F407268

General Info

Members Datasets Scaffolds Average Seq Length
324 163 648 355

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100010741|Ga0070706_1000107415
Length 375
Sequence MLPLISFTPYPFPASPVRLIMSIANSIKDSVLALRAYTLSPHRASVKLNQNENPWDAPAEIKQETLKRMKDRAWSRYPDFSPQRLHDRLAEFSGWQPDGIIAGNGSNELIQALLMVTIGEGKRVLITEPTFALYRQITTILDGEVVTVPLNHELEFDLAALLKEIEETQPDVTIICSPNNPTGCVISDEELMVLLKAARGLIVVDEAYHEFAGHSTVRLLDRHENLVVLRTFSKAMAMAALRVGYLLASPGLVQEISKAVLPYNLNAFSQIAAEVAIEMFDIRLKPLVEAICAERDRLYEELARIPGLVPVRSRANFMVVHSRIEPKKVFVELLKRDILIRDVSGYPMLSDYFRVSVGTPEENDLLLEALREILK

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
143 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
147 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
148 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
149 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
150 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
151 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
152 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.93
Rhizosphere 98.46
Stem 0
Stem Tuber 0
Unclassified 21.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100010741 3300005467 Bacteria 8497
2 MBSR1b_contig_13698525 2162886012 Unclassified 1369
3 JGI24751J29686_10000074 3300002459 Bacteria 56035
4 JGI25406J46586_10003242 3300003203 Bacteria 7656
5 JGI25406J46586_10024514 3300003203 Bacteria 2362
6 rootL2_10096409 3300003322 Bacteria 4002
7 rootL2_10193992 3300003322 Unclassified 1234
8 Ga0065714_10064450 3300005288 Bacteria 77548
9 Ga0065704_10019211 3300005289 Bacteria 2027
10 Ga0065704_10112235 3300005289 Unclassified 1938
11 Ga0065712_10067784 3300005290 Bacteria 36245
12 Ga0065712_10077762 3300005290 Bacteria 3445
13 Ga0065715_10091873 3300005293 Bacteria 5495
14 Ga0065715_10101185 3300005293 Unclassified 3229
15 Ga0065715_10181919 3300005293 Bacteria 1470
16 Ga0065707_10002958 3300005295 Bacteria 6998
17 Ga0065707_10115687 3300005295 Bacteria 2259
18 Ga0065707_10155347 3300005295 Bacteria 1614
19 Ga0070690_100004186 3300005330 Bacteria 7986
20 Ga0070670_100001763 3300005331 Bacteria 17603
21 Ga0070670_100046852 3300005331 Bacteria 3719
22 Ga0070677_10045291 3300005333 Unclassified 1754
23 Ga0070680_100191802 3300005336 Unclassified 1722
24 Ga0070682_100018191 3300005337 Unclassified 4104
25 Ga0070687_100000398 3300005343 Bacteria 14763
26 Ga0070687_100006141 3300005343 Unclassified 4905
27 Ga0070692_10065123 3300005345 Bacteria 1929
28 Ga0070692_10082479 3300005345 Unclassified 1734
29 Ga0070692_10086896 3300005345 Archaea 1693
30 Ga0070669_100005513 3300005353 Bacteria 9133
31 Ga0070673_100023712 3300005364 Bacteria 4487
32 Ga0070673_100050919 3300005364 Bacteria 3240
33 Ga0070659_100028472 3300005366 Bacteria 4315
34 Ga0070701_10022279 3300005438 Bacteria 3035
35 Ga0070705_100001672 3300005440 Bacteria 11606
36 Ga0070705_100208970 3300005440 Bacteria 1344
37 Ga0070700_100002664 3300005441 Bacteria 9128
38 Ga0070700_100008886 3300005441 Bacteria 5494
39 Ga0070700_100072285 3300005441 Unclassified 2205
40 Ga0070694_100027334 3300005444 Bacteria 3704
41 Ga0070694_100044718 3300005444 Bacteria 2964
42 Ga0070694_100052346 3300005444 Unclassified 2759
43 Ga0070708_100000330 3300005445 Bacteria 35639
44 Ga0070708_100090030 3300005445 Bacteria 2792
45 Ga0070681_10003800 3300005458 Bacteria 14187
46 Ga0070681_10234963 3300005458 Unclassified 1747
47 Ga0068867_100131256 3300005459 Unclassified 1947
48 Ga0070706_100000920 3300005467 Bacteria 32204
49 Ga0070706_100005282 3300005467 Bacteria 12316
50 Ga0070706_100026011 3300005467 Bacteria 5385
51 Ga0070707_100030588 3300005468 Bacteria 5127
52 Ga0070707_100081463 3300005468 Bacteria 3125
53 Ga0070698_100085663 3300005471 Bacteria 3137
54 Ga0070698_100208992 3300005471 Unclassified 1887
55 Ga0070699_100000914 3300005518 Bacteria 27512
56 Ga0070699_100000990 3300005518 Bacteria 26429
57 Ga0070699_100025581 3300005518 Bacteria 5088
58 Ga0070699_100410581 3300005518 Bacteria 1225
59 Ga0070697_100000174 3300005536 Bacteria 52444
60 Ga0070697_100107772 3300005536 Bacteria 2318
61 Ga0068853_100023964 3300005539 Bacteria 5115
62 Ga0070672_100100909 3300005543 Bacteria 2341
63 Ga0070672_100150135 3300005543 Unclassified 1927
64 Ga0070686_100089579 3300005544 Unclassified 2055
65 Ga0070686_100098599 3300005544 Bacteria 1970
66 Ga0070695_100041337 3300005545 Bacteria 2922
67 Ga0070695_100043655 3300005545 Bacteria 2851
68 Ga0070696_100028560 3300005546 Unclassified 3806
69 Ga0070696_100067725 3300005546 Bacteria 2506
70 Ga0070696_100281897 3300005546 Bacteria 1267
71 Ga0070693_100003349 3300005547 Bacteria 7451
72 Ga0070693_100085901 3300005547 Bacteria 1886
73 Ga0070693_100111101 3300005547 Bacteria 1686
74 Ga0070693_100120987 3300005547 Archaea 1623
75 Ga0070704_100050357 3300005549 Bacteria 2927
76 Ga0070704_100084474 3300005549 Unclassified 2347
77 Ga0070704_100203246 3300005549 Unclassified 1601
78 Ga0070664_100152059 3300005564 Unclassified 2044
79 Ga0068854_100160265 3300005578 Unclassified 1742
80 Ga0068854_100170665 3300005578 Bacteria 1692
81 Ga0070702_100037032 3300005615 Unclassified 2707
82 Ga0070702_100129954 3300005615 Bacteria 1589
83 Ga0068852_100414196 3300005616 Bacteria 1328
84 Ga0068859_100006657 3300005617 Bacteria 11735
85 Ga0068859_100017192 3300005617 Bacteria 7262
86 Ga0068859_100019462 3300005617 Bacteria 6819
87 Ga0068859_100019681 3300005617 Bacteria 6779
88 Ga0068859_100043289 3300005617 Bacteria 4525
89 Ga0068859_100175388 3300005617 Bacteria 2225
90 Ga0068859_100240979 3300005617 Bacteria 1897
91 Ga0068859_100316831 3300005617 Unclassified 1653
92 Ga0068859_100340158 3300005617 Bacteria 1595
93 Ga0068859_100501132 3300005617 Unclassified 1309
94 Ga0068864_100042911 3300005618 Bacteria 3871
95 Ga0068864_100066788 3300005618 Unclassified 3122
96 Ga0068864_100067870 3300005618 Unclassified 3097
97 Ga0068861_100005081 3300005719 Bacteria 8876
98 Ga0068861_100129312 3300005719 Unclassified 2048
99 Ga0068861_100260934 3300005719 Bacteria 1483
100 Ga0068851_10003498 3300005834 Bacteria 6991
101 Ga0068870_10092074 3300005840 Unclassified 1697
102 Ga0068863_100176092 3300005841 Bacteria 2053
103 Ga0068863_100340153 3300005841 Bacteria 1460
104 Ga0068858_100018036 3300005842 Bacteria 6610
105 Ga0068858_100068116 3300005842 Bacteria 3298
106 Ga0068858_100102434 3300005842 Bacteria 2670
107 Ga0068858_100117797 3300005842 Bacteria 2482
108 Ga0068858_100157414 3300005842 Bacteria 2138
109 Ga0068858_100207947 3300005842 Bacteria 1852
110 Ga0068860_100015460 3300005843 Bacteria 7451
111 Ga0068860_100101735 3300005843 Bacteria 2741
112 Ga0068860_100166909 3300005843 Bacteria 2125
113 Ga0068862_100021969 3300005844 Bacteria 5337
114 Ga0068862_100022514 3300005844 Bacteria 5271
115 Ga0068862_100032428 3300005844 Bacteria 4414
116 Ga0068862_100267573 3300005844 Bacteria 1562
117 Ga0081455_10004283 3300005937 Bacteria 16063
118 Ga0081455_10028979 3300005937 Bacteria 5052
119 Ga0081540_1130953 3300005983 Unclassified 1024
120 Ga0081539_10000976 3300005985 Bacteria 53364
121 Ga0081539_10003731 3300005985 Bacteria 18117
122 Ga0081539_10020530 3300005985 Bacteria 4459
123 Ga0070716_100096053 3300006173 Bacteria 1805
124 Ga0068871_100065448 3300006358 Bacteria 2977
125 Ga0075428_100032363 3300006844 Bacteria 5776
126 Ga0075428_100234787 3300006844 Bacteria 1979
127 Ga0075431_100315537 3300006847 Unclassified 1577
128 Ga0075433_10100490 3300006852 Unclassified 2561
129 Ga0075434_100226834 3300006871 Bacteria 1887
130 Ga0075434_100302825 3300006871 Bacteria 1619
131 Ga0075429_100090283 3300006880 Bacteria 2671
132 Ga0075436_100048045 3300006914 Bacteria 2945
133 Ga0097620_100006657 3300006931 Bacteria 11735
134 Ga0097620_100017191 3300006931 Bacteria 7262
135 Ga0097620_100019462 3300006931 Bacteria 6819
136 Ga0097620_100019680 3300006931 Bacteria 6779
137 Ga0097620_100043289 3300006931 Bacteria 4525
138 Ga0097620_100175384 3300006931 Bacteria 2225
139 Ga0097620_100240979 3300006931 Bacteria 1897
140 Ga0097620_100316838 3300006931 Unclassified 1653
141 Ga0097620_100340181 3300006931 Bacteria 1595
142 Ga0097620_100501170 3300006931 Unclassified 1309
143 Ga0075435_100029502 3300007076 Bacteria 4305
144 Ga0111539_10013191 3300009094 Bacteria 10332
145 Ga0111539_10049069 3300009094 Bacteria 5037
146 Ga0105245_10119817 3300009098 Bacteria 2457
147 Ga0105247_10040801 3300009101 Bacteria 2839
148 Ga0105247_10047356 3300009101 Bacteria 2640
149 Ga0105247_10227304 3300009101 Unclassified 1265
150 Ga0114129_10025065 3300009147 Bacteria 8453
151 Ga0114129_10026409 3300009147 Bacteria 8222
152 Ga0114129_10061807 3300009147 Bacteria 5234
153 Ga0114129_10066724 3300009147 Bacteria 5018
154 Ga0114129_10198159 3300009147 Bacteria 2722
155 Ga0114129_10209589 3300009147 Bacteria 2635
156 Ga0114129_10293062 3300009147 Bacteria 2171
157 Ga0105243_10333833 3300009148 Bacteria 1386
158 Ga0105243_10420495 3300009148 Unclassified 1246
159 Ga0105243_10455466 3300009148 Unclassified 1201
160 Ga0105241_10244155 3300009174 Bacteria 1519
161 Ga0105242_10011786 3300009176 Bacteria 6728
162 Ga0105242_10017081 3300009176 Bacteria 5650
163 Ga0105242_10038746 3300009176 Bacteria 3834
164 Ga0105242_10131683 3300009176 Unclassified 2160
165 Ga0105248_10028668 3300009177 Bacteria 6204
166 Ga0105248_10036636 3300009177 Bacteria 5487
167 Ga0105248_10163049 3300009177 Unclassified 2513
168 Ga0105248_10174579 3300009177 Bacteria 2422
169 Ga0105248_10401056 3300009177 Bacteria 1544
170 Ga0105248_10436894 3300009177 Bacteria 1474
171 Ga0105248_10567245 3300009177 Unclassified 1281
172 Ga0105248_10605914 3300009177 Bacteria 1236
173 Ga0105237_10001285 3300009545 Bacteria 33426
174 Ga0105249_10009785 3300009553 Bacteria 8399
175 Ga0105249_10017244 3300009553 Bacteria 6409
176 Ga0105239_10117907 3300010375 Bacteria 2946
177 Ga0157373_10007476 3300013100 Bacteria 8129
178 Ga0157374_10240293 3300013296 Bacteria 1781
179 Ga0157378_10030978 3300013297 Bacteria 4723
180 Ga0157378_10227848 3300013297 Bacteria 1774
181 Ga0157378_10246266 3300013297 Unclassified 1710
182 Ga0163162_10000646 3300013306 Bacteria 32306
183 Ga0163162_10016908 3300013306 Bacteria 7132
184 Ga0163162_10052051 3300013306 Bacteria 4111
185 Ga0163162_10177903 3300013306 Bacteria 2253
186 Ga0157372_10191169 3300013307 Bacteria 2371
187 Ga0163163_10000773 3300014325 Bacteria 27136
188 Ga0163163_10021176 3300014325 Bacteria 6132
189 Ga0163163_10113181 3300014325 Bacteria 2743
190 Ga0163163_10361372 3300014325 Bacteria 1508
191 Ga0157380_10007451 3300014326 Bacteria 7769
192 Ga0157380_10021058 3300014326 Bacteria 4886
193 Ga0157380_10055576 3300014326 Unclassified 3145
194 Ga0157380_10158214 3300014326 Bacteria 1966
195 Ga0157379_10158429 3300014968 Unclassified 2043
196 Ga0157376_10029698 3300014969 Unclassified 4357
197 Ga0157376_10052889 3300014969 Bacteria 3379
198 Ga0207697_10004359 3300025315 Bacteria 6771
199 Ga0207656_10006148 3300025321 Unclassified 4298
200 Ga0207653_10002447 3300025885 Bacteria 5899
201 Ga0207647_10005143 3300025904 Bacteria 9627
202 Ga0207645_10029984 3300025907 Bacteria 3505
203 Ga0207643_10100373 3300025908 Unclassified 1697
204 Ga0207684_10000085 3300025910 Bacteria 175922
205 Ga0207684_10011608 3300025910 Bacteria 7697
206 Ga0207684_10017764 3300025910 Bacteria 6102
207 Ga0207684_10053455 3300025910 Bacteria 3428
208 Ga0207684_10080779 3300025910 Bacteria 2766
209 Ga0207654_10131215 3300025911 Bacteria 1586
210 Ga0207707_10008289 3300025912 Bacteria 9018
211 Ga0207695_10076318 3300025913 Bacteria 3407
212 Ga0207671_10010970 3300025914 Bacteria 7423
213 Ga0207671_10043002 3300025914 Bacteria 3342
214 Ga0207662_10014074 3300025918 Bacteria 4481
215 Ga0207662_10046077 3300025918 Bacteria 2578
216 Ga0207646_10176205 3300025922 Bacteria 1931
217 Ga0207646_10302632 3300025922 Unclassified 1445
218 Ga0207646_10312363 3300025922 Bacteria 1420
219 Ga0207694_10019854 3300025924 Bacteria 5083
220 Ga0207650_10170445 3300025925 Bacteria 1730
221 Ga0207659_10106527 3300025926 Bacteria 2123
222 Ga0207690_10015844 3300025932 Bacteria 4576
223 Ga0207706_10129322 3300025933 Bacteria 2221
224 Ga0207686_10000383 3300025934 Bacteria 30902
225 Ga0207686_10150775 3300025934 Unclassified 1618
226 Ga0207709_10005354 3300025935 Bacteria 7301
227 Ga0207670_10000754 3300025936 Bacteria 17010
228 Ga0207665_10032441 3300025939 Bacteria 3458
229 Ga0207691_10024607 3300025940 Bacteria 5663
230 Ga0207691_10086701 3300025940 Bacteria 2809
231 Ga0207711_10049477 3300025941 Bacteria 3599
232 Ga0207711_10154789 3300025941 Bacteria 2071
233 Ga0207711_10164425 3300025941 Bacteria 2011
234 Ga0207711_10180769 3300025941 Bacteria 1918
235 Ga0207689_10068221 3300025942 Unclassified 2923
236 Ga0207679_10099814 3300025945 Bacteria 2267
237 Ga0207651_10091190 3300025960 Bacteria 2231
238 Ga0207651_10129562 3300025960 Unclassified 1929
239 Ga0207712_10031040 3300025961 Bacteria 3596
240 Ga0207712_10076743 3300025961 Unclassified 2420
241 Ga0207640_10123896 3300025981 Unclassified 1857
242 Ga0207658_10113281 3300025986 Bacteria 2149
243 Ga0207677_10040192 3300026023 Bacteria 3081
244 Ga0207703_10034977 3300026035 Bacteria 3991
245 Ga0207703_10202017 3300026035 Bacteria 1767
246 Ga0207639_10179029 3300026041 Bacteria 1802
247 Ga0207708_10000426 3300026075 Bacteria 32859
248 Ga0207708_10002961 3300026075 Bacteria 12514
249 Ga0207708_10015598 3300026075 Bacteria 5698
250 Ga0207708_10042832 3300026075 Bacteria 3450
251 Ga0207708_10042862 3300026075 Bacteria 3448
252 Ga0207708_10108346 3300026075 Unclassified 2155
253 Ga0207641_10204399 3300026088 Bacteria 1823
254 Ga0207641_10218642 3300026088 Bacteria 1765
255 Ga0207641_10307324 3300026088 Bacteria 1500
256 Ga0207648_10052391 3300026089 Bacteria 3568
257 Ga0207648_10122489 3300026089 Unclassified 2287
258 Ga0207648_10191029 3300026089 Bacteria 1815
259 Ga0207676_10032387 3300026095 Bacteria 3938
260 Ga0207676_10036259 3300026095 Bacteria 3750
261 Ga0207676_10179437 3300026095 Bacteria 1853
262 Ga0207676_10221653 3300026095 Bacteria 1685
263 Ga0207676_10244597 3300026095 Bacteria 1611
264 Ga0207674_10316598 3300026116 Unclassified 1510
265 Ga0207674_10319140 3300026116 Bacteria 1503
266 Ga0207675_100017555 3300026118 Bacteria 6677
267 Ga0207675_100126390 3300026118 Bacteria 2421
268 Ga0207675_100156144 3300026118 Unclassified 2174
269 Ga0207698_10142297 3300026142 Bacteria 2069
270 Ga0207428_10043805 3300027907 Bacteria 3613
271 Ga0207428_10164159 3300027907 Unclassified 1685
272 Ga0268265_10215688 3300028380 Bacteria 1676
273 Ga0268264_10018654 3300028381 Bacteria 5672
274 Ga0268264_10025284 3300028381 Bacteria 4851
275 Ga0268264_10348121 3300028381 Unclassified 1409
276 Ga0307405_10001871 3300031731 Bacteria 9038
277 Ga0307410_10002925 3300031852 Bacteria 8416
278 Ga0307406_10004104 3300031901 Bacteria 7928
279 Ga0307406_10076472 3300031901 Unclassified 2212
280 Ga0307407_10024355 3300031903 Bacteria 3173
281 Ga0307412_10001510 3300031911 Bacteria 12923
282 Ga0307409_100044204 3300031995 Bacteria 3353
283 Ga0307416_100008892 3300032002 Bacteria 6523
284 Ga0307414_10003378 3300032004 Bacteria 8522
285 Ga0307411_10068493 3300032005 Unclassified 2392
286 Ga0307415_100002268 3300032126 Bacteria 9535
287 Ga0495621_0047442 3300046539 Bacteria 1527
288 Ga0496109_0000181 3300048912 Bacteria 62664
289 Ga0496112_0112140 3300048915 Bacteria 2697
290 Ga0496113_0034752 3300048916 Bacteria 3681
291 Ga0501298_001898 3300049521 Bacteria 3111
292 Ga0501299_001635 3300049522 Bacteria 2944
293 Ga0501038_0005568 3300049574 Bacteria 11694
294 Ga0501048_0022757 3300049582 Bacteria 4582
295 Ga0501202_002819 3300049652 Bacteria 2945
296 Ga0501216_000878 3300049660 Bacteria 3805
297 Ga0501217_002871 3300049661 Bacteria 3440
298 Ga0501227_000071 3300049665 Bacteria 15600
299 Ga0501235_006910 3300049669 Unclassified 2470
300 Ga0501235_016571 3300049669 Unclassified 1628
301 Ga0501243_009574 3300049675 Unclassified 1506
302 Ga0501225_0001380 3300049705 Bacteria 7575
303 Ga0501081_0171210 3300049743 Bacteria 1568
304 Ga0501226_000455 3300049853 Bacteria 5758
305 nmdc:mga05p37_103865_c1 3300050507 Unclassified 3497
306 nmdc:mga05p37_111804_c1 3300050507 Bacteria 3359
307 nmdc:mga05p37_131544_c1 3300050507 Bacteria 3070
308 nmdc:mga05p37_73949_c1 3300050507 Unclassified 4194
309 nmdc:mga09592_116402_c1 3300050508 Bacteria 2294
310 nmdc:mga09592_25864_c1 3300050508 Bacteria 4860
311 nmdc:mga08y16_15977_c1 3300050511 Bacteria 7890
312 nmdc:mga08y16_304599_c1 3300050511 Unclassified 1642
313 nmdc:mga0n895_423485_c1 3300050512 Bacteria 1346
314 nmdc:mga0rr50_129282_c1 3300050513 Unclassified 2020
315 nmdc:mga0rr50_84833_c1 3300050513 Bacteria 2453
316 nmdc:mga0a205_12324_c1 3300050515 Bacteria 7907
317 nmdc:mga0a205_134713_c1 3300050515 Bacteria 2371
318 nmdc:mga0a205_142969_c1 3300050515 Unclassified 2292
319 nmdc:mga0a205_14894_c1 3300050515 Bacteria 7255
320 nmdc:mga0a205_206197_c1 3300050515 Unclassified 1855
321 nmdc:mga0a205_87074_c1 3300050515 Unclassified 3018
322 Ga0501084_0050129 3300054114 Bacteria 3495
323 Ga0501082_0317242 3300060353 Bacteria 1358
324 Ga0530510_0127900 3300061734 Bacteria 1868
325 Ga0070706_100010741
326 MBSR1b_contig_13698525
327 JGI24751J29686_10000074
328 JGI25406J46586_10003242
329 JGI25406J46586_10024514
330 rootL2_10096409
331 rootL2_10193992
332 Ga0065714_10064450
333 Ga0065704_10019211
334 Ga0065704_10112235
335 Ga0065712_10067784
336 Ga0065712_10077762
337 Ga0065715_10091873
338 Ga0065715_10101185
339 Ga0065715_10181919
340 Ga0065707_10002958
341 Ga0065707_10115687
342 Ga0065707_10155347
343 Ga0070690_100004186
344 Ga0070670_100001763
345 Ga0070670_100046852
346 Ga0070677_10045291
347 Ga0070680_100191802
348 Ga0070682_100018191
349 Ga0070687_100000398
350 Ga0070687_100006141
351 Ga0070692_10065123
352 Ga0070692_10082479
353 Ga0070692_10086896
354 Ga0070669_100005513
355 Ga0070673_100023712
356 Ga0070673_100050919
357 Ga0070659_100028472
358 Ga0070701_10022279
359 Ga0070705_100001672
360 Ga0070705_100208970
361 Ga0070700_100002664
362 Ga0070700_100008886
363 Ga0070700_100072285
364 Ga0070694_100027334
365 Ga0070694_100044718
366 Ga0070694_100052346
367 Ga0070708_100000330
368 Ga0070708_100090030
369 Ga0070681_10003800
370 Ga0070681_10234963
371 Ga0068867_100131256
372 Ga0070706_100000920
373 Ga0070706_100005282
374 Ga0070706_100026011
375 Ga0070707_100030588
376 Ga0070707_100081463
377 Ga0070698_100085663
378 Ga0070698_100208992
379 Ga0070699_100000914
380 Ga0070699_100000990
381 Ga0070699_100025581
382 Ga0070699_100410581
383 Ga0070697_100000174
384 Ga0070697_100107772
385 Ga0068853_100023964
386 Ga0070672_100100909
387 Ga0070672_100150135
388 Ga0070686_100089579
389 Ga0070686_100098599
390 Ga0070695_100041337
391 Ga0070695_100043655
392 Ga0070696_100028560
393 Ga0070696_100067725
394 Ga0070696_100281897
395 Ga0070693_100003349
396 Ga0070693_100085901
397 Ga0070693_100111101
398 Ga0070693_100120987
399 Ga0070704_100050357
400 Ga0070704_100084474
401 Ga0070704_100203246
402 Ga0070664_100152059
403 Ga0068854_100160265
404 Ga0068854_100170665
405 Ga0070702_100037032
406 Ga0070702_100129954
407 Ga0068852_100414196
408 Ga0068859_100006657
409 Ga0068859_100017192
410 Ga0068859_100019462
411 Ga0068859_100019681
412 Ga0068859_100043289
413 Ga0068859_100175388
414 Ga0068859_100240979
415 Ga0068859_100316831
416 Ga0068859_100340158
417 Ga0068859_100501132
418 Ga0068864_100042911
419 Ga0068864_100066788
420 Ga0068864_100067870
421 Ga0068861_100005081
422 Ga0068861_100129312
423 Ga0068861_100260934
424 Ga0068851_10003498
425 Ga0068870_10092074
426 Ga0068863_100176092
427 Ga0068863_100340153
428 Ga0068858_100018036
429 Ga0068858_100068116
430 Ga0068858_100102434
431 Ga0068858_100117797
432 Ga0068858_100157414
433 Ga0068858_100207947
434 Ga0068860_100015460
435 Ga0068860_100101735
436 Ga0068860_100166909
437 Ga0068862_100021969
438 Ga0068862_100022514
439 Ga0068862_100032428
440 Ga0068862_100267573
441 Ga0081455_10004283
442 Ga0081455_10028979
443 Ga0081540_1130953
444 Ga0081539_10000976
445 Ga0081539_10003731
446 Ga0081539_10020530
447 Ga0070716_100096053
448 Ga0068871_100065448
449 Ga0075428_100032363
450 Ga0075428_100234787
451 Ga0075431_100315537
452 Ga0075433_10100490
453 Ga0075434_100226834
454 Ga0075434_100302825
455 Ga0075429_100090283
456 Ga0075436_100048045
457 Ga0097620_100006657
458 Ga0097620_100017191
459 Ga0097620_100019462
460 Ga0097620_100019680
461 Ga0097620_100043289
462 Ga0097620_100175384
463 Ga0097620_100240979
464 Ga0097620_100316838
465 Ga0097620_100340181
466 Ga0097620_100501170
467 Ga0075435_100029502
468 Ga0111539_10013191
469 Ga0111539_10049069
470 Ga0105245_10119817
471 Ga0105247_10040801
472 Ga0105247_10047356
473 Ga0105247_10227304
474 Ga0114129_10025065
475 Ga0114129_10026409
476 Ga0114129_10061807
477 Ga0114129_10066724
478 Ga0114129_10198159
479 Ga0114129_10209589
480 Ga0114129_10293062
481 Ga0105243_10333833
482 Ga0105243_10420495
483 Ga0105243_10455466
484 Ga0105241_10244155
485 Ga0105242_10011786
486 Ga0105242_10017081
487 Ga0105242_10038746
488 Ga0105242_10131683
489 Ga0105248_10028668
490 Ga0105248_10036636
491 Ga0105248_10163049
492 Ga0105248_10174579
493 Ga0105248_10401056
494 Ga0105248_10436894
495 Ga0105248_10567245
496 Ga0105248_10605914
497 Ga0105237_10001285
498 Ga0105249_10009785
499 Ga0105249_10017244
500 Ga0105239_10117907
501 Ga0157373_10007476
502 Ga0157374_10240293
503 Ga0157378_10030978
504 Ga0157378_10227848
505 Ga0157378_10246266
506 Ga0163162_10000646
507 Ga0163162_10016908
508 Ga0163162_10052051
509 Ga0163162_10177903
510 Ga0157372_10191169
511 Ga0163163_10000773
512 Ga0163163_10021176
513 Ga0163163_10113181
514 Ga0163163_10361372
515 Ga0157380_10007451
516 Ga0157380_10021058
517 Ga0157380_10055576
518 Ga0157380_10158214
519 Ga0157379_10158429
520 Ga0157376_10029698
521 Ga0157376_10052889
522 Ga0207697_10004359
523 Ga0207656_10006148
524 Ga0207653_10002447
525 Ga0207647_10005143
526 Ga0207645_10029984
527 Ga0207643_10100373
528 Ga0207684_10000085
529 Ga0207684_10011608
530 Ga0207684_10017764
531 Ga0207684_10053455
532 Ga0207684_10080779
533 Ga0207654_10131215
534 Ga0207707_10008289
535 Ga0207695_10076318
536 Ga0207671_10010970
537 Ga0207671_10043002
538 Ga0207662_10014074
539 Ga0207662_10046077
540 Ga0207646_10176205
541 Ga0207646_10302632
542 Ga0207646_10312363
543 Ga0207694_10019854
544 Ga0207650_10170445
545 Ga0207659_10106527
546 Ga0207690_10015844
547 Ga0207706_10129322
548 Ga0207686_10000383
549 Ga0207686_10150775
550 Ga0207709_10005354
551 Ga0207670_10000754
552 Ga0207665_10032441
553 Ga0207691_10024607
554 Ga0207691_10086701
555 Ga0207711_10049477
556 Ga0207711_10154789
557 Ga0207711_10164425
558 Ga0207711_10180769
559 Ga0207689_10068221
560 Ga0207679_10099814
561 Ga0207651_10091190
562 Ga0207651_10129562
563 Ga0207712_10031040
564 Ga0207712_10076743
565 Ga0207640_10123896
566 Ga0207658_10113281
567 Ga0207677_10040192
568 Ga0207703_10034977
569 Ga0207703_10202017
570 Ga0207639_10179029
571 Ga0207708_10000426
572 Ga0207708_10002961
573 Ga0207708_10015598
574 Ga0207708_10042832
575 Ga0207708_10042862
576 Ga0207708_10108346
577 Ga0207641_10204399
578 Ga0207641_10218642
579 Ga0207641_10307324
580 Ga0207648_10052391
581 Ga0207648_10122489
582 Ga0207648_10191029
583 Ga0207676_10032387
584 Ga0207676_10036259
585 Ga0207676_10179437
586 Ga0207676_10221653
587 Ga0207676_10244597
588 Ga0207674_10316598
589 Ga0207674_10319140
590 Ga0207675_100017555
591 Ga0207675_100126390
592 Ga0207675_100156144
593 Ga0207698_10142297
594 Ga0207428_10043805
595 Ga0207428_10164159
596 Ga0268265_10215688
597 Ga0268264_10018654
598 Ga0268264_10025284
599 Ga0268264_10348121
600 Ga0307405_10001871
601 Ga0307410_10002925
602 Ga0307406_10004104
603 Ga0307406_10076472
604 Ga0307407_10024355
605 Ga0307412_10001510
606 Ga0307409_100044204
607 Ga0307416_100008892
608 Ga0307414_10003378
609 Ga0307411_10068493
610 Ga0307415_100002268
611 Ga0495621_0047442
612 Ga0496109_0000181
613 Ga0496112_0112140
614 Ga0496113_0034752
615 Ga0501298_001898
616 Ga0501299_001635
617 Ga0501038_0005568
618 Ga0501048_0022757
619 Ga0501202_002819
620 Ga0501216_000878
621 Ga0501217_002871
622 Ga0501227_000071
623 Ga0501235_006910
624 Ga0501235_016571
625 Ga0501243_009574
626 Ga0501225_0001380
627 Ga0501081_0171210
628 Ga0501226_000455
629 nmdc:mga05p37_103865_c1
630 nmdc:mga05p37_111804_c1
631 nmdc:mga05p37_131544_c1
632 nmdc:mga05p37_73949_c1
633 nmdc:mga09592_116402_c1
634 nmdc:mga09592_25864_c1
635 nmdc:mga08y16_15977_c1
636 nmdc:mga08y16_304599_c1
637 nmdc:mga0n895_423485_c1
638 nmdc:mga0rr50_129282_c1
639 nmdc:mga0rr50_84833_c1
640 nmdc:mga0a205_12324_c1
641 nmdc:mga0a205_134713_c1
642 nmdc:mga0a205_142969_c1
643 nmdc:mga0a205_14894_c1
644 nmdc:mga0a205_206197_c1
645 nmdc:mga0a205_87074_c1
646 Ga0501084_0050129
647 Ga0501082_0317242
648 Ga0530510_0127900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

43

370

0.94

PF04864

Alliinase_C

Allinase

85

269

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r8d-assembly1.cif.gz_A crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis 0.9288 7 353
3cq5-assembly1.cif.gz_B histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp 0.9282 7 353
3hdo-assembly1.cif.gz_B crystal structure of a histidinol-phosphate aminotransferase from geobacter metallireducens 0.9243 7 353
3ftb-assembly2.cif.gz_E the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum 0.916 26 353
3hdo-assembly1.cif.gz_B crystal structure of a histidinol-phosphate aminotransferase from geobacter metallireducens 0.9141 7 353
ID Description Score Start End Superfamily
3cq4B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9542 268 353 3.90.1150.10
1geyA02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9533 265 347 3.90.1150.10
af_P06986_261_350_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9508 265 348 3.90.1150.10
af_P9WML7_277_364_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9487 266 349 3.90.1150.10
af_Q58365_285_372_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9484 271 353 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A0M9UDI1-F1-model_v4 Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) 0.9758 5 355 GO:0000105
GO:0004400
GO:0030170
AF-A0A2V9JE09-F1-model_v4 Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) 0.973 1 352 GO:0000105
GO:0004400
GO:0030170
AF-A0A832IK73-F1-model_v4 Histidinol-phosphate transaminase (EC 2.6.1.9) 0.9679 1 336 GO:0000105
GO:0004400
GO:0030170
AF-A0A0P1N063-F1-model_v4 Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) 0.9659 1 353 GO:0000105
GO:0004400
GO:0030170
AF-A0A1F9IL65-F1-model_v4 Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) 0.9631 4 355 GO:0000105
GO:0004400
GO:0030170

Map