F407296

General Info

Members Datasets Scaffolds Average Seq Length
324 230 324 174

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10135012|Ga0081455_101350122
Length 183
Sequence LDGVTTAANANARADAHLAWPHRIHAHFKRVGVRQVGYVPDTGHSRLIKLCQADPEIADVVLTSEAEGAGLVAGAALGGQRAALLMQSSGVGNCVNMFSLLPNCGFPCLVLVTMRGEFADFNPWQVPMGSITEQVLKLCGFLTYRVEQAEDVDPVVGSGCDMAFSGNLRIAILLAQRLVGHRQ

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
225 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
228 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 0
Rhizoplane 1.54
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100211400 3300005330 Bacteria 1355
2 Ga0070670_100196290 3300005331 Bacteria 1753
3 Ga0070677_10073726 3300005333 Bacteria 1442
4 Ga0070666_10654466 3300005335 Bacteria 769
5 Ga0070680_100031409 3300005336 Bacteria 4270
6 Ga0070689_100164778 3300005340 Bacteria 1793
7 Ga0070689_100703364 3300005340 Bacteria 883
8 Ga0070687_100294900 3300005343 Bacteria 1026
9 Ga0070687_101055983 3300005343 Bacteria 592
10 Ga0070669_101156704 3300005353 Bacteria 667
11 Ga0070675_100067783 3300005354 Bacteria 2953
12 Ga0070671_100274988 3300005355 Bacteria 1432
13 Ga0070674_100045373 3300005356 Bacteria 3003
14 Ga0070667_100110839 3300005367 Bacteria 2379
15 Ga0070667_100152549 3300005367 Bacteria 2030
16 Ga0070709_10341803 3300005434 Bacteria 1103
17 Ga0070714_100769726 3300005435 Bacteria 931
18 Ga0070714_101049184 3300005435 Bacteria 794
19 Ga0070713_100028594 3300005436 Bacteria 4403
20 Ga0070711_100032603 3300005439 Bacteria 3464
21 Ga0070663_100677053 3300005455 Bacteria 875
22 Ga0070663_100872056 3300005455 Bacteria 776
23 Ga0070678_100512966 3300005456 Bacteria 1059
24 Ga0070681_10059168 3300005458 Bacteria 3811
25 Ga0068867_100112015 3300005459 Bacteria 2098
26 Ga0070698_100086534 3300005471 Bacteria 3120
27 Ga0070679_100069186 3300005530 Bacteria 3521
28 Ga0070684_100834911 3300005535 Bacteria 862
29 Ga0070672_100179811 3300005543 Bacteria 1762
30 Ga0070672_101141077 3300005543 Bacteria 693
31 Ga0070686_100426244 3300005544 Bacteria 1015
32 Ga0070665_100000386 3300005548 Bacteria 65232
33 Ga0070665_100322269 3300005548 Bacteria 1550
34 Ga0070665_100592410 3300005548 Bacteria 1122
35 Ga0068854_100470962 3300005578 Bacteria 1053
36 Ga0068859_101118158 3300005617 Bacteria 867
37 Ga0068859_101195659 3300005617 Bacteria 837
38 Ga0068861_100217563 3300005719 Bacteria 1612
39 Ga0068858_100666840 3300005842 Bacteria 1011
40 Ga0081455_10135012 3300005937 Bacteria 1924
41 Ga0081455_10816038 3300005937 Bacteria 585
42 Ga0075365_10626609 3300006038 Bacteria 760
43 Ga0075363_100438308 3300006048 Bacteria 771
44 Ga0075364_10038670 3300006051 Bacteria 3091
45 Ga0075364_10148659 3300006051 Bacteria 1578
46 Ga0070716_100109477 3300006173 Bacteria 1709
47 Ga0070716_100746356 3300006173 Bacteria 752
48 Ga0070712_100216131 3300006175 Bacteria 1515
49 Ga0075362_10000380 3300006177 Bacteria 12698
50 Ga0075367_10071552 3300006178 Bacteria 2086
51 Ga0075367_10186869 3300006178 Bacteria 1292
52 Ga0075369_10136732 3300006186 Bacteria 1116
53 Ga0075366_10028446 3300006195 Bacteria 3280
54 Ga0068865_100168668 3300006881 Bacteria 1676
55 Ga0097620_101118107 3300006931 Bacteria 867
56 Ga0097620_101195973 3300006931 Bacteria 837
57 Ga0105240_10613551 3300009093 Bacteria 1196
58 Ga0111539_12588929 3300009094 Bacteria 588
59 Ga0105245_10811765 3300009098 Bacteria 974
60 Ga0105243_10453811 3300009148 Bacteria 1203
61 Ga0105242_10698562 3300009176 Bacteria 992
62 Ga0105249_11120321 3300009553 Bacteria 857
63 Ga0105028_102125 3300009993 Bacteria 2082
64 Ga0105239_10423530 3300010375 Bacteria 1508
65 Ga0105246_10085466 3300011119 Bacteria 2259
66 Ga0157371_10446648 3300013102 Bacteria 950
67 Ga0157369_10755949 3300013105 Bacteria 1000
68 Ga0157374_11101749 3300013296 Bacteria 814
69 Ga0157378_10331494 3300013297 Bacteria 1481
70 Ga0157378_10508126 3300013297 Bacteria 1205
71 Ga0163163_10868506 3300014325 Bacteria 965
72 Ga0157380_10174584 3300014326 Bacteria 1881
73 Ga0157377_10397147 3300014745 Bacteria 938
74 Ga0157379_10792790 3300014968 Bacteria 894
75 Ga0157376_11176403 3300014969 Bacteria 794
76 Ga0163161_10240464 3300017792 Bacteria 1408
77 Ga0213875_10000033 3300021388 Bacteria 170944
78 Ga0209758_1112476 3300025297 Bacteria 750
79 Ga0207682_10004293 3300025893 Bacteria 5995
80 Ga0207642_10095490 3300025899 Bacteria 1480
81 Ga0207688_10015926 3300025901 Bacteria 4077
82 Ga0207680_10283700 3300025903 Bacteria 1151
83 Ga0207699_10088994 3300025906 Bacteria 1934
84 Ga0207699_10090736 3300025906 Bacteria 1917
85 Ga0207699_10144433 3300025906 Bacteria 1567
86 Ga0207645_10033122 3300025907 Bacteria 3321
87 Ga0207645_10377747 3300025907 Bacteria 951
88 Ga0207693_10049887 3300025915 Bacteria 3287
89 Ga0207663_10266032 3300025916 Bacteria 1268
90 Ga0207660_10103014 3300025917 Bacteria 2135
91 Ga0207662_10176727 3300025918 Bacteria 1372
92 Ga0207662_10672501 3300025918 Bacteria 724
93 Ga0207652_10007519 3300025921 Bacteria 8770
94 Ga0207650_10707370 3300025925 Bacteria 851
95 Ga0207659_10181080 3300025926 Bacteria 1669
96 Ga0207687_10158964 3300025927 Bacteria 1732
97 Ga0207700_10340147 3300025928 Bacteria 1304
98 Ga0207700_10388820 3300025928 Bacteria 1221
99 Ga0207664_10231348 3300025929 Bacteria 1607
100 Ga0207664_10532054 3300025929 Bacteria 1054
101 Ga0207664_10555460 3300025929 Bacteria 1030
102 Ga0207706_10202379 3300025933 Bacteria 1742
103 Ga0207686_10694480 3300025934 Bacteria 808
104 Ga0207670_10653384 3300025936 Bacteria 867
105 Ga0207669_10054343 3300025937 Bacteria 2418
106 Ga0207669_10257233 3300025937 Bacteria 1304
107 Ga0207704_10074938 3300025938 Bacteria 2162
108 Ga0207665_10136665 3300025939 Bacteria 1745
109 Ga0207665_10185366 3300025939 Bacteria 1509
110 Ga0207691_10084048 3300025940 Bacteria 2858
111 Ga0207691_10159182 3300025940 Bacteria 1982
112 Ga0207679_10122132 3300025945 Bacteria 2075
113 Ga0207667_10103046 3300025949 Bacteria 2944
114 Ga0207667_10776248 3300025949 Bacteria 956
115 Ga0207651_10219317 3300025960 Bacteria 1536
116 Ga0207651_10317587 3300025960 Bacteria 1301
117 Ga0207651_10832806 3300025960 Bacteria 819
118 Ga0207658_10122834 3300025986 Bacteria 2073
119 Ga0207658_10216099 3300025986 Bacteria 1610
120 Ga0207677_10491699 3300026023 Bacteria 1059
121 Ga0207678_10637318 3300026067 Bacteria 936
122 Ga0207702_11151708 3300026078 Bacteria 770
123 Ga0207648_10059753 3300026089 Bacteria 3325
124 Ga0207675_100213637 3300026118 Bacteria 1856
125 Ga0207683_10111884 3300026121 Bacteria 2445
126 Ga0268266_10000411 3300028379 Bacteria 65247
127 Ga0265337_1007492 3300028556 Bacteria 4080
128 Ga0265338_10042050 3300028800 Bacteria 4263
129 Ga0265325_10057454 3300031241 Bacteria 1984
130 Ga0265339_10096400 3300031249 Bacteria 1544
131 Ga0307408_101076724 3300031548 Bacteria 745
132 Ga0265313_10000118 3300031595 Bacteria 79605
133 Ga0307416_101311584 3300032002 Bacteria 830
134 Ga0316583_10115602 3300032133 Bacteria 935
135 Ga0373926_0019480 3300035083 Bacteria 2339
136 Ga0373944_0007901 3300035089 Bacteria 2864
137 Ga0373949_0073852 3300035090 Bacteria 898
138 Ga0373923_0000635 3300035111 Bacteria 8826
139 Ga0373932_0170819 3300035112 Bacteria 757
140 Ga0373936_0001498 3300035113 Bacteria 8471
141 Ga0373945_0007731 3300035116 Bacteria 3486
142 Ga0373953_0001348 3300035117 Bacteria 7055
143 Ga0373943_0001065 3300035170 Bacteria 12191
144 Ga0373946_0001173 3300035171 Bacteria 9072
145 Ga0373955_0000223 3300035172 Bacteria 23964
146 Ga0316574_0169526 3300035398 Bacteria 1406
147 Ga0373924_0088989 3300035410 Bacteria 1319
148 Ga0373931_0152096 3300035691 Bacteria 1350
149 Ga0373935_0001620 3300035692 Bacteria 12561
150 Ga0373927_0002295 3300035695 Bacteria 13999
151 Ga0373933_0031685 3300035724 Bacteria 3068
152 Ga0373947_0000090 3300035725 Bacteria 45944
153 Ga0373937_0000007 3300036401 Bacteria 183537
154 Ga0373925_0000011 3300037068 Bacteria 209840
155 Ga0373925_1295431 3300037068 Bacteria 598
156 Ga0395900_0136076 3300037418 Bacteria 2517
157 Ga0395898_0036315 3300037466 Bacteria 4892
158 Ga0436364_0640586 3300037853 Bacteria 24713
159 Ga0436364_1265840 3300037853 Bacteria 970
160 Ga0395901_0161783 3300038443 Bacteria 2351
161 Ga0395901_0251146 3300038443 Bacteria 1842
162 Ga0395901_0543235 3300038443 Bacteria 1178
163 Ga0436365_1496797 3300039437 Bacteria 2038
164 Ga0436360_0171023 3300039438 Bacteria 1228
165 Ga0436362_1078060 3300039453 Bacteria 946
166 Ga0439446_0223872 3300042156 Bacteria 642
167 Ga0466968_0091475 3300044735 Bacteria 1349
168 Ga0495592_0000549 3300046454 Bacteria 26792
169 Ga0495629_0035677 3300046459 Bacteria 3514
170 Ga0495638_0002807 3300046460 Bacteria 13952
171 Ga0495651_0012836 3300046462 Bacteria 6470
172 Ga0495653_0000190 3300046463 Bacteria 50144
173 Ga0495582_0078094 3300046473 Bacteria 1836
174 Ga0495582_0104558 3300046473 Bacteria 1587
175 Ga0495664_0000019 3300046477 Bacteria 153012
176 Ga0495664_0043608 3300046477 Bacteria 2658
177 Ga0495608_0000026 3300046511 Bacteria 156234
178 Ga0495618_0000015 3300046514 Bacteria 152478
179 Ga0495628_0000006 3300046516 Bacteria 306606
180 Ga0495630_0005882 3300046517 Bacteria 8675
181 Ga0495663_0149314 3300046525 Bacteria 797
182 Ga0495666_0234635 3300046526 Bacteria 838
183 Ga0495652_0000030 3300046529 Bacteria 152921
184 Ga0495665_0004041 3300046531 Bacteria 7918
185 Ga0495665_0215834 3300046531 Bacteria 992
186 Ga0495640_0000013 3300046533 Bacteria 172438
187 Ga0495587_0000021 3300046536 Bacteria 152895
188 Ga0495598_0013752 3300046537 Bacteria 2013
189 Ga0495621_0025478 3300046539 Bacteria 1987
190 Ga0495645_0000001 3300046543 Bacteria 657910
191 Ga0495667_0000027 3300046559 Bacteria 152535
192 Ga0495668_0216526 3300046616 Bacteria 1049
193 Ga0495634_0000008 3300046642 Bacteria 163983
194 Ga0495634_0079891 3300046642 Bacteria 2141
195 Ga0495635_0000003 3300046663 Bacteria 390055
196 Ga0495657_0000144 3300046675 Bacteria 63756
197 Ga0495599_0000014 3300046678 Bacteria 177414
198 Ga0495623_0000006 3300046679 Bacteria 140385
199 Ga0495646_0000501 3300046680 Bacteria 20979
200 Ga0495613_0004313 3300046689 Bacteria 10647
201 Ga0495613_0386529 3300046689 Bacteria 956
202 Ga0495624_0014664 3300046690 Bacteria 5309
203 Ga0495624_0093478 3300046690 Bacteria 1854
204 Ga0495600_0000005 3300046809 Bacteria 171675
205 Ga0495581_0036715 3300047315 Bacteria 2835
206 Ga0495604_0000002 3300047317 Bacteria 530904
207 Ga0495674_0000004 3300047319 Bacteria 531855
208 Ga0495672_0151215 3300047320 Bacteria 1204
209 Ga0495680_0000160 3300047322 Bacteria 68852
210 Ga0495675_0000192 3300047444 Bacteria 44849
211 Ga0495684_0000004 3300047471 Bacteria 307093
212 Ga0495593_0000362 3300047673 Bacteria 25069
213 Ga0495602_0000001 3300048088 Bacteria 510904
214 Ga0496100_0592616 3300048903 Bacteria 860
215 Ga0496110_0850304 3300048913 Bacteria 818
216 Ga0496112_0060971 3300048915 Bacteria 3718
217 Ga0496113_0260746 3300048916 Bacteria 1385
218 Ga0496114_0449916 3300048917 Bacteria 1141
219 Ga0501031_0010885 3300049568 Bacteria 5927
220 Ga0501032_0008944 3300049569 Bacteria 7283
221 Ga0501032_0039646 3300049569 Bacteria 3203
222 Ga0501032_0061192 3300049569 Bacteria 2524
223 Ga0501033_0061532 3300049570 Bacteria 2766
224 Ga0501033_0686408 3300049570 Bacteria 697
225 Ga0501034_0000179 3300049571 Bacteria 118832
226 Ga0501034_0000687 3300049571 Bacteria 51400
227 Ga0501034_0163107 3300049571 Bacteria 2198
228 Ga0501034_0194754 3300049571 Bacteria 1987
229 Ga0501034_0584144 3300049571 Bacteria 1024
230 Ga0501036_0000281 3300049572 Bacteria 35045
231 Ga0501036_0033771 3300049572 Bacteria 4326
232 Ga0501036_0079207 3300049572 Bacteria 2779
233 Ga0501036_0789162 3300049572 Bacteria 782
234 Ga0501036_0851288 3300049572 Bacteria 749
235 Ga0501037_0018217 3300049573 Bacteria 5173
236 Ga0501038_0010685 3300049574 Bacteria 8396
237 Ga0501038_0028445 3300049574 Bacteria 4966
238 Ga0501038_0476844 3300049574 Bacteria 956
239 Ga0501039_0026653 3300049575 Bacteria 4441
240 Ga0501039_0026870 3300049575 Bacteria 4424
241 Ga0501039_0698958 3300049575 Bacteria 793
242 Ga0501042_0125722 3300049578 Bacteria 1846
243 Ga0501043_0006423 3300049579 Bacteria 9442
244 Ga0501043_0008355 3300049579 Bacteria 8148
245 Ga0501043_0070814 3300049579 Bacteria 2739
246 Ga0501043_0218209 3300049579 Bacteria 1476
247 Ga0501046_0005983 3300049580 Bacteria 10828
248 Ga0501046_0104168 3300049580 Bacteria 2174
249 Ga0501047_0000316 3300049581 Bacteria 55680
250 Ga0501047_0054763 3300049581 Bacteria 3858
251 Ga0501047_0187115 3300049581 Bacteria 1935
252 Ga0501047_0260085 3300049581 Bacteria 1583
253 Ga0501047_0914865 3300049581 Bacteria 690
254 Ga0501048_0000150 3300049582 Bacteria 42721
255 Ga0501048_0074369 3300049582 Bacteria 2397
256 Ga0501067_0148092 3300049583 Bacteria 1308
257 Ga0501067_0307270 3300049583 Bacteria 883
258 Ga0501068_0044933 3300049584 Bacteria 2661
259 Ga0501068_0082431 3300049584 Bacteria 1975
260 Ga0501068_0118783 3300049584 Bacteria 1647
261 Ga0501069_0028767 3300049585 Bacteria 3048
262 Ga0501070_0043316 3300049586 Bacteria 3746
263 Ga0501070_0102378 3300049586 Bacteria 2368
264 Ga0501070_0275749 3300049586 Bacteria 1373
265 Ga0501070_0277864 3300049586 Bacteria 1367
266 Ga0501070_0282509 3300049586 Bacteria 1354
267 Ga0501070_0290502 3300049586 Bacteria 1332
268 Ga0501070_0901894 3300049586 Bacteria 689
269 Ga0501071_0052571 3300049587 Bacteria 2938
270 Ga0501073_0014170 3300049589 Bacteria 5788
271 Ga0501073_0022261 3300049589 Bacteria 4566
272 Ga0501073_0139278 3300049589 Bacteria 1681
273 Ga0501074_0019719 3300049590 Bacteria 4896
274 Ga0501074_0024770 3300049590 Bacteria 4360
275 Ga0501074_0157917 3300049590 Bacteria 1619
276 Ga0501074_0224069 3300049590 Bacteria 1338
277 Ga0501075_0177444 3300049591 Bacteria 1626
278 Ga0501076_0293626 3300049592 Bacteria 1332
279 Ga0501079_0015597 3300049741 Bacteria 5801
280 Ga0501079_0324144 3300049741 Bacteria 1206
281 Ga0501080_0000496 3300049742 Bacteria 30745
282 Ga0501080_0010180 3300049742 Bacteria 8598
283 Ga0501080_0017332 3300049742 Bacteria 6658
284 Ga0501080_0055509 3300049742 Bacteria 3689
285 Ga0501080_0758633 3300049742 Bacteria 853
286 Ga0501081_0066039 3300049743 Bacteria 2516
287 Ga0501083_0002062 3300049744 Bacteria 13827
288 Ga0501083_0129295 3300049744 Bacteria 1655
289 Ga0501083_0135900 3300049744 Bacteria 1611
290 Ga0501083_0665817 3300049744 Bacteria 677
291 Ga0501035_0162351 3300049822 Bacteria 1933
292 Ga0501035_0317907 3300049822 Bacteria 1308
293 Ga0501044_0002534 3300049823 Bacteria 20803
294 Ga0501044_0091203 3300049823 Bacteria 3073
295 Ga0501044_0177940 3300049823 Bacteria 2095
296 Ga0501044_1040360 3300049823 Bacteria 689
297 Ga0501045_0305920 3300049824 Bacteria 1183
298 nmdc:mga03683_160669_c1 3300050489 Bacteria 1018
299 nmdc:mga00v17_30510_c1 3300050491 Bacteria 3173
300 nmdc:mga0k408_94877_c1 3300050493 Bacteria 1755
301 nmdc:mga06z11_180439_c1 3300050494 Bacteria 1217
302 nmdc:mga04h51_187449_c1 3300050495 Bacteria 808
303 nmdc:mga07m45_34589_c1 3300050496 Bacteria 2808
304 nmdc:mga07m45_72097_c1 3300050496 Bacteria 1966
305 nmdc:mga0n895_277879_c1 3300050512 Bacteria 1698
306 Ga0495601_0000078 3300053077 Bacteria 51996
307 Ga0495612_0000005 3300053078 Bacteria 286943
308 Ga0500610_0222671 3300053079 Bacteria 892
309 Ga0495595_0000013 3300053084 Bacteria 160811
310 Ga0495619_0000003 3300053085 Bacteria 515784
311 Ga0495619_0130120 3300053085 Bacteria 1729
312 Ga0500643_001563 3300053087 Bacteria 12967
313 Ga0500646_0032206 3300053090 Bacteria 1446
314 Ga0500641_0040104 3300053096 Bacteria 1889
315 Ga0500650_0000263 3300053098 Bacteria 12670
316 Ga0500595_000001 3300053119 Bacteria 1088438
317 Ga0500595_012237 3300053119 Bacteria 3326
318 Ga0500642_0211633 3300053130 Bacteria 900
319 Ga0500579_150743 3300053143 Bacteria 1015
320 Ga0500588_0126030 3300053146 Bacteria 908
321 Ga0501084_0386078 3300054114 Bacteria 1183
322 Ga0501084_1424206 3300054114 Bacteria 580
323 Ga0501082_0564698 3300060353 Bacteria 995
324 Ga0501082_0914147 3300060353 Bacteria 768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0324144 Ga0501079_0324144_129_605 158
2 3300047320 Ga0495672_0151215 Ga0495672_0151215_250_738 160
3 3300049744 Ga0501083_0665817 Ga0501083_0665817_165_647 160
4 3300044735 Ga0466968_0091475 Ga0466968_0091475_740_1231 163
5 3300049742 Ga0501080_0758633 Ga0501080_0758633_109_600 163
6 3300054114 Ga0501084_1424206 Ga0501084_1424206_76_567 163
7 3300060353 Ga0501082_0914147 Ga0501082_0914147_181_672 163
8 3300037068 Ga0373925_1295431 Ga0373925_1295431_86_583 165
9 3300032002 Ga0307416_101311584 Ga0307416_1013115842 166
10 3300014968 Ga0157379_10792790 Ga0157379_107927902 167
11 3300048903 Ga0496100_0592616 Ga0496100_0592616_210_719 167
12 3300048917 Ga0496114_0449916 Ga0496114_0449916_409_918 167
13 3300053130 Ga0500642_0211633 Ga0500642_0211633_309_833 167
14 3300025929 Ga0207664_10532054 Ga0207664_105320542 169
15 3300005471 Ga0070698_100086534 Ga0070698_1000865344 170
16 3300005617 Ga0068859_101118158 Ga0068859_1011181581 170
17 3300005937 Ga0081455_10135012 Ga0081455_101350122 170
18 3300006931 Ga0097620_101118107 Ga0097620_1011181071 170
19 3300049569 Ga0501032_0061192 Ga0501032_0061192_993_1505 170
20 3300049571 Ga0501034_0000687 Ga0501034_0000687_35024_35536 170
21 3300049572 Ga0501036_0000281 Ga0501036_0000281_8472_8984 170
22 3300049579 Ga0501043_0008355 Ga0501043_0008355_6582_7094 170
23 3300049581 Ga0501047_0000316 Ga0501047_0000316_27825_28337 170
24 3300049582 Ga0501048_0000150 Ga0501048_0000150_41723_42235 170
25 3300049590 Ga0501074_0157917 Ga0501074_0157917_64_576 170
26 3300049592 Ga0501076_0293626 Ga0501076_0293626_61_594 170
27 3300049742 Ga0501080_0000496 Ga0501080_0000496_12358_12870 170
28 3300049744 Ga0501083_0002062 Ga0501083_0002062_754_1266 170
29 3300049823 Ga0501044_0002534 Ga0501044_0002534_11225_11737 170
30 3300053098 Ga0500650_0000263 Ga0500650_0000263_10481_11005 170
31 3300005435 Ga0070714_100769726 Ga0070714_1007697261 172
32 3300005436 Ga0070713_100028594 Ga0070713_1000285942 172
33 3300005439 Ga0070711_100032603 Ga0070711_1000326034 172
34 3300006173 Ga0070716_100109477 Ga0070716_1001094772 172
35 3300006175 Ga0070712_100216131 Ga0070712_1002161312 172
36 3300009093 Ga0105240_10613551 Ga0105240_106135513 172
37 3300013102 Ga0157371_10446648 Ga0157371_104466482 172
38 3300013105 Ga0157369_10755949 Ga0157369_107559492 172
39 3300025906 Ga0207699_10144433 Ga0207699_101444332 172
40 3300025916 Ga0207663_10266032 Ga0207663_102660322 172
41 3300025928 Ga0207700_10340147 Ga0207700_103401472 172
42 3300025928 Ga0207700_10388820 Ga0207700_103888202 172
43 3300025929 Ga0207664_10231348 Ga0207664_102313482 172
44 3300025929 Ga0207664_10555460 Ga0207664_105554602 172
45 3300025939 Ga0207665_10136665 Ga0207665_101366653 172
46 3300025949 Ga0207667_10103046 Ga0207667_101030462 172
47 3300037853 Ga0436364_1265840 Ga0436364_1265840_219_737 172
48 3300039437 Ga0436365_1496797 Ga0436365_1496797_704_1222 172
49 3300049568 Ga0501031_0010885 Ga0501031_0010885_2489_3007 172
50 3300049569 Ga0501032_0008944 Ga0501032_0008944_3024_3542 172
51 3300049569 Ga0501032_0039646 Ga0501032_0039646_1680_2198 172
52 3300049570 Ga0501033_0061532 Ga0501033_0061532_1825_2343 172
53 3300049570 Ga0501033_0686408 Ga0501033_0686408_32_550 172
54 3300049571 Ga0501034_0000179 Ga0501034_0000179_33119_33637 172
55 3300049571 Ga0501034_0163107 Ga0501034_0163107_478_996 172
56 3300049571 Ga0501034_0194754 Ga0501034_0194754_846_1364 172
57 3300049572 Ga0501036_0033771 Ga0501036_0033771_2906_3424 172
58 3300049572 Ga0501036_0079207 Ga0501036_0079207_891_1409 172
59 3300049572 Ga0501036_0789162 Ga0501036_0789162_241_759 172
60 3300049572 Ga0501036_0851288 Ga0501036_0851288_77_595 172
61 3300049573 Ga0501037_0018217 Ga0501037_0018217_675_1193 172
62 3300049574 Ga0501038_0010685 Ga0501038_0010685_7314_7832 172
63 3300049574 Ga0501038_0028445 Ga0501038_0028445_4214_4732 172
64 3300049574 Ga0501038_0476844 Ga0501038_0476844_263_781 172
65 3300049575 Ga0501039_0026653 Ga0501039_0026653_1663_2181 172
66 3300049575 Ga0501039_0026870 Ga0501039_0026870_3087_3605 172
67 3300049575 Ga0501039_0698958 Ga0501039_0698958_32_550 172
68 3300049578 Ga0501042_0125722 Ga0501042_0125722_837_1355 172
69 3300049579 Ga0501043_0006423 Ga0501043_0006423_7246_7764 172
70 3300049579 Ga0501043_0070814 Ga0501043_0070814_2078_2596 172
71 3300049579 Ga0501043_0218209 Ga0501043_0218209_798_1316 172
72 3300049580 Ga0501046_0005983 Ga0501046_0005983_5044_5562 172
73 3300049580 Ga0501046_0104168 Ga0501046_0104168_1542_2060 172
74 3300049581 Ga0501047_0187115 Ga0501047_0187115_105_623 172
75 3300049581 Ga0501047_0260085 Ga0501047_0260085_441_959 172
76 3300049581 Ga0501047_0914865 Ga0501047_0914865_29_547 172
77 3300049582 Ga0501048_0074369 Ga0501048_0074369_193_711 172
78 3300049583 Ga0501067_0148092 Ga0501067_0148092_426_944 172
79 3300049583 Ga0501067_0307270 Ga0501067_0307270_307_825 172
80 3300049584 Ga0501068_0082431 Ga0501068_0082431_41_559 172
81 3300049584 Ga0501068_0118783 Ga0501068_0118783_841_1359 172
82 3300049585 Ga0501069_0028767 Ga0501069_0028767_186_704 172
83 3300049586 Ga0501070_0043316 Ga0501070_0043316_2343_2861 172
84 3300049586 Ga0501070_0290502 Ga0501070_0290502_639_1157 172
85 3300049586 Ga0501070_0901894 Ga0501070_0901894_101_619 172
86 3300049589 Ga0501073_0014170 Ga0501073_0014170_3070_3588 172
87 3300049589 Ga0501073_0022261 Ga0501073_0022261_2468_2986 172
88 3300049589 Ga0501073_0139278 Ga0501073_0139278_247_765 172
89 3300049590 Ga0501074_0019719 Ga0501074_0019719_2781_3299 172
90 3300049590 Ga0501074_0224069 Ga0501074_0224069_736_1254 172
91 3300049591 Ga0501075_0177444 Ga0501075_0177444_433_951 172
92 3300049741 Ga0501079_0015597 Ga0501079_0015597_1204_1722 172
93 3300049742 Ga0501080_0010180 Ga0501080_0010180_1599_2117 172
94 3300049742 Ga0501080_0017332 Ga0501080_0017332_424_942 172
95 3300049743 Ga0501081_0066039 Ga0501081_0066039_524_1042 172
96 3300049822 Ga0501035_0162351 Ga0501035_0162351_605_1123 172
97 3300049822 Ga0501035_0317907 Ga0501035_0317907_231_749 172
98 3300049823 Ga0501044_0091203 Ga0501044_0091203_548_1066 172
99 3300049823 Ga0501044_0177940 Ga0501044_0177940_1465_1983 172
100 3300049823 Ga0501044_1040360 Ga0501044_1040360_59_577 172
101 3300049824 Ga0501045_0305920 Ga0501045_0305920_467_985 172
102 3300054114 Ga0501084_0386078 Ga0501084_0386078_110_628 172
103 3300060353 Ga0501082_0564698 Ga0501082_0564698_365_883 172
104 3300005330 Ga0070690_100211400 Ga0070690_1002114001 173
105 3300005331 Ga0070670_100196290 Ga0070670_1001962903 173
106 3300005333 Ga0070677_10073726 Ga0070677_100737261 173
107 3300005335 Ga0070666_10654466 Ga0070666_106544662 173
108 3300005336 Ga0070680_100031409 Ga0070680_1000314093 173
109 3300005340 Ga0070689_100164778 Ga0070689_1001647782 173
110 3300005340 Ga0070689_100703364 Ga0070689_1007033642 173
111 3300005343 Ga0070687_100294900 Ga0070687_1002949003 173
112 3300005343 Ga0070687_101055983 Ga0070687_1010559831 173
113 3300005353 Ga0070669_101156704 Ga0070669_1011567041 173
114 3300005354 Ga0070675_100067783 Ga0070675_1000677832 173
115 3300005355 Ga0070671_100274988 Ga0070671_1002749883 173
116 3300005356 Ga0070674_100045373 Ga0070674_1000453733 173
117 3300005367 Ga0070667_100110839 Ga0070667_1001108393 173
118 3300005367 Ga0070667_100152549 Ga0070667_1001525493 173
119 3300005434 Ga0070709_10341803 Ga0070709_103418032 173
120 3300005435 Ga0070714_101049184 Ga0070714_1010491841 173
121 3300005455 Ga0070663_100677053 Ga0070663_1006770532 173
122 3300005455 Ga0070663_100872056 Ga0070663_1008720561 173
123 3300005456 Ga0070678_100512966 Ga0070678_1005129662 173
124 3300005458 Ga0070681_10059168 Ga0070681_100591683 173
125 3300005459 Ga0068867_100112015 Ga0068867_1001120153 173
126 3300005530 Ga0070679_100069186 Ga0070679_1000691864 173
127 3300005535 Ga0070684_100834911 Ga0070684_1008349112 173
128 3300005543 Ga0070672_100179811 Ga0070672_1001798113 173
129 3300005543 Ga0070672_101141077 Ga0070672_1011410771 173
130 3300005544 Ga0070686_100426244 Ga0070686_1004262442 173
131 3300005548 Ga0070665_100000386 Ga0070665_10000038625 173
132 3300005548 Ga0070665_100322269 Ga0070665_1003222693 173
133 3300005548 Ga0070665_100592410 Ga0070665_1005924102 173
134 3300005578 Ga0068854_100470962 Ga0068854_1004709622 173
135 3300005617 Ga0068859_101195659 Ga0068859_1011956592 173
136 3300005719 Ga0068861_100217563 Ga0068861_1002175633 173
137 3300005842 Ga0068858_100666840 Ga0068858_1006668402 173
138 3300005937 Ga0081455_10816038 Ga0081455_108160381 173
139 3300006038 Ga0075365_10626609 Ga0075365_106266092 173
140 3300006048 Ga0075363_100438308 Ga0075363_1004383081 173
141 3300006051 Ga0075364_10038670 Ga0075364_100386703 173
142 3300006051 Ga0075364_10148659 Ga0075364_101486592 173
143 3300006173 Ga0070716_100746356 Ga0070716_1007463562 173
144 3300006177 Ga0075362_10000380 Ga0075362_100003805 173
145 3300006178 Ga0075367_10071552 Ga0075367_100715523 173
146 3300006178 Ga0075367_10186869 Ga0075367_101868693 173
147 3300006186 Ga0075369_10136732 Ga0075369_101367322 173
148 3300006195 Ga0075366_10028446 Ga0075366_100284463 173
149 3300006881 Ga0068865_100168668 Ga0068865_1001686683 173
150 3300006931 Ga0097620_101195973 Ga0097620_1011959732 173
151 3300009094 Ga0111539_12588929 Ga0111539_125889291 173
152 3300009098 Ga0105245_10811765 Ga0105245_108117651 173
153 3300009148 Ga0105243_10453811 Ga0105243_104538113 173
154 3300009176 Ga0105242_10698562 Ga0105242_106985622 173
155 3300009553 Ga0105249_11120321 Ga0105249_111203211 173
156 3300009993 Ga0105028_102125 Ga0105028_1021253 173
157 3300010375 Ga0105239_10423530 Ga0105239_104235302 173
158 3300011119 Ga0105246_10085466 Ga0105246_100854661 173
159 3300013296 Ga0157374_11101749 Ga0157374_111017492 173
160 3300013297 Ga0157378_10331494 Ga0157378_103314942 173
161 3300013297 Ga0157378_10508126 Ga0157378_105081262 173
162 3300014325 Ga0163163_10868506 Ga0163163_108685061 173
163 3300014326 Ga0157380_10174584 Ga0157380_101745843 173
164 3300014745 Ga0157377_10397147 Ga0157377_103971472 173
165 3300014969 Ga0157376_11176403 Ga0157376_111764032 173
166 3300017792 Ga0163161_10240464 Ga0163161_102404643 173
167 3300021388 Ga0213875_10000033 Ga0213875_1000003338 173
168 3300025297 Ga0209758_1112476 Ga0209758_11124762 173
169 3300025893 Ga0207682_10004293 Ga0207682_100042933 173
170 3300025899 Ga0207642_10095490 Ga0207642_100954903 173
171 3300025901 Ga0207688_10015926 Ga0207688_100159266 173
172 3300025903 Ga0207680_10283700 Ga0207680_102837001 173
173 3300025906 Ga0207699_10088994 Ga0207699_100889942 173
174 3300025906 Ga0207699_10090736 Ga0207699_100907362 173
175 3300025907 Ga0207645_10033122 Ga0207645_100331224 173
176 3300025907 Ga0207645_10377747 Ga0207645_103777471 173
177 3300025915 Ga0207693_10049887 Ga0207693_100498873 173
178 3300025917 Ga0207660_10103014 Ga0207660_101030142 173
179 3300025918 Ga0207662_10176727 Ga0207662_101767272 173
180 3300025918 Ga0207662_10672501 Ga0207662_106725011 173
181 3300025921 Ga0207652_10007519 Ga0207652_100075197 173
182 3300025925 Ga0207650_10707370 Ga0207650_107073702 173
183 3300025926 Ga0207659_10181080 Ga0207659_101810802 173
184 3300025927 Ga0207687_10158964 Ga0207687_101589643 173
185 3300025933 Ga0207706_10202379 Ga0207706_102023793 173
186 3300025934 Ga0207686_10694480 Ga0207686_106944802 173
187 3300025936 Ga0207670_10653384 Ga0207670_106533842 173
188 3300025937 Ga0207669_10054343 Ga0207669_100543433 173
189 3300025937 Ga0207669_10257233 Ga0207669_102572332 173
190 3300025938 Ga0207704_10074938 Ga0207704_100749382 173
191 3300025939 Ga0207665_10185366 Ga0207665_101853663 173
192 3300025940 Ga0207691_10084048 Ga0207691_100840483 173
193 3300025940 Ga0207691_10159182 Ga0207691_101591824 173
194 3300025945 Ga0207679_10122132 Ga0207679_101221323 173
195 3300025949 Ga0207667_10776248 Ga0207667_107762482 173
196 3300025960 Ga0207651_10219317 Ga0207651_102193173 173
197 3300025960 Ga0207651_10317587 Ga0207651_103175872 173
198 3300025960 Ga0207651_10832806 Ga0207651_108328061 173
199 3300025986 Ga0207658_10122834 Ga0207658_101228343 173
200 3300025986 Ga0207658_10216099 Ga0207658_102160993 173
201 3300026023 Ga0207677_10491699 Ga0207677_104916992 173
202 3300026067 Ga0207678_10637318 Ga0207678_106373182 173
203 3300026078 Ga0207702_11151708 Ga0207702_111517081 173
204 3300026089 Ga0207648_10059753 Ga0207648_100597534 173
205 3300026118 Ga0207675_100213637 Ga0207675_1002136372 173
206 3300026121 Ga0207683_10111884 Ga0207683_101118843 173
207 3300028379 Ga0268266_10000411 Ga0268266_1000041125 173
208 3300028556 Ga0265337_1007492 Ga0265337_10074924 173
209 3300028800 Ga0265338_10042050 Ga0265338_100420504 173
210 3300031241 Ga0265325_10057454 Ga0265325_100574543 173
211 3300031249 Ga0265339_10096400 Ga0265339_100964003 173
212 3300031548 Ga0307408_101076724 Ga0307408_1010767242 173
213 3300031595 Ga0265313_10000118 Ga0265313_1000011812 173
214 3300032133 Ga0316583_10115602 Ga0316583_101156022 173
215 3300035083 Ga0373926_0019480 Ga0373926_0019480_1557_2084 173
216 3300035089 Ga0373944_0007901 Ga0373944_0007901_1579_2106 173
217 3300035090 Ga0373949_0073852 Ga0373949_0073852_148_681 173
218 3300035111 Ga0373923_0000635 Ga0373923_0000635_5403_5930 173
219 3300035112 Ga0373932_0170819 Ga0373932_0170819_147_680 173
220 3300035113 Ga0373936_0001498 Ga0373936_0001498_3553_4080 173
221 3300035116 Ga0373945_0007731 Ga0373945_0007731_264_791 173
222 3300035117 Ga0373953_0001348 Ga0373953_0001348_2341_2868 173
223 3300035170 Ga0373943_0001065 Ga0373943_0001065_603_1130 173
224 3300035171 Ga0373946_0001173 Ga0373946_0001173_1783_2310 173
225 3300035172 Ga0373955_0000223 Ga0373955_0000223_3589_4116 173
226 3300035398 Ga0316574_0169526 Ga0316574_0169526_676_1200 173
227 3300035410 Ga0373924_0088989 Ga0373924_0088989_390_917 173
228 3300035691 Ga0373931_0152096 Ga0373931_0152096_130_651 173
229 3300035692 Ga0373935_0001620 Ga0373935_0001620_923_1450 173
230 3300035695 Ga0373927_0002295 Ga0373927_0002295_6758_7285 173
231 3300035724 Ga0373933_0031685 Ga0373933_0031685_1377_1904 173
232 3300035725 Ga0373947_0000090 Ga0373947_0000090_34498_35025 173
233 3300036401 Ga0373937_0000007 Ga0373937_0000007_79239_79766 173
234 3300037068 Ga0373925_0000011 Ga0373925_0000011_70490_71017 173
235 3300037418 Ga0395900_0136076 Ga0395900_0136076_505_1026 173
236 3300037466 Ga0395898_0036315 Ga0395898_0036315_477_998 173
237 3300037853 Ga0436364_0640586 Ga0436364_0640586_992_1519 173
238 3300038443 Ga0395901_0161783 Ga0395901_0161783_1464_2006 173
239 3300038443 Ga0395901_0251146 Ga0395901_0251146_1206_1727 173
240 3300038443 Ga0395901_0543235 Ga0395901_0543235_612_1133 173
241 3300039438 Ga0436360_0171023 Ga0436360_0171023_178_708 173
242 3300039453 Ga0436362_1078060 Ga0436362_1078060_165_689 173
243 3300042156 Ga0439446_0223872 Ga0439446_0223872_69_590 173
244 3300046454 Ga0495592_0000549 Ga0495592_0000549_13206_13733 173
245 3300046459 Ga0495629_0035677 Ga0495629_0035677_993_1520 173
246 3300046460 Ga0495638_0002807 Ga0495638_0002807_3845_4366 173
247 3300046462 Ga0495651_0012836 Ga0495651_0012836_712_1239 173
248 3300046463 Ga0495653_0000190 Ga0495653_0000190_15250_15777 173
249 3300046473 Ga0495582_0078094 Ga0495582_0078094_1021_1554 173
250 3300046473 Ga0495582_0104558 Ga0495582_0104558_328_855 173
251 3300046477 Ga0495664_0000019 Ga0495664_0000019_13171_13698 173
252 3300046477 Ga0495664_0043608 Ga0495664_0043608_1962_2507 173
253 3300046511 Ga0495608_0000026 Ga0495608_0000026_138835_139362 173
254 3300046514 Ga0495618_0000015 Ga0495618_0000015_138863_139390 173
255 3300046516 Ga0495628_0000006 Ga0495628_0000006_167217_167744 173
256 3300046517 Ga0495630_0005882 Ga0495630_0005882_8035_8562 173
257 3300046525 Ga0495663_0149314 Ga0495663_0149314_39_560 173
258 3300046526 Ga0495666_0234635 Ga0495666_0234635_245_772 173
259 3300046529 Ga0495652_0000030 Ga0495652_0000030_13079_13606 173
260 3300046531 Ga0495665_0004041 Ga0495665_0004041_4437_4970 173
261 3300046531 Ga0495665_0215834 Ga0495665_0215834_56_583 173
262 3300046533 Ga0495640_0000013 Ga0495640_0000013_68064_68591 173
263 3300046536 Ga0495587_0000021 Ga0495587_0000021_139295_139822 173
264 3300046537 Ga0495598_0013752 Ga0495598_0013752_873_1394 173
265 3300046539 Ga0495621_0025478 Ga0495621_0025478_826_1347 173
266 3300046543 Ga0495645_0000001 Ga0495645_0000001_371600_372127 173
267 3300046559 Ga0495667_0000027 Ga0495667_0000027_138849_139376 173
268 3300046616 Ga0495668_0216526 Ga0495668_0216526_137_658 173
269 3300046642 Ga0495634_0000008 Ga0495634_0000008_5051_5578 173
270 3300046642 Ga0495634_0079891 Ga0495634_0079891_1159_1692 173
271 3300046663 Ga0495635_0000003 Ga0495635_0000003_371231_371758 173
272 3300046675 Ga0495657_0000144 Ga0495657_0000144_47656_48183 173
273 3300046678 Ga0495599_0000014 Ga0495599_0000014_103891_104418 173
274 3300046679 Ga0495623_0000006 Ga0495623_0000006_35894_36421 173
275 3300046680 Ga0495646_0000501 Ga0495646_0000501_3555_4082 173
276 3300046689 Ga0495613_0004313 Ga0495613_0004313_2919_3446 173
277 3300046689 Ga0495613_0386529 Ga0495613_0386529_247_780 173
278 3300046690 Ga0495624_0014664 Ga0495624_0014664_3975_4502 173
279 3300046690 Ga0495624_0093478 Ga0495624_0093478_1090_1623 173
280 3300046809 Ga0495600_0000005 Ga0495600_0000005_67229_67756 173
281 3300047315 Ga0495581_0036715 Ga0495581_0036715_613_1140 173
282 3300047317 Ga0495604_0000002 Ga0495604_0000002_158892_159419 173
283 3300047319 Ga0495674_0000004 Ga0495674_0000004_158440_158967 173
284 3300047322 Ga0495680_0000160 Ga0495680_0000160_23496_24023 173
285 3300047444 Ga0495675_0000192 Ga0495675_0000192_23426_23953 173
286 3300047471 Ga0495684_0000004 Ga0495684_0000004_139316_139843 173
287 3300047673 Ga0495593_0000362 Ga0495593_0000362_4054_4581 173
288 3300048088 Ga0495602_0000001 Ga0495602_0000001_371273_371800 173
289 3300048913 Ga0496110_0850304 Ga0496110_0850304_98_631 173
290 3300048915 Ga0496112_0060971 Ga0496112_0060971_885_1418 173
291 3300048916 Ga0496113_0260746 Ga0496113_0260746_839_1360 173
292 3300049571 Ga0501034_0584144 Ga0501034_0584144_109_630 173
293 3300049581 Ga0501047_0054763 Ga0501047_0054763_676_1197 173
294 3300049584 Ga0501068_0044933 Ga0501068_0044933_1854_2375 173
295 3300049586 Ga0501070_0102378 Ga0501070_0102378_1003_1524 173
296 3300049586 Ga0501070_0275749 Ga0501070_0275749_759_1280 173
297 3300049586 Ga0501070_0277864 Ga0501070_0277864_336_863 173
298 3300049586 Ga0501070_0282509 Ga0501070_0282509_786_1307 173
299 3300049587 Ga0501071_0052571 Ga0501071_0052571_168_689 173
300 3300049590 Ga0501074_0024770 Ga0501074_0024770_868_1389 173
301 3300049742 Ga0501080_0055509 Ga0501080_0055509_2055_2576 173
302 3300049744 Ga0501083_0129295 Ga0501083_0129295_847_1368 173
303 3300049744 Ga0501083_0135900 Ga0501083_0135900_448_969 173
304 3300050489 nmdc:mga03683_160669_c1 nmdc:mga03683_160669_c1_468_989 173
305 3300050491 nmdc:mga00v17_30510_c1 nmdc:mga00v17_30510_c1_646_1167 173
306 3300050493 nmdc:mga0k408_94877_c1 nmdc:mga0k408_94877_c1_820_1341 173
307 3300050494 nmdc:mga06z11_180439_c1 nmdc:mga06z11_180439_c1_624_1157 173
308 3300050495 nmdc:mga04h51_187449_c1 nmdc:mga04h51_187449_c1_69_602 173
309 3300050496 nmdc:mga07m45_34589_c1 nmdc:mga07m45_34589_c1_480_1001 173
310 3300050496 nmdc:mga07m45_72097_c1 nmdc:mga07m45_72097_c1_1265_1798 173
311 3300050512 nmdc:mga0n895_277879_c1 nmdc:mga0n895_277879_c1_514_1041 173
312 3300053077 Ga0495601_0000078 Ga0495601_0000078_33172_33699 173
313 3300053078 Ga0495612_0000005 Ga0495612_0000005_147554_148081 173
314 3300053079 Ga0500610_0222671 Ga0500610_0222671_14_535 173
315 3300053084 Ga0495595_0000013 Ga0495595_0000013_20980_21507 173
316 3300053085 Ga0495619_0000003 Ga0495619_0000003_376395_376922 173
317 3300053085 Ga0495619_0130120 Ga0495619_0130120_36_569 173
318 3300053087 Ga0500643_001563 Ga0500643_001563_4308_4832 173
319 3300053090 Ga0500646_0032206 Ga0500646_0032206_351_872 173
320 3300053096 Ga0500641_0040104 Ga0500641_0040104_465_998 173
321 3300053119 Ga0500595_000001 Ga0500595_000001_123616_124140 173
322 3300053119 Ga0500595_012237 Ga0500595_012237_2237_2770 173
323 3300053143 Ga0500579_150743 Ga0500579_150743_96_629 173
324 3300053146 Ga0500588_0126030 Ga0500588_0126030_295_816 173

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b46-assembly1.cif.gz_A 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form 0.8327 8 166
6efg-assembly1.cif.gz_B pyruvate decarboxylase from kluyveromyces lactis 0.8321 7 166
8ogh-assembly1.cif.gz_A truncated 1-deoxy-d-xylulose 5-phosphate synthase (dxps) from mycobacterium tuberculosis with butylacetylphosphonate (bap) bound 0.8313 4 160
7a9g-assembly1.cif.gz_BBB truncated 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from mycobacterium tuberculosis with intermediate 2-acetyl-thiamine diphosphate 0.8243 4 161
1y9d-assembly1.cif.gz_C pyruvate oxidase variant v265a from lactobacillus plantarum 0.8124 7 168
ID Description Score Start End Superfamily
af_P58415_1_165_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9469 7 166 3.40.50.970
af_P58415_1_165_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.914 7 166 3.40.50.970
af_A4I3N7_14_187_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8754 8 162 3.40.50.970
af_Q4D595_58_227_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8705 8 162 3.40.50.970
af_A0A0R0ECS7_251_324_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8259 3 73 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A3D0TJG8-F1-model_v4 Phosphonopyruvate decarboxylase 0.9868 7 164 GO:0016831
AF-A0A2D8NRD8-F1-model_v4 deleted 0.9856 7 173
AF-A0A7Z9M8S4-F1-model_v4 Phosphonopyruvate decarboxylase 0.9856 6 158 GO:0016831
AF-A0A4D7BJI1-F1-model_v4 Phosphonopyruvate decarboxylase 0.9851 7 173 GO:0016831
AF-A0A7C2YME8-F1-model_v4 Phosphonopyruvate decarboxylase 0.985 7 173 GO:0016831
GO:0030976

Feature Viewer

pLDDT pTM Quality
91.03 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map