2.60.40.1730 |
| af_Q55CY7_5_208_2.60.40.1730 | Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain | 0.8545 | 45 | 233 | 2.60.40.1730 |
| af_P37898_2_201_2.60.40.1730 | Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain | 0.8433 | 45 | 234 | 2.60.40.1730 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350YSD3-F1-model_v4 | Peptidase M1 | 0.9894 | 28 | 362 |
GO:0046872
|
| AF-A0A7Y5L864-F1-model_v4 | M1 family peptidase | 0.9887 | 25 | 223 |
|
| AF-A0A418N395-F1-model_v4 | M1 family peptidase | 0.9886 | 24 | 551 |
GO:0008237
GO:0008270 |
| AF-A0A3C0IW86-F1-model_v4 | Peptidase M1 | 0.9884 | 240 | 488 |
GO:0008237
GO:0008270 |
| AF-A0A3D2S6U5-F1-model_v4 | Peptidase M1 | 0.9876 | 66 | 457 |
GO:0005615
GO:0005737 GO:0008270 GO:0016020 GO:0042277 GO:0043171 GO:0070006 |