F407265

General Info

Members Datasets Scaffolds Average Seq Length
324 191 324 160

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10235016|Ga0070681_102350161
Length 174
Sequence LRAARGGANRKAAPSLTAKDVYADPMHKSRDPMQALGETPEKIRELASRWSEAQWNGSYEPGKWTARQILVHLAQTELALTTRVRFALSEENYRAQPFSQDAWMANEAGADGRTALDAYLALRRLNVLLFRSLTPEQRRRPFQHPEYGELNAEWVAAQLAGHDLHHLAQLERIR

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 0
Rhizoplane 1.85
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10045174 3300005290 Bacteria 683
2 Ga0065712_10483172 3300005290 Bacteria 661
3 Ga0065715_10001764 3300005293 Bacteria 6393
4 Ga0065715_10180957 3300005293 Bacteria 1477
5 Ga0065707_10087327 3300005295 Bacteria 5073
6 Ga0065707_10561154 3300005295 Unclassified 711
7 Ga0070676_10006898 3300005328 Bacteria 6079
8 Ga0070690_100068330 3300005330 Bacteria 2304
9 Ga0070690_100611298 3300005330 Bacteria 828
10 Ga0070690_100890419 3300005330 Unclassified 695
11 Ga0068869_100142018 3300005334 Bacteria 1855
12 Ga0070689_100042701 3300005340 Bacteria 3482
13 Ga0070689_100060996 3300005340 Bacteria 2933
14 Ga0070687_100034419 3300005343 Bacteria 2508
15 Ga0070661_100099484 3300005344 Bacteria 2161
16 Ga0070661_100147673 3300005344 Bacteria 1776
17 Ga0070668_100462164 3300005347 Bacteria 1093
18 Ga0070669_100049207 3300005353 Bacteria 3077
19 Ga0070669_100066514 3300005353 Bacteria 2657
20 Ga0070669_100428883 3300005353 Bacteria 1086
21 Ga0070675_100256631 3300005354 Bacteria 1531
22 Ga0070675_101238748 3300005354 Bacteria 687
23 Ga0070675_101647718 3300005354 Unclassified 592
24 Ga0070671_100170462 3300005355 Bacteria 1841
25 Ga0070671_100922238 3300005355 Bacteria 763
26 Ga0070674_100004180 3300005356 Bacteria 8199
27 Ga0070674_100072026 3300005356 Bacteria 2446
28 Ga0070674_100419508 3300005356 Bacteria 1097
29 Ga0070673_100031205 3300005364 Bacteria 3997
30 Ga0070688_100015804 3300005365 Bacteria 4301
31 Ga0070667_100177644 3300005367 Bacteria 1882
32 Ga0070667_100418341 3300005367 Bacteria 1221
33 Ga0070703_10029021 3300005406 Bacteria 1657
34 Ga0070701_10022090 3300005438 Unclassified 3046
35 Ga0070701_10112909 3300005438 Bacteria 1521
36 Ga0070705_100010243 3300005440 Bacteria 4686
37 Ga0070700_100023316 3300005441 Bacteria 3618
38 Ga0070700_100112138 3300005441 Bacteria 1815
39 Ga0070694_100008902 3300005444 Bacteria 6151
40 Ga0070694_100103396 3300005444 Bacteria 2018
41 Ga0070708_100030062 3300005445 Unclassified 4691
42 Ga0070678_100003694 3300005456 Bacteria 8562
43 Ga0070678_100111387 3300005456 Bacteria 2142
44 Ga0070678_100584835 3300005456 Bacteria 995
45 Ga0070678_101716289 3300005456 Bacteria 591
46 Ga0070662_100065605 3300005457 Bacteria 2661
47 Ga0070662_100946810 3300005457 Bacteria 736
48 Ga0070681_10235016 3300005458 Bacteria 1747
49 Ga0068867_100239670 3300005459 Bacteria 1470
50 Ga0068867_100262314 3300005459 Bacteria 1409
51 Ga0070685_10048679 3300005466 Bacteria 2442
52 Ga0070685_10100375 3300005466 Bacteria 1767
53 Ga0070707_100209108 3300005468 Bacteria 1902
54 Ga0070707_100472751 3300005468 Bacteria 1215
55 Ga0070698_100004169 3300005471 Bacteria 15891
56 Ga0070698_100008414 3300005471 Bacteria 11151
57 Ga0070698_101149614 3300005471 Bacteria 725
58 Ga0070699_100125571 3300005518 Bacteria 2258
59 Ga0070697_100690674 3300005536 Bacteria 900
60 Ga0070672_100012101 3300005543 Bacteria 6041
61 Ga0070686_100006661 3300005544 Bacteria 6431
62 Ga0070686_100084663 3300005544 Bacteria 2107
63 Ga0070695_100002747 3300005545 Bacteria 10206
64 Ga0070695_100291073 3300005545 Bacteria 1204
65 Ga0070695_101029279 3300005545 Bacteria 671
66 Ga0070696_100107268 3300005546 Bacteria 2008
67 Ga0070696_100259312 3300005546 Bacteria 1318
68 Ga0070696_100483550 3300005546 Bacteria 982
69 Ga0070693_100039718 3300005547 Bacteria 2638
70 Ga0070704_100025207 3300005549 Bacteria 3913
71 Ga0070704_100220954 3300005549 Bacteria 1540
72 Ga0068855_100279011 3300005563 Unclassified 1856
73 Ga0068857_100299269 3300005577 Bacteria 1483
74 Ga0068854_100007862 3300005578 Bacteria 6822
75 Ga0070702_100014967 3300005615 Bacteria 3948
76 Ga0068852_100447608 3300005616 Bacteria 1278
77 Ga0068852_100890580 3300005616 Bacteria 907
78 Ga0068859_100046548 3300005617 Bacteria 4356
79 Ga0068859_100112100 3300005617 Bacteria 2791
80 Ga0068864_100928808 3300005618 Bacteria 860
81 Ga0068861_100278338 3300005719 Unclassified 1440
82 Ga0068861_100319888 3300005719 Bacteria 1351
83 Ga0068870_10002928 3300005840 Bacteria 7192
84 Ga0068870_10728759 3300005840 Unclassified 687
85 Ga0068863_100073208 3300005841 Bacteria 3241
86 Ga0068863_100156549 3300005841 Unclassified 2182
87 Ga0068858_100281107 3300005842 Bacteria 1585
88 Ga0068858_100946823 3300005842 Unclassified 843
89 Ga0068862_100108519 3300005844 Bacteria 2434
90 Ga0075365_10133851 3300006038 Bacteria 1717
91 Ga0075368_10048081 3300006042 Bacteria 1690
92 Ga0075363_100251884 3300006048 Unclassified 1017
93 Ga0075364_10008936 3300006051 Bacteria 5998
94 Ga0070716_101095149 3300006173 Unclassified 635
95 Ga0075362_10225948 3300006177 Bacteria 916
96 Ga0075367_10002624 3300006178 Bacteria 8264
97 Ga0075366_10006306 3300006195 Bacteria 6488
98 Ga0075366_10140861 3300006195 Bacteria 1458
99 Ga0075366_10225650 3300006195 Bacteria 1141
100 Ga0097621_100136431 3300006237 Bacteria 2093
101 Ga0075370_10339593 3300006353 Bacteria 896
102 Ga0068871_100079479 3300006358 Bacteria 2714
103 Ga0075428_100025403 3300006844 Bacteria 6556
104 Ga0075428_100028777 3300006844 Bacteria 6149
105 Ga0075428_101029824 3300006844 Unclassified 871
106 Ga0075430_100159458 3300006846 Bacteria 1878
107 Ga0075431_100491241 3300006847 Bacteria 1219
108 Ga0075431_100949213 3300006847 Unclassified 828
109 Ga0075433_10043744 3300006852 Unclassified 3889
110 Ga0075433_10078599 3300006852 Bacteria 2907
111 Ga0075433_10203121 3300006852 Unclassified 1762
112 Ga0075433_10885450 3300006852 Unclassified 779
113 Ga0075433_10974872 3300006852 Bacteria 739
114 Ga0075434_100000019 3300006871 Bacteria 73391
115 Ga0075434_100026598 3300006871 Bacteria 5670
116 Ga0075434_100029485 3300006871 Bacteria 5401
117 Ga0075434_100465658 3300006871 Bacteria 1285
118 Ga0075434_100567823 3300006871 Unclassified 1154
119 Ga0075429_100164787 3300006880 Bacteria 1942
120 Ga0075429_100182896 3300006880 Bacteria 1837
121 Ga0075429_100230618 3300006880 Bacteria 1622
122 Ga0075429_100478782 3300006880 Bacteria 1091
123 Ga0075429_101243264 3300006880 Unclassified 650
124 Ga0075436_100000160 3300006914 Bacteria 41885
125 Ga0075436_100016389 3300006914 Bacteria 5071
126 Ga0075436_100432609 3300006914 Bacteria 956
127 Ga0075436_101134992 3300006914 Unclassified 589
128 Ga0097620_100046545 3300006931 Bacteria 4356
129 Ga0097620_100112098 3300006931 Bacteria 2791
130 Ga0075435_100000041 3300007076 Bacteria 66202
131 Ga0075435_100010076 3300007076 Bacteria 6894
132 Ga0075435_100566206 3300007076 Bacteria 984
133 Ga0075435_100776278 3300007076 Bacteria 834
134 Ga0099794_10452413 3300007265 Bacteria 673
135 Ga0105240_10188145 3300009093 Unclassified 2430
136 Ga0111539_10092037 3300009094 Bacteria 3563
137 Ga0105245_10668288 3300009098 Bacteria 1070
138 Ga0105245_10693795 3300009098 Bacteria 1051
139 Ga0114129_10017195 3300009147 Bacteria 10301
140 Ga0114129_10026239 3300009147 Bacteria 8252
141 Ga0114129_10052262 3300009147 Bacteria 5735
142 Ga0114129_10309419 3300009147 Bacteria 2103
143 Ga0105243_10189483 3300009148 Bacteria 1795
144 Ga0105241_10318745 3300009174 Bacteria 1340
145 Ga0105248_10018671 3300009177 Bacteria 7666
146 Ga0105248_10020246 3300009177 Bacteria 7370
147 Ga0105248_10509876 3300009177 Unclassified 1356
148 Ga0105248_10767557 3300009177 Bacteria 1088
149 Ga0105248_11591798 3300009177 Bacteria 740
150 Ga0105249_10007162 3300009553 Bacteria 9738
151 Ga0105249_10128718 3300009553 Bacteria 2414
152 Ga0105239_10164540 3300010375 Bacteria 2480
153 Ga0105246_10843920 3300011119 Unclassified 817
154 Ga0157370_10196081 3300013104 Bacteria 1874
155 Ga0157369_10924424 3300013105 Bacteria 894
156 Ga0163162_10145993 3300013306 Bacteria 2482
157 Ga0157375_10291738 3300013308 Bacteria 1794
158 Ga0163163_10681266 3300014325 Bacteria 1092
159 Ga0157380_10000616 3300014326 Bacteria 21930
160 Ga0157380_10007312 3300014326 Bacteria 7838
161 Ga0157380_10175185 3300014326 Bacteria 1878
162 Ga0157380_10452141 3300014326 Bacteria 1234
163 Ga0157380_10571178 3300014326 Bacteria 1113
164 Ga0157380_12867223 3300014326 Unclassified 548
165 Ga0157377_10450044 3300014745 Unclassified 889
166 Ga0157379_10262772 3300014968 Bacteria 1569
167 Ga0157379_11061069 3300014968 Bacteria 775
168 Ga0157376_10311964 3300014969 Bacteria 1492
169 Ga0207697_10039844 3300025315 Bacteria 1928
170 Ga0207656_10423218 3300025321 Bacteria 671
171 Ga0207682_10006053 3300025893 Unclassified 4892
172 Ga0207682_10032108 3300025893 Bacteria 2110
173 Ga0207688_10056169 3300025901 Bacteria 2211
174 Ga0207688_10297312 3300025901 Bacteria 986
175 Ga0207680_10391340 3300025903 Bacteria 981
176 Ga0207645_10054513 3300025907 Bacteria 2553
177 Ga0207643_10000586 3300025908 Bacteria 23097
178 Ga0207654_10223324 3300025911 Bacteria 1251
179 Ga0207707_10226042 3300025912 Bacteria 1629
180 Ga0207657_10189278 3300025919 Unclassified 1661
181 Ga0207649_10039377 3300025920 Bacteria 2866
182 Ga0207649_10188810 3300025920 Bacteria 1447
183 Ga0207646_10133897 3300025922 Bacteria 2232
184 Ga0207646_10457764 3300025922 Bacteria 1151
185 Ga0207646_11135104 3300025922 Bacteria 687
186 Ga0207681_10184304 3300025923 Bacteria 1592
187 Ga0207681_10249798 3300025923 Bacteria 1384
188 Ga0207681_10402477 3300025923 Bacteria 1106
189 Ga0207659_10000495 3300025926 Bacteria 23739
190 Ga0207659_10096068 3300025926 Bacteria 2224
191 Ga0207659_10355822 3300025926 Bacteria 1216
192 Ga0207644_10027834 3300025931 Bacteria 3907
193 Ga0207644_10134631 3300025931 Bacteria 1896
194 Ga0207690_10164663 3300025932 Bacteria 1656
195 Ga0207706_10202109 3300025933 Bacteria 1743
196 Ga0207686_10095782 3300025934 Bacteria 1970
197 Ga0207709_10108386 3300025935 Bacteria 1852
198 Ga0207670_10037919 3300025936 Bacteria 3144
199 Ga0207670_11122101 3300025936 Bacteria 664
200 Ga0207669_10000542 3300025937 Bacteria 16430
201 Ga0207669_10060399 3300025937 Bacteria 2324
202 Ga0207669_10100078 3300025937 Bacteria 1914
203 Ga0207704_10219465 3300025938 Bacteria 1406
204 Ga0207665_10944265 3300025939 Bacteria 685
205 Ga0207691_10006977 3300025940 Bacteria 10899
206 Ga0207691_10439583 3300025940 Bacteria 1111
207 Ga0207711_10055138 3300025941 Bacteria 3413
208 Ga0207711_10824682 3300025941 Bacteria 864
209 Ga0207711_10849122 3300025941 Bacteria 850
210 Ga0207689_10173671 3300025942 Bacteria 1777
211 Ga0207679_10018474 3300025945 Bacteria 4671
212 Ga0207667_10238227 3300025949 Unclassified 1862
213 Ga0207651_10172887 3300025960 Bacteria 1705
214 Ga0207712_10336492 3300025961 Bacteria 1250
215 Ga0207668_10146749 3300025972 Bacteria 1821
216 Ga0207640_10028655 3300025981 Bacteria 3407
217 Ga0207658_10564168 3300025986 Bacteria 1020
218 Ga0207703_10036611 3300026035 Bacteria 3907
219 Ga0207703_11094242 3300026035 Bacteria 765
220 Ga0207678_10207154 3300026067 Bacteria 1677
221 Ga0207708_10021427 3300026075 Bacteria 4874
222 Ga0207708_10036827 3300026075 Bacteria 3726
223 Ga0207702_10695250 3300026078 Bacteria 1002
224 Ga0207641_10050607 3300026088 Bacteria 3515
225 Ga0207648_10011300 3300026089 Bacteria 8417
226 Ga0207648_10137453 3300026089 Bacteria 2153
227 Ga0207676_10199729 3300026095 Bacteria 1766
228 Ga0207676_11306583 3300026095 Bacteria 720
229 Ga0207675_100112990 3300026118 Bacteria 2564
230 Ga0207683_10010838 3300026121 Bacteria 7774
231 Ga0207683_10034828 3300026121 Bacteria 4378
232 Ga0207683_10260070 3300026121 Bacteria 1585
233 Ga0207698_10351544 3300026142 Bacteria 1392
234 Ga0207428_10006512 3300027907 Bacteria 10776
235 Ga0268265_11331638 3300028380 Bacteria 719
236 Ga0307408_100324019 3300031548 Unclassified 1299
237 Ga0307408_100801130 3300031548 Bacteria 855
238 Ga0307413_11171066 3300031824 Bacteria 667
239 Ga0307410_10574006 3300031852 Bacteria 938
240 Ga0307409_100760098 3300031995 Bacteria 974
241 Ga0307409_101167480 3300031995 Bacteria 793
242 Ga0307416_100616154 3300032002 Bacteria 1167
243 Ga0373949_0122504 3300035090 Bacteria 731
244 Ga0373951_0032422 3300035091 Bacteria 1236
245 Ga0373939_0084782 3300035114 Bacteria 1060
246 Ga0450896_008875 3300042133 Bacteria 1396
247 Ga0439435_0242658 3300042436 Bacteria 605
248 Ga0450918_009046 3300042531 Bacteria 1748
249 Ga0451577_0018105 3300042876 Bacteria 6493
250 Ga0453684_0075341 3300044712 Bacteria 4242
251 Ga0466967_0340134 3300045976 Bacteria 1451
252 Ga0466967_0902812 3300045976 Unclassified 879
253 Ga0495611_0385840 3300046648 Bacteria 641
254 Ga0495604_0775981 3300047317 Unclassified 605
255 Ga0496101_0556695 3300048904 Bacteria 907
256 Ga0496106_0169669 3300048909 Bacteria 1729
257 Ga0496107_0407103 3300048910 Bacteria 1012
258 Ga0496109_1944747 3300048912 Bacteria 520
259 Ga0496112_0166642 3300048915 Bacteria 2169
260 Ga0496112_0569481 3300048915 Bacteria 1066
261 Ga0501031_0290955 3300049568 Bacteria 1059
262 Ga0501034_0121360 3300049571 Unclassified 2600
263 Ga0501036_0174065 3300049572 Bacteria 1813
264 Ga0501037_0625200 3300049573 Bacteria 721
265 Ga0501040_0105790 3300049576 Bacteria 1966
266 Ga0501040_1026782 3300049576 Unclassified 598
267 Ga0501041_0079376 3300049577 Bacteria 2020
268 Ga0501047_0172995 3300049581 Bacteria 2028
269 Ga0501048_0148236 3300049582 Bacteria 1659
270 Ga0501067_0339703 3300049583 Unclassified 837
271 Ga0501071_0019435 3300049587 Bacteria 4714
272 Ga0501072_0147124 3300049588 Bacteria 1878
273 Ga0501074_0486693 3300049590 Unclassified 874
274 Ga0501075_0024911 3300049591 Bacteria 4393
275 Ga0501075_1401623 3300049591 Unclassified 529
276 Ga0501079_0225440 3300049741 Bacteria 1464
277 Ga0501080_1444607 3300049742 Archaea 586
278 Ga0501045_0020822 3300049824 Bacteria 4687
279 Ga0501045_0082828 3300049824 Bacteria 2366
280 Ga0501045_0586551 3300049824 Unclassified 826
281 Ga0501045_0921912 3300049824 Bacteria 641
282 nmdc:mga03683_312978_c1 3300050489 Unclassified 738
283 nmdc:mga00v17_4326_c1 3300050491 Bacteria 7376
284 nmdc:mga0yw44_65710_c1 3300050492 Bacteria 1937
285 nmdc:mga0k408_152201_c1 3300050493 Bacteria 1378
286 nmdc:mga0k408_222942_c1 3300050493 Unclassified 1125
287 nmdc:mga06z11_305603_c1 3300050494 Bacteria 946
288 nmdc:mga04h51_135328_c1 3300050495 Unclassified 930
289 nmdc:mga04h51_97392_c1 3300050495 Bacteria 1067
290 nmdc:mga05p37_23262_c1 3300050507 Bacteria 7517
291 nmdc:mga05p37_348758_c1 3300050507 Bacteria 1743
292 nmdc:mga05p37_60499_c1 3300050507 Bacteria 4663
293 nmdc:mga05p37_891143_c1 3300050507 Bacteria 961
294 nmdc:mga05p37_979418_c1 3300050507 Bacteria 901
295 nmdc:mga09592_176589_c1 3300050508 Bacteria 1847
296 nmdc:mga09592_220973_c1 3300050508 Bacteria 1641
297 nmdc:mga09592_53479_c1 3300050508 Bacteria 3409
298 nmdc:mga0qj67_331330_c1 3300050509 Unclassified 1232
299 nmdc:mga06r32_1125621_c1 3300050510 Bacteria 733
300 nmdc:mga08y16_1363987_c1 3300050511 Unclassified 673
301 nmdc:mga08y16_152247_c1 3300050511 Bacteria 2404
302 nmdc:mga08y16_280856_c1 3300050511 Bacteria 1717
303 nmdc:mga0n895_237354_c1 3300050512 Bacteria 1850
304 nmdc:mga0n895_467523_c1 3300050512 Bacteria 1272
305 nmdc:mga0n895_73465_c1 3300050512 Unclassified 3395
306 nmdc:mga0n895_74988_c1 3300050512 Bacteria 3362
307 nmdc:mga0n895_81_c1 3300050512 Bacteria 54736
308 nmdc:mga0rr50_1054834_c1 3300050513 Unclassified 692
309 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
310 nmdc:mga0rr50_29040_c1 3300050513 Bacteria 3895
311 nmdc:mga0rr50_349890_c1 3300050513 Bacteria 1243
312 nmdc:mga0rr50_631101_c1 3300050513 Bacteria 914
313 nmdc:mga08x19_265_c1 3300050514 Bacteria 39740
314 nmdc:mga08x19_290731_c1 3300050514 Bacteria 1134
315 nmdc:mga0a205_1493661_c1 3300050515 Bacteria 524
316 nmdc:mga0a205_25115_c1 3300050515 Bacteria 5673
317 nmdc:mga0a205_34582_c2 3300050515 Bacteria 4443
318 nmdc:mga0a205_856216_c1 3300050515 Bacteria 756
319 nmdc:mga0a205_92323_c1 3300050515 Bacteria 2925
320 Ga0501084_0317716 3300054114 Bacteria 1315
321 Ga0590077_008274 3300059426 Bacteria 2130
322 Ga0501082_0442578 3300060353 Bacteria 1135
323 Ga0501082_0816925 3300060353 Bacteria 815
324 Ga0530510_0627762 3300061734 Archaea 818

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0775981 Ga0495604_0775981_181_582 129
2 3300049591 Ga0501075_1401623 Ga0501075_1401623_16_432 138
3 3300025321 Ga0207656_10423218 Ga0207656_104232181 139
4 3300005471 Ga0070698_100008414 Ga0070698_1000084144 141
5 3300028380 Ga0268265_11331638 Ga0268265_113316381 141
6 3300006844 Ga0075428_101029824 Ga0075428_1010298243 145
7 3300006847 Ga0075431_100491241 Ga0075431_1004912413 145
8 3300005295 Ga0065707_10561154 Ga0065707_105611541 146
9 3300006852 Ga0075433_10974872 Ga0075433_109748721 147
10 3300050515 nmdc:mga0a205_856216_c1 nmdc:mga0a205_856216_c1_35_514 147
11 3300050508 nmdc:mga09592_176589_c1 nmdc:mga09592_176589_c1_824_1276 148
12 3300005471 Ga0070698_101149614 Ga0070698_1011496142 150
13 3300014325 Ga0163163_10681266 Ga0163163_106812662 151
14 3300050510 nmdc:mga06r32_1125621_c1 nmdc:mga06r32_1125621_c1_112_603 151
15 3300031548 Ga0307408_100324019 Ga0307408_1003240192 153
16 3300059426 Ga0590077_008274 Ga0590077_008274_1561_2046 154
17 3300005456 Ga0070678_101716289 Ga0070678_1017162891 155
18 3300005719 Ga0068861_100278338 Ga0068861_1002783382 155
19 3300006852 Ga0075433_10203121 Ga0075433_102031212 156
20 3300006871 Ga0075434_100465658 Ga0075434_1004656581 156
21 3300007076 Ga0075435_100566206 Ga0075435_1005662062 156
22 3300009147 Ga0114129_10052262 Ga0114129_100522623 156
23 3300026078 Ga0207702_10695250 Ga0207702_106952501 156
24 3300031548 Ga0307408_100801130 Ga0307408_1008011301 156
25 3300031852 Ga0307410_10574006 Ga0307410_105740061 156
26 3300031995 Ga0307409_101167480 Ga0307409_1011674802 156
27 3300032002 Ga0307416_100616154 Ga0307416_1006161542 156
28 3300045976 Ga0466967_0340134 Ga0466967_0340134_57_530 156
29 3300046648 Ga0495611_0385840 Ga0495611_0385840_29_523 156
30 3300050507 nmdc:mga05p37_891143_c1 nmdc:mga05p37_891143_c1_302_781 156
31 3300050511 nmdc:mga08y16_280856_c1 nmdc:mga08y16_280856_c1_147_617 156
32 3300050512 nmdc:mga0n895_467523_c1 nmdc:mga0n895_467523_c1_680_1168 156
33 3300050515 nmdc:mga0a205_34582_c2 nmdc:mga0a205_34582_c2_3746_4225 156
34 3300005290 Ga0065712_10045174 Ga0065712_100451741 157
35 3300005290 Ga0065712_10483172 Ga0065712_104831721 157
36 3300005293 Ga0065715_10001764 Ga0065715_100017642 157
37 3300005293 Ga0065715_10180957 Ga0065715_101809571 157
38 3300005295 Ga0065707_10087327 Ga0065707_100873273 157
39 3300005328 Ga0070676_10006898 Ga0070676_100068981 157
40 3300005330 Ga0070690_100068330 Ga0070690_1000683302 157
41 3300005330 Ga0070690_100611298 Ga0070690_1006112982 157
42 3300005330 Ga0070690_100890419 Ga0070690_1008904191 157
43 3300005334 Ga0068869_100142018 Ga0068869_1001420181 157
44 3300005340 Ga0070689_100042701 Ga0070689_1000427012 157
45 3300005340 Ga0070689_100060996 Ga0070689_1000609962 157
46 3300005343 Ga0070687_100034419 Ga0070687_1000344192 157
47 3300005344 Ga0070661_100099484 Ga0070661_1000994842 157
48 3300005344 Ga0070661_100147673 Ga0070661_1001476732 157
49 3300005347 Ga0070668_100462164 Ga0070668_1004621642 157
50 3300005353 Ga0070669_100049207 Ga0070669_1000492072 157
51 3300005353 Ga0070669_100066514 Ga0070669_1000665142 157
52 3300005353 Ga0070669_100428883 Ga0070669_1004288832 157
53 3300005354 Ga0070675_100256631 Ga0070675_1002566312 157
54 3300005354 Ga0070675_101238748 Ga0070675_1012387481 157
55 3300005354 Ga0070675_101647718 Ga0070675_1016477181 157
56 3300005355 Ga0070671_100170462 Ga0070671_1001704623 157
57 3300005355 Ga0070671_100922238 Ga0070671_1009222381 157
58 3300005356 Ga0070674_100004180 Ga0070674_1000041802 157
59 3300005356 Ga0070674_100072026 Ga0070674_1000720262 157
60 3300005356 Ga0070674_100419508 Ga0070674_1004195081 157
61 3300005364 Ga0070673_100031205 Ga0070673_1000312054 157
62 3300005365 Ga0070688_100015804 Ga0070688_1000158044 157
63 3300005367 Ga0070667_100177644 Ga0070667_1001776442 157
64 3300005367 Ga0070667_100418341 Ga0070667_1004183411 157
65 3300005406 Ga0070703_10029021 Ga0070703_100290212 157
66 3300005438 Ga0070701_10022090 Ga0070701_100220903 157
67 3300005438 Ga0070701_10112909 Ga0070701_101129091 157
68 3300005440 Ga0070705_100010243 Ga0070705_1000102432 157
69 3300005441 Ga0070700_100023316 Ga0070700_1000233162 157
70 3300005441 Ga0070700_100112138 Ga0070700_1001121382 157
71 3300005444 Ga0070694_100008902 Ga0070694_1000089023 157
72 3300005444 Ga0070694_100103396 Ga0070694_1001033962 157
73 3300005445 Ga0070708_100030062 Ga0070708_1000300622 157
74 3300005456 Ga0070678_100003694 Ga0070678_1000036945 157
75 3300005456 Ga0070678_100111387 Ga0070678_1001113872 157
76 3300005456 Ga0070678_100584835 Ga0070678_1005848352 157
77 3300005457 Ga0070662_100065605 Ga0070662_1000656053 157
78 3300005457 Ga0070662_100946810 Ga0070662_1009468101 157
79 3300005458 Ga0070681_10235016 Ga0070681_102350161 157
80 3300005459 Ga0068867_100239670 Ga0068867_1002396702 157
81 3300005459 Ga0068867_100262314 Ga0068867_1002623141 157
82 3300005466 Ga0070685_10048679 Ga0070685_100486792 157
83 3300005466 Ga0070685_10100375 Ga0070685_101003752 157
84 3300005468 Ga0070707_100209108 Ga0070707_1002091082 157
85 3300005468 Ga0070707_100472751 Ga0070707_1004727511 157
86 3300005471 Ga0070698_100004169 Ga0070698_1000041696 157
87 3300005518 Ga0070699_100125571 Ga0070699_1001255712 157
88 3300005536 Ga0070697_100690674 Ga0070697_1006906742 157
89 3300005543 Ga0070672_100012101 Ga0070672_1000121016 157
90 3300005544 Ga0070686_100006661 Ga0070686_1000066611 157
91 3300005544 Ga0070686_100084663 Ga0070686_1000846633 157
92 3300005545 Ga0070695_100002747 Ga0070695_1000027474 157
93 3300005545 Ga0070695_100291073 Ga0070695_1002910732 157
94 3300005545 Ga0070695_101029279 Ga0070695_1010292791 157
95 3300005546 Ga0070696_100107268 Ga0070696_1001072682 157
96 3300005546 Ga0070696_100259312 Ga0070696_1002593122 157
97 3300005546 Ga0070696_100483550 Ga0070696_1004835501 157
98 3300005547 Ga0070693_100039718 Ga0070693_1000397182 157
99 3300005549 Ga0070704_100025207 Ga0070704_1000252072 157
100 3300005549 Ga0070704_100220954 Ga0070704_1002209542 157
101 3300005563 Ga0068855_100279011 Ga0068855_1002790111 157
102 3300005577 Ga0068857_100299269 Ga0068857_1002992692 157
103 3300005578 Ga0068854_100007862 Ga0068854_1000078624 157
104 3300005615 Ga0070702_100014967 Ga0070702_1000149672 157
105 3300005616 Ga0068852_100447608 Ga0068852_1004476082 157
106 3300005616 Ga0068852_100890580 Ga0068852_1008905801 157
107 3300005617 Ga0068859_100046548 Ga0068859_1000465482 157
108 3300005617 Ga0068859_100112100 Ga0068859_1001121002 157
109 3300005618 Ga0068864_100928808 Ga0068864_1009288081 157
110 3300005719 Ga0068861_100319888 Ga0068861_1003198881 157
111 3300005840 Ga0068870_10002928 Ga0068870_100029287 157
112 3300005840 Ga0068870_10728759 Ga0068870_107287592 157
113 3300005841 Ga0068863_100073208 Ga0068863_1000732082 157
114 3300005841 Ga0068863_100156549 Ga0068863_1001565492 157
115 3300005842 Ga0068858_100281107 Ga0068858_1002811072 157
116 3300005842 Ga0068858_100946823 Ga0068858_1009468232 157
117 3300005844 Ga0068862_100108519 Ga0068862_1001085192 157
118 3300006038 Ga0075365_10133851 Ga0075365_101338512 157
119 3300006042 Ga0075368_10048081 Ga0075368_100480812 157
120 3300006048 Ga0075363_100251884 Ga0075363_1002518842 157
121 3300006051 Ga0075364_10008936 Ga0075364_100089362 157
122 3300006173 Ga0070716_101095149 Ga0070716_1010951491 157
123 3300006177 Ga0075362_10225948 Ga0075362_102259482 157
124 3300006178 Ga0075367_10002624 Ga0075367_100026242 157
125 3300006195 Ga0075366_10006306 Ga0075366_100063062 157
126 3300006195 Ga0075366_10140861 Ga0075366_101408612 157
127 3300006195 Ga0075366_10225650 Ga0075366_102256502 157
128 3300006237 Ga0097621_100136431 Ga0097621_1001364312 157
129 3300006353 Ga0075370_10339593 Ga0075370_103395932 157
130 3300006358 Ga0068871_100079479 Ga0068871_1000794792 157
131 3300006844 Ga0075428_100025403 Ga0075428_1000254033 157
132 3300006844 Ga0075428_100028777 Ga0075428_1000287772 157
133 3300006846 Ga0075430_100159458 Ga0075430_1001594582 157
134 3300006847 Ga0075431_100949213 Ga0075431_1009492131 157
135 3300006852 Ga0075433_10043744 Ga0075433_100437442 157
136 3300006852 Ga0075433_10078599 Ga0075433_100785992 157
137 3300006852 Ga0075433_10885450 Ga0075433_108854501 157
138 3300006871 Ga0075434_100000019 Ga0075434_10000001946 157
139 3300006871 Ga0075434_100026598 Ga0075434_1000265982 157
140 3300006871 Ga0075434_100029485 Ga0075434_1000294852 157
141 3300006871 Ga0075434_100567823 Ga0075434_1005678232 157
142 3300006880 Ga0075429_100164787 Ga0075429_1001647872 157
143 3300006880 Ga0075429_100182896 Ga0075429_1001828962 157
144 3300006880 Ga0075429_100230618 Ga0075429_1002306182 157
145 3300006880 Ga0075429_100478782 Ga0075429_1004787821 157
146 3300006880 Ga0075429_101243264 Ga0075429_1012432641 157
147 3300006914 Ga0075436_100000160 Ga0075436_1000001609 157
148 3300006914 Ga0075436_100016389 Ga0075436_1000163892 157
149 3300006914 Ga0075436_100432609 Ga0075436_1004326092 157
150 3300006914 Ga0075436_101134992 Ga0075436_1011349921 157
151 3300006931 Ga0097620_100046545 Ga0097620_1000465452 157
152 3300006931 Ga0097620_100112098 Ga0097620_1001120982 157
153 3300007076 Ga0075435_100000041 Ga0075435_10000004112 157
154 3300007076 Ga0075435_100010076 Ga0075435_1000100763 157
155 3300007076 Ga0075435_100776278 Ga0075435_1007762781 157
156 3300007265 Ga0099794_10452413 Ga0099794_104524131 157
157 3300009093 Ga0105240_10188145 Ga0105240_101881451 157
158 3300009094 Ga0111539_10092037 Ga0111539_100920372 157
159 3300009098 Ga0105245_10668288 Ga0105245_106682882 157
160 3300009098 Ga0105245_10693795 Ga0105245_106937952 157
161 3300009147 Ga0114129_10017195 Ga0114129_100171954 157
162 3300009147 Ga0114129_10026239 Ga0114129_100262392 157
163 3300009147 Ga0114129_10309419 Ga0114129_103094192 157
164 3300009148 Ga0105243_10189483 Ga0105243_101894832 157
165 3300009174 Ga0105241_10318745 Ga0105241_103187452 157
166 3300009177 Ga0105248_10018671 Ga0105248_100186714 157
167 3300009177 Ga0105248_10020246 Ga0105248_100202468 157
168 3300009177 Ga0105248_10509876 Ga0105248_105098762 157
169 3300009177 Ga0105248_10767557 Ga0105248_107675572 157
170 3300009177 Ga0105248_11591798 Ga0105248_115917981 157
171 3300009553 Ga0105249_10007162 Ga0105249_100071622 157
172 3300009553 Ga0105249_10128718 Ga0105249_101287182 157
173 3300010375 Ga0105239_10164540 Ga0105239_101645402 157
174 3300011119 Ga0105246_10843920 Ga0105246_108439202 157
175 3300013104 Ga0157370_10196081 Ga0157370_101960812 157
176 3300013105 Ga0157369_10924424 Ga0157369_109244241 157
177 3300013306 Ga0163162_10145993 Ga0163162_101459932 157
178 3300013308 Ga0157375_10291738 Ga0157375_102917382 157
179 3300014326 Ga0157380_10000616 Ga0157380_1000061621 157
180 3300014326 Ga0157380_10007312 Ga0157380_100073129 157
181 3300014326 Ga0157380_10175185 Ga0157380_101751853 157
182 3300014326 Ga0157380_10452141 Ga0157380_104521413 157
183 3300014326 Ga0157380_10571178 Ga0157380_105711782 157
184 3300014326 Ga0157380_12867223 Ga0157380_128672231 157
185 3300014745 Ga0157377_10450044 Ga0157377_104500441 157
186 3300014968 Ga0157379_10262772 Ga0157379_102627722 157
187 3300014968 Ga0157379_11061069 Ga0157379_110610692 157
188 3300014969 Ga0157376_10311964 Ga0157376_103119642 157
189 3300025315 Ga0207697_10039844 Ga0207697_100398442 157
190 3300025893 Ga0207682_10006053 Ga0207682_100060534 157
191 3300025893 Ga0207682_10032108 Ga0207682_100321082 157
192 3300025901 Ga0207688_10056169 Ga0207688_100561693 157
193 3300025901 Ga0207688_10297312 Ga0207688_102973122 157
194 3300025903 Ga0207680_10391340 Ga0207680_103913402 157
195 3300025907 Ga0207645_10054513 Ga0207645_100545132 157
196 3300025908 Ga0207643_10000586 Ga0207643_100005862 157
197 3300025911 Ga0207654_10223324 Ga0207654_102233242 157
198 3300025912 Ga0207707_10226042 Ga0207707_102260421 157
199 3300025919 Ga0207657_10189278 Ga0207657_101892782 157
200 3300025920 Ga0207649_10039377 Ga0207649_100393773 157
201 3300025920 Ga0207649_10188810 Ga0207649_101888102 157
202 3300025922 Ga0207646_10133897 Ga0207646_101338972 157
203 3300025922 Ga0207646_10457764 Ga0207646_104577642 157
204 3300025922 Ga0207646_11135104 Ga0207646_111351041 157
205 3300025923 Ga0207681_10184304 Ga0207681_101843041 157
206 3300025923 Ga0207681_10249798 Ga0207681_102497982 157
207 3300025923 Ga0207681_10402477 Ga0207681_104024772 157
208 3300025926 Ga0207659_10000495 Ga0207659_1000049519 157
209 3300025926 Ga0207659_10096068 Ga0207659_100960683 157
210 3300025926 Ga0207659_10355822 Ga0207659_103558222 157
211 3300025931 Ga0207644_10027834 Ga0207644_100278343 157
212 3300025931 Ga0207644_10134631 Ga0207644_101346312 157
213 3300025932 Ga0207690_10164663 Ga0207690_101646631 157
214 3300025933 Ga0207706_10202109 Ga0207706_102021093 157
215 3300025934 Ga0207686_10095782 Ga0207686_100957822 157
216 3300025935 Ga0207709_10108386 Ga0207709_101083861 157
217 3300025936 Ga0207670_10037919 Ga0207670_100379192 157
218 3300025936 Ga0207670_11122101 Ga0207670_111221011 157
219 3300025937 Ga0207669_10000542 Ga0207669_100005426 157
220 3300025937 Ga0207669_10060399 Ga0207669_100603992 157
221 3300025937 Ga0207669_10100078 Ga0207669_101000783 157
222 3300025938 Ga0207704_10219465 Ga0207704_102194652 157
223 3300025939 Ga0207665_10944265 Ga0207665_109442651 157
224 3300025940 Ga0207691_10006977 Ga0207691_100069775 157
225 3300025940 Ga0207691_10439583 Ga0207691_104395832 157
226 3300025941 Ga0207711_10055138 Ga0207711_100551382 157
227 3300025941 Ga0207711_10824682 Ga0207711_108246821 157
228 3300025941 Ga0207711_10849122 Ga0207711_108491222 157
229 3300025942 Ga0207689_10173671 Ga0207689_101736712 157
230 3300025945 Ga0207679_10018474 Ga0207679_100184742 157
231 3300025949 Ga0207667_10238227 Ga0207667_102382271 157
232 3300025960 Ga0207651_10172887 Ga0207651_101728872 157
233 3300025961 Ga0207712_10336492 Ga0207712_103364922 157
234 3300025972 Ga0207668_10146749 Ga0207668_101467492 157
235 3300025981 Ga0207640_10028655 Ga0207640_100286552 157
236 3300025986 Ga0207658_10564168 Ga0207658_105641681 157
237 3300026035 Ga0207703_10036611 Ga0207703_100366112 157
238 3300026035 Ga0207703_11094242 Ga0207703_110942422 157
239 3300026067 Ga0207678_10207154 Ga0207678_102071541 157
240 3300026075 Ga0207708_10021427 Ga0207708_100214274 157
241 3300026075 Ga0207708_10036827 Ga0207708_100368272 157
242 3300026088 Ga0207641_10050607 Ga0207641_100506072 157
243 3300026089 Ga0207648_10011300 Ga0207648_100113004 157
244 3300026089 Ga0207648_10137453 Ga0207648_101374532 157
245 3300026095 Ga0207676_10199729 Ga0207676_101997292 157
246 3300026095 Ga0207676_11306583 Ga0207676_113065831 157
247 3300026118 Ga0207675_100112990 Ga0207675_1001129902 157
248 3300026121 Ga0207683_10010838 Ga0207683_100108386 157
249 3300026121 Ga0207683_10034828 Ga0207683_100348282 157
250 3300026121 Ga0207683_10260070 Ga0207683_102600702 157
251 3300026142 Ga0207698_10351544 Ga0207698_103515442 157
252 3300027907 Ga0207428_10006512 Ga0207428_100065126 157
253 3300031824 Ga0307413_11171066 Ga0307413_111710662 157
254 3300031995 Ga0307409_100760098 Ga0307409_1007600982 157
255 3300035090 Ga0373949_0122504 Ga0373949_0122504_181_654 157
256 3300035091 Ga0373951_0032422 Ga0373951_0032422_727_1200 157
257 3300035114 Ga0373939_0084782 Ga0373939_0084782_264_767 157
258 3300042133 Ga0450896_008875 Ga0450896_008875_24_500 157
259 3300042436 Ga0439435_0242658 Ga0439435_0242658_88_567 157
260 3300042531 Ga0450918_009046 Ga0450918_009046_78_554 157
261 3300042876 Ga0451577_0018105 Ga0451577_0018105_4081_4569 157
262 3300044712 Ga0453684_0075341 Ga0453684_0075341_1789_2277 157
263 3300045976 Ga0466967_0902812 Ga0466967_0902812_187_660 157
264 3300048904 Ga0496101_0556695 Ga0496101_0556695_210_683 157
265 3300048909 Ga0496106_0169669 Ga0496106_0169669_36_509 157
266 3300048910 Ga0496107_0407103 Ga0496107_0407103_55_537 157
267 3300048912 Ga0496109_1944747 Ga0496109_1944747_20_493 157
268 3300048915 Ga0496112_0166642 Ga0496112_0166642_311_784 157
269 3300048915 Ga0496112_0569481 Ga0496112_0569481_17_490 157
270 3300049568 Ga0501031_0290955 Ga0501031_0290955_349_822 157
271 3300049571 Ga0501034_0121360 Ga0501034_0121360_1313_1786 157
272 3300049572 Ga0501036_0174065 Ga0501036_0174065_261_734 157
273 3300049573 Ga0501037_0625200 Ga0501037_0625200_170_643 157
274 3300049576 Ga0501040_0105790 Ga0501040_0105790_215_688 157
275 3300049576 Ga0501040_1026782 Ga0501040_1026782_82_555 157
276 3300049577 Ga0501041_0079376 Ga0501041_0079376_365_838 157
277 3300049581 Ga0501047_0172995 Ga0501047_0172995_847_1320 157
278 3300049582 Ga0501048_0148236 Ga0501048_0148236_171_644 157
279 3300049583 Ga0501067_0339703 Ga0501067_0339703_178_651 157
280 3300049587 Ga0501071_0019435 Ga0501071_0019435_2960_3433 157
281 3300049588 Ga0501072_0147124 Ga0501072_0147124_180_653 157
282 3300049590 Ga0501074_0486693 Ga0501074_0486693_295_768 157
283 3300049591 Ga0501075_0024911 Ga0501075_0024911_954_1427 157
284 3300049741 Ga0501079_0225440 Ga0501079_0225440_876_1349 157
285 3300049742 Ga0501080_1444607 Ga0501080_1444607_15_497 157
286 3300049824 Ga0501045_0020822 Ga0501045_0020822_1271_1744 157
287 3300049824 Ga0501045_0082828 Ga0501045_0082828_1737_2219 157
288 3300049824 Ga0501045_0586551 Ga0501045_0586551_144_617 157
289 3300049824 Ga0501045_0921912 Ga0501045_0921912_112_585 157
290 3300050489 nmdc:mga03683_312978_c1 nmdc:mga03683_312978_c1_18_500 157
291 3300050491 nmdc:mga00v17_4326_c1 nmdc:mga00v17_4326_c1_4968_5468 157
292 3300050492 nmdc:mga0yw44_65710_c1 nmdc:mga0yw44_65710_c1_963_1463 157
293 3300050493 nmdc:mga0k408_152201_c1 nmdc:mga0k408_152201_c1_398_898 157
294 3300050493 nmdc:mga0k408_222942_c1 nmdc:mga0k408_222942_c1_163_645 157
295 3300050494 nmdc:mga06z11_305603_c1 nmdc:mga06z11_305603_c1_166_672 157
296 3300050495 nmdc:mga04h51_135328_c1 nmdc:mga04h51_135328_c1_255_737 157
297 3300050495 nmdc:mga04h51_97392_c1 nmdc:mga04h51_97392_c1_19_501 157
298 3300050507 nmdc:mga05p37_23262_c1 nmdc:mga05p37_23262_c1_1153_1635 157
299 3300050507 nmdc:mga05p37_348758_c1 nmdc:mga05p37_348758_c1_891_1376 157
300 3300050507 nmdc:mga05p37_60499_c1 nmdc:mga05p37_60499_c1_1632_2117 157
301 3300050507 nmdc:mga05p37_979418_c1 nmdc:mga05p37_979418_c1_241_717 157
302 3300050508 nmdc:mga09592_220973_c1 nmdc:mga09592_220973_c1_690_1175 157
303 3300050508 nmdc:mga09592_53479_c1 nmdc:mga09592_53479_c1_752_1255 157
304 3300050509 nmdc:mga0qj67_331330_c1 nmdc:mga0qj67_331330_c1_468_947 157
305 3300050511 nmdc:mga08y16_1363987_c1 nmdc:mga08y16_1363987_c1_135_611 157
306 3300050511 nmdc:mga08y16_152247_c1 nmdc:mga08y16_152247_c1_134_619 157
307 3300050512 nmdc:mga0n895_237354_c1 nmdc:mga0n895_237354_c1_1250_1735 157
308 3300050512 nmdc:mga0n895_73465_c1 nmdc:mga0n895_73465_c1_179_655 157
309 3300050512 nmdc:mga0n895_74988_c1 nmdc:mga0n895_74988_c1_42_518 157
310 3300050512 nmdc:mga0n895_81_c1 nmdc:mga0n895_81_c1_14696_15220 157
311 3300050513 nmdc:mga0rr50_1054834_c1 nmdc:mga0rr50_1054834_c1_97_579 157
312 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_129831_130355 157
313 3300050513 nmdc:mga0rr50_29040_c1 nmdc:mga0rr50_29040_c1_111_587 157
314 3300050513 nmdc:mga0rr50_349890_c1 nmdc:mga0rr50_349890_c1_390_863 157
315 3300050513 nmdc:mga0rr50_631101_c1 nmdc:mga0rr50_631101_c1_299_775 157
316 3300050514 nmdc:mga08x19_265_c1 nmdc:mga08x19_265_c1_13134_13658 157
317 3300050514 nmdc:mga08x19_290731_c1 nmdc:mga08x19_290731_c1_357_833 157
318 3300050515 nmdc:mga0a205_1493661_c1 nmdc:mga0a205_1493661_c1_18_497 157
319 3300050515 nmdc:mga0a205_25115_c1 nmdc:mga0a205_25115_c1_4961_5437 157
320 3300050515 nmdc:mga0a205_92323_c1 nmdc:mga0a205_92323_c1_456_938 157
321 3300054114 Ga0501084_0317716 Ga0501084_0317716_369_842 157
322 3300060353 Ga0501082_0442578 Ga0501082_0442578_604_1098 157
323 3300060353 Ga0501082_0816925 Ga0501082_0816925_49_522 157
324 3300061734 Ga0530510_0627762 Ga0530510_0627762_166_660 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

35

170

0.94

PF11716

MDMPI_N

Mycothiol maleylpyruvate isomerase N-terminal domain

36

168

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.8471 1 155
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.8269 1 155
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8261 14 155
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8251 14 155
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.8117 14 153
ID Description Score Start End Superfamily
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8512 1 155 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8258 14 153 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8207 1 155 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8117 14 153 1.20.120.450
5cogA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7679 14 153 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V8EKY6-F1-model_v4 DinB-like domain-containing protein 0.9715 31 155
AF-A0A2V7ZGD2-F1-model_v4 DinB-like domain-containing protein 0.9711 3 155
AF-A0A2V8B7D9-F1-model_v4 DinB-like domain-containing protein 0.9705 20 155
AF-A0A2V8CGZ6-F1-model_v4 DinB-like domain-containing protein 0.967 53 153
AF-A0A2V7IRB1-F1-model_v4 DinB-like domain-containing protein 0.9616 1 152

Feature Viewer

pLDDT pTM Quality
96.53 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map