F407265
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 324 | 191 | 324 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10235016|Ga0070681_102350161 |
| Length | 174 |
| Sequence | LRAARGGANRKAAPSLTAKDVYADPMHKSRDPMQALGETPEKIRELASRWSEAQWNGSYEPGKWTARQILVHLAQTELALTTRVRFALSEENYRAQPFSQDAWMANEAGADGRTALDAYLALRRLNVLLFRSLTPEQRRRPFQHPEYGELNAEWVAAQLAGHDLHHLAQLERIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 137 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 138 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 142 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 143 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 144 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 145 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 146 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 147 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 148 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 149 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 150 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 154 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 155 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 174 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 175 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 176 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 177 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 178 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 179 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 190 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.56 |
| Nodule | 0 |
| Rhizoplane | 1.85 |
| Rhizosphere | 92.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10045174 | 3300005290 | Bacteria | 683 |
| 2 | Ga0065712_10483172 | 3300005290 | Bacteria | 661 |
| 3 | Ga0065715_10001764 | 3300005293 | Bacteria | 6393 |
| 4 | Ga0065715_10180957 | 3300005293 | Bacteria | 1477 |
| 5 | Ga0065707_10087327 | 3300005295 | Bacteria | 5073 |
| 6 | Ga0065707_10561154 | 3300005295 | Unclassified | 711 |
| 7 | Ga0070676_10006898 | 3300005328 | Bacteria | 6079 |
| 8 | Ga0070690_100068330 | 3300005330 | Bacteria | 2304 |
| 9 | Ga0070690_100611298 | 3300005330 | Bacteria | 828 |
| 10 | Ga0070690_100890419 | 3300005330 | Unclassified | 695 |
| 11 | Ga0068869_100142018 | 3300005334 | Bacteria | 1855 |
| 12 | Ga0070689_100042701 | 3300005340 | Bacteria | 3482 |
| 13 | Ga0070689_100060996 | 3300005340 | Bacteria | 2933 |
| 14 | Ga0070687_100034419 | 3300005343 | Bacteria | 2508 |
| 15 | Ga0070661_100099484 | 3300005344 | Bacteria | 2161 |
| 16 | Ga0070661_100147673 | 3300005344 | Bacteria | 1776 |
| 17 | Ga0070668_100462164 | 3300005347 | Bacteria | 1093 |
| 18 | Ga0070669_100049207 | 3300005353 | Bacteria | 3077 |
| 19 | Ga0070669_100066514 | 3300005353 | Bacteria | 2657 |
| 20 | Ga0070669_100428883 | 3300005353 | Bacteria | 1086 |
| 21 | Ga0070675_100256631 | 3300005354 | Bacteria | 1531 |
| 22 | Ga0070675_101238748 | 3300005354 | Bacteria | 687 |
| 23 | Ga0070675_101647718 | 3300005354 | Unclassified | 592 |
| 24 | Ga0070671_100170462 | 3300005355 | Bacteria | 1841 |
| 25 | Ga0070671_100922238 | 3300005355 | Bacteria | 763 |
| 26 | Ga0070674_100004180 | 3300005356 | Bacteria | 8199 |
| 27 | Ga0070674_100072026 | 3300005356 | Bacteria | 2446 |
| 28 | Ga0070674_100419508 | 3300005356 | Bacteria | 1097 |
| 29 | Ga0070673_100031205 | 3300005364 | Bacteria | 3997 |
| 30 | Ga0070688_100015804 | 3300005365 | Bacteria | 4301 |
| 31 | Ga0070667_100177644 | 3300005367 | Bacteria | 1882 |
| 32 | Ga0070667_100418341 | 3300005367 | Bacteria | 1221 |
| 33 | Ga0070703_10029021 | 3300005406 | Bacteria | 1657 |
| 34 | Ga0070701_10022090 | 3300005438 | Unclassified | 3046 |
| 35 | Ga0070701_10112909 | 3300005438 | Bacteria | 1521 |
| 36 | Ga0070705_100010243 | 3300005440 | Bacteria | 4686 |
| 37 | Ga0070700_100023316 | 3300005441 | Bacteria | 3618 |
| 38 | Ga0070700_100112138 | 3300005441 | Bacteria | 1815 |
| 39 | Ga0070694_100008902 | 3300005444 | Bacteria | 6151 |
| 40 | Ga0070694_100103396 | 3300005444 | Bacteria | 2018 |
| 41 | Ga0070708_100030062 | 3300005445 | Unclassified | 4691 |
| 42 | Ga0070678_100003694 | 3300005456 | Bacteria | 8562 |
| 43 | Ga0070678_100111387 | 3300005456 | Bacteria | 2142 |
| 44 | Ga0070678_100584835 | 3300005456 | Bacteria | 995 |
| 45 | Ga0070678_101716289 | 3300005456 | Bacteria | 591 |
| 46 | Ga0070662_100065605 | 3300005457 | Bacteria | 2661 |
| 47 | Ga0070662_100946810 | 3300005457 | Bacteria | 736 |
| 48 | Ga0070681_10235016 | 3300005458 | Bacteria | 1747 |
| 49 | Ga0068867_100239670 | 3300005459 | Bacteria | 1470 |
| 50 | Ga0068867_100262314 | 3300005459 | Bacteria | 1409 |
| 51 | Ga0070685_10048679 | 3300005466 | Bacteria | 2442 |
| 52 | Ga0070685_10100375 | 3300005466 | Bacteria | 1767 |
| 53 | Ga0070707_100209108 | 3300005468 | Bacteria | 1902 |
| 54 | Ga0070707_100472751 | 3300005468 | Bacteria | 1215 |
| 55 | Ga0070698_100004169 | 3300005471 | Bacteria | 15891 |
| 56 | Ga0070698_100008414 | 3300005471 | Bacteria | 11151 |
| 57 | Ga0070698_101149614 | 3300005471 | Bacteria | 725 |
| 58 | Ga0070699_100125571 | 3300005518 | Bacteria | 2258 |
| 59 | Ga0070697_100690674 | 3300005536 | Bacteria | 900 |
| 60 | Ga0070672_100012101 | 3300005543 | Bacteria | 6041 |
| 61 | Ga0070686_100006661 | 3300005544 | Bacteria | 6431 |
| 62 | Ga0070686_100084663 | 3300005544 | Bacteria | 2107 |
| 63 | Ga0070695_100002747 | 3300005545 | Bacteria | 10206 |
| 64 | Ga0070695_100291073 | 3300005545 | Bacteria | 1204 |
| 65 | Ga0070695_101029279 | 3300005545 | Bacteria | 671 |
| 66 | Ga0070696_100107268 | 3300005546 | Bacteria | 2008 |
| 67 | Ga0070696_100259312 | 3300005546 | Bacteria | 1318 |
| 68 | Ga0070696_100483550 | 3300005546 | Bacteria | 982 |
| 69 | Ga0070693_100039718 | 3300005547 | Bacteria | 2638 |
| 70 | Ga0070704_100025207 | 3300005549 | Bacteria | 3913 |
| 71 | Ga0070704_100220954 | 3300005549 | Bacteria | 1540 |
| 72 | Ga0068855_100279011 | 3300005563 | Unclassified | 1856 |
| 73 | Ga0068857_100299269 | 3300005577 | Bacteria | 1483 |
| 74 | Ga0068854_100007862 | 3300005578 | Bacteria | 6822 |
| 75 | Ga0070702_100014967 | 3300005615 | Bacteria | 3948 |
| 76 | Ga0068852_100447608 | 3300005616 | Bacteria | 1278 |
| 77 | Ga0068852_100890580 | 3300005616 | Bacteria | 907 |
| 78 | Ga0068859_100046548 | 3300005617 | Bacteria | 4356 |
| 79 | Ga0068859_100112100 | 3300005617 | Bacteria | 2791 |
| 80 | Ga0068864_100928808 | 3300005618 | Bacteria | 860 |
| 81 | Ga0068861_100278338 | 3300005719 | Unclassified | 1440 |
| 82 | Ga0068861_100319888 | 3300005719 | Bacteria | 1351 |
| 83 | Ga0068870_10002928 | 3300005840 | Bacteria | 7192 |
| 84 | Ga0068870_10728759 | 3300005840 | Unclassified | 687 |
| 85 | Ga0068863_100073208 | 3300005841 | Bacteria | 3241 |
| 86 | Ga0068863_100156549 | 3300005841 | Unclassified | 2182 |
| 87 | Ga0068858_100281107 | 3300005842 | Bacteria | 1585 |
| 88 | Ga0068858_100946823 | 3300005842 | Unclassified | 843 |
| 89 | Ga0068862_100108519 | 3300005844 | Bacteria | 2434 |
| 90 | Ga0075365_10133851 | 3300006038 | Bacteria | 1717 |
| 91 | Ga0075368_10048081 | 3300006042 | Bacteria | 1690 |
| 92 | Ga0075363_100251884 | 3300006048 | Unclassified | 1017 |
| 93 | Ga0075364_10008936 | 3300006051 | Bacteria | 5998 |
| 94 | Ga0070716_101095149 | 3300006173 | Unclassified | 635 |
| 95 | Ga0075362_10225948 | 3300006177 | Bacteria | 916 |
| 96 | Ga0075367_10002624 | 3300006178 | Bacteria | 8264 |
| 97 | Ga0075366_10006306 | 3300006195 | Bacteria | 6488 |
| 98 | Ga0075366_10140861 | 3300006195 | Bacteria | 1458 |
| 99 | Ga0075366_10225650 | 3300006195 | Bacteria | 1141 |
| 100 | Ga0097621_100136431 | 3300006237 | Bacteria | 2093 |
| 101 | Ga0075370_10339593 | 3300006353 | Bacteria | 896 |
| 102 | Ga0068871_100079479 | 3300006358 | Bacteria | 2714 |
| 103 | Ga0075428_100025403 | 3300006844 | Bacteria | 6556 |
| 104 | Ga0075428_100028777 | 3300006844 | Bacteria | 6149 |
| 105 | Ga0075428_101029824 | 3300006844 | Unclassified | 871 |
| 106 | Ga0075430_100159458 | 3300006846 | Bacteria | 1878 |
| 107 | Ga0075431_100491241 | 3300006847 | Bacteria | 1219 |
| 108 | Ga0075431_100949213 | 3300006847 | Unclassified | 828 |
| 109 | Ga0075433_10043744 | 3300006852 | Unclassified | 3889 |
| 110 | Ga0075433_10078599 | 3300006852 | Bacteria | 2907 |
| 111 | Ga0075433_10203121 | 3300006852 | Unclassified | 1762 |
| 112 | Ga0075433_10885450 | 3300006852 | Unclassified | 779 |
| 113 | Ga0075433_10974872 | 3300006852 | Bacteria | 739 |
| 114 | Ga0075434_100000019 | 3300006871 | Bacteria | 73391 |
| 115 | Ga0075434_100026598 | 3300006871 | Bacteria | 5670 |
| 116 | Ga0075434_100029485 | 3300006871 | Bacteria | 5401 |
| 117 | Ga0075434_100465658 | 3300006871 | Bacteria | 1285 |
| 118 | Ga0075434_100567823 | 3300006871 | Unclassified | 1154 |
| 119 | Ga0075429_100164787 | 3300006880 | Bacteria | 1942 |
| 120 | Ga0075429_100182896 | 3300006880 | Bacteria | 1837 |
| 121 | Ga0075429_100230618 | 3300006880 | Bacteria | 1622 |
| 122 | Ga0075429_100478782 | 3300006880 | Bacteria | 1091 |
| 123 | Ga0075429_101243264 | 3300006880 | Unclassified | 650 |
| 124 | Ga0075436_100000160 | 3300006914 | Bacteria | 41885 |
| 125 | Ga0075436_100016389 | 3300006914 | Bacteria | 5071 |
| 126 | Ga0075436_100432609 | 3300006914 | Bacteria | 956 |
| 127 | Ga0075436_101134992 | 3300006914 | Unclassified | 589 |
| 128 | Ga0097620_100046545 | 3300006931 | Bacteria | 4356 |
| 129 | Ga0097620_100112098 | 3300006931 | Bacteria | 2791 |
| 130 | Ga0075435_100000041 | 3300007076 | Bacteria | 66202 |
| 131 | Ga0075435_100010076 | 3300007076 | Bacteria | 6894 |
| 132 | Ga0075435_100566206 | 3300007076 | Bacteria | 984 |
| 133 | Ga0075435_100776278 | 3300007076 | Bacteria | 834 |
| 134 | Ga0099794_10452413 | 3300007265 | Bacteria | 673 |
| 135 | Ga0105240_10188145 | 3300009093 | Unclassified | 2430 |
| 136 | Ga0111539_10092037 | 3300009094 | Bacteria | 3563 |
| 137 | Ga0105245_10668288 | 3300009098 | Bacteria | 1070 |
| 138 | Ga0105245_10693795 | 3300009098 | Bacteria | 1051 |
| 139 | Ga0114129_10017195 | 3300009147 | Bacteria | 10301 |
| 140 | Ga0114129_10026239 | 3300009147 | Bacteria | 8252 |
| 141 | Ga0114129_10052262 | 3300009147 | Bacteria | 5735 |
| 142 | Ga0114129_10309419 | 3300009147 | Bacteria | 2103 |
| 143 | Ga0105243_10189483 | 3300009148 | Bacteria | 1795 |
| 144 | Ga0105241_10318745 | 3300009174 | Bacteria | 1340 |
| 145 | Ga0105248_10018671 | 3300009177 | Bacteria | 7666 |
| 146 | Ga0105248_10020246 | 3300009177 | Bacteria | 7370 |
| 147 | Ga0105248_10509876 | 3300009177 | Unclassified | 1356 |
| 148 | Ga0105248_10767557 | 3300009177 | Bacteria | 1088 |
| 149 | Ga0105248_11591798 | 3300009177 | Bacteria | 740 |
| 150 | Ga0105249_10007162 | 3300009553 | Bacteria | 9738 |
| 151 | Ga0105249_10128718 | 3300009553 | Bacteria | 2414 |
| 152 | Ga0105239_10164540 | 3300010375 | Bacteria | 2480 |
| 153 | Ga0105246_10843920 | 3300011119 | Unclassified | 817 |
| 154 | Ga0157370_10196081 | 3300013104 | Bacteria | 1874 |
| 155 | Ga0157369_10924424 | 3300013105 | Bacteria | 894 |
| 156 | Ga0163162_10145993 | 3300013306 | Bacteria | 2482 |
| 157 | Ga0157375_10291738 | 3300013308 | Bacteria | 1794 |
| 158 | Ga0163163_10681266 | 3300014325 | Bacteria | 1092 |
| 159 | Ga0157380_10000616 | 3300014326 | Bacteria | 21930 |
| 160 | Ga0157380_10007312 | 3300014326 | Bacteria | 7838 |
| 161 | Ga0157380_10175185 | 3300014326 | Bacteria | 1878 |
| 162 | Ga0157380_10452141 | 3300014326 | Bacteria | 1234 |
| 163 | Ga0157380_10571178 | 3300014326 | Bacteria | 1113 |
| 164 | Ga0157380_12867223 | 3300014326 | Unclassified | 548 |
| 165 | Ga0157377_10450044 | 3300014745 | Unclassified | 889 |
| 166 | Ga0157379_10262772 | 3300014968 | Bacteria | 1569 |
| 167 | Ga0157379_11061069 | 3300014968 | Bacteria | 775 |
| 168 | Ga0157376_10311964 | 3300014969 | Bacteria | 1492 |
| 169 | Ga0207697_10039844 | 3300025315 | Bacteria | 1928 |
| 170 | Ga0207656_10423218 | 3300025321 | Bacteria | 671 |
| 171 | Ga0207682_10006053 | 3300025893 | Unclassified | 4892 |
| 172 | Ga0207682_10032108 | 3300025893 | Bacteria | 2110 |
| 173 | Ga0207688_10056169 | 3300025901 | Bacteria | 2211 |
| 174 | Ga0207688_10297312 | 3300025901 | Bacteria | 986 |
| 175 | Ga0207680_10391340 | 3300025903 | Bacteria | 981 |
| 176 | Ga0207645_10054513 | 3300025907 | Bacteria | 2553 |
| 177 | Ga0207643_10000586 | 3300025908 | Bacteria | 23097 |
| 178 | Ga0207654_10223324 | 3300025911 | Bacteria | 1251 |
| 179 | Ga0207707_10226042 | 3300025912 | Bacteria | 1629 |
| 180 | Ga0207657_10189278 | 3300025919 | Unclassified | 1661 |
| 181 | Ga0207649_10039377 | 3300025920 | Bacteria | 2866 |
| 182 | Ga0207649_10188810 | 3300025920 | Bacteria | 1447 |
| 183 | Ga0207646_10133897 | 3300025922 | Bacteria | 2232 |
| 184 | Ga0207646_10457764 | 3300025922 | Bacteria | 1151 |
| 185 | Ga0207646_11135104 | 3300025922 | Bacteria | 687 |
| 186 | Ga0207681_10184304 | 3300025923 | Bacteria | 1592 |
| 187 | Ga0207681_10249798 | 3300025923 | Bacteria | 1384 |
| 188 | Ga0207681_10402477 | 3300025923 | Bacteria | 1106 |
| 189 | Ga0207659_10000495 | 3300025926 | Bacteria | 23739 |
| 190 | Ga0207659_10096068 | 3300025926 | Bacteria | 2224 |
| 191 | Ga0207659_10355822 | 3300025926 | Bacteria | 1216 |
| 192 | Ga0207644_10027834 | 3300025931 | Bacteria | 3907 |
| 193 | Ga0207644_10134631 | 3300025931 | Bacteria | 1896 |
| 194 | Ga0207690_10164663 | 3300025932 | Bacteria | 1656 |
| 195 | Ga0207706_10202109 | 3300025933 | Bacteria | 1743 |
| 196 | Ga0207686_10095782 | 3300025934 | Bacteria | 1970 |
| 197 | Ga0207709_10108386 | 3300025935 | Bacteria | 1852 |
| 198 | Ga0207670_10037919 | 3300025936 | Bacteria | 3144 |
| 199 | Ga0207670_11122101 | 3300025936 | Bacteria | 664 |
| 200 | Ga0207669_10000542 | 3300025937 | Bacteria | 16430 |
| 201 | Ga0207669_10060399 | 3300025937 | Bacteria | 2324 |
| 202 | Ga0207669_10100078 | 3300025937 | Bacteria | 1914 |
| 203 | Ga0207704_10219465 | 3300025938 | Bacteria | 1406 |
| 204 | Ga0207665_10944265 | 3300025939 | Bacteria | 685 |
| 205 | Ga0207691_10006977 | 3300025940 | Bacteria | 10899 |
| 206 | Ga0207691_10439583 | 3300025940 | Bacteria | 1111 |
| 207 | Ga0207711_10055138 | 3300025941 | Bacteria | 3413 |
| 208 | Ga0207711_10824682 | 3300025941 | Bacteria | 864 |
| 209 | Ga0207711_10849122 | 3300025941 | Bacteria | 850 |
| 210 | Ga0207689_10173671 | 3300025942 | Bacteria | 1777 |
| 211 | Ga0207679_10018474 | 3300025945 | Bacteria | 4671 |
| 212 | Ga0207667_10238227 | 3300025949 | Unclassified | 1862 |
| 213 | Ga0207651_10172887 | 3300025960 | Bacteria | 1705 |
| 214 | Ga0207712_10336492 | 3300025961 | Bacteria | 1250 |
| 215 | Ga0207668_10146749 | 3300025972 | Bacteria | 1821 |
| 216 | Ga0207640_10028655 | 3300025981 | Bacteria | 3407 |
| 217 | Ga0207658_10564168 | 3300025986 | Bacteria | 1020 |
| 218 | Ga0207703_10036611 | 3300026035 | Bacteria | 3907 |
| 219 | Ga0207703_11094242 | 3300026035 | Bacteria | 765 |
| 220 | Ga0207678_10207154 | 3300026067 | Bacteria | 1677 |
| 221 | Ga0207708_10021427 | 3300026075 | Bacteria | 4874 |
| 222 | Ga0207708_10036827 | 3300026075 | Bacteria | 3726 |
| 223 | Ga0207702_10695250 | 3300026078 | Bacteria | 1002 |
| 224 | Ga0207641_10050607 | 3300026088 | Bacteria | 3515 |
| 225 | Ga0207648_10011300 | 3300026089 | Bacteria | 8417 |
| 226 | Ga0207648_10137453 | 3300026089 | Bacteria | 2153 |
| 227 | Ga0207676_10199729 | 3300026095 | Bacteria | 1766 |
| 228 | Ga0207676_11306583 | 3300026095 | Bacteria | 720 |
| 229 | Ga0207675_100112990 | 3300026118 | Bacteria | 2564 |
| 230 | Ga0207683_10010838 | 3300026121 | Bacteria | 7774 |
| 231 | Ga0207683_10034828 | 3300026121 | Bacteria | 4378 |
| 232 | Ga0207683_10260070 | 3300026121 | Bacteria | 1585 |
| 233 | Ga0207698_10351544 | 3300026142 | Bacteria | 1392 |
| 234 | Ga0207428_10006512 | 3300027907 | Bacteria | 10776 |
| 235 | Ga0268265_11331638 | 3300028380 | Bacteria | 719 |
| 236 | Ga0307408_100324019 | 3300031548 | Unclassified | 1299 |
| 237 | Ga0307408_100801130 | 3300031548 | Bacteria | 855 |
| 238 | Ga0307413_11171066 | 3300031824 | Bacteria | 667 |
| 239 | Ga0307410_10574006 | 3300031852 | Bacteria | 938 |
| 240 | Ga0307409_100760098 | 3300031995 | Bacteria | 974 |
| 241 | Ga0307409_101167480 | 3300031995 | Bacteria | 793 |
| 242 | Ga0307416_100616154 | 3300032002 | Bacteria | 1167 |
| 243 | Ga0373949_0122504 | 3300035090 | Bacteria | 731 |
| 244 | Ga0373951_0032422 | 3300035091 | Bacteria | 1236 |
| 245 | Ga0373939_0084782 | 3300035114 | Bacteria | 1060 |
| 246 | Ga0450896_008875 | 3300042133 | Bacteria | 1396 |
| 247 | Ga0439435_0242658 | 3300042436 | Bacteria | 605 |
| 248 | Ga0450918_009046 | 3300042531 | Bacteria | 1748 |
| 249 | Ga0451577_0018105 | 3300042876 | Bacteria | 6493 |
| 250 | Ga0453684_0075341 | 3300044712 | Bacteria | 4242 |
| 251 | Ga0466967_0340134 | 3300045976 | Bacteria | 1451 |
| 252 | Ga0466967_0902812 | 3300045976 | Unclassified | 879 |
| 253 | Ga0495611_0385840 | 3300046648 | Bacteria | 641 |
| 254 | Ga0495604_0775981 | 3300047317 | Unclassified | 605 |
| 255 | Ga0496101_0556695 | 3300048904 | Bacteria | 907 |
| 256 | Ga0496106_0169669 | 3300048909 | Bacteria | 1729 |
| 257 | Ga0496107_0407103 | 3300048910 | Bacteria | 1012 |
| 258 | Ga0496109_1944747 | 3300048912 | Bacteria | 520 |
| 259 | Ga0496112_0166642 | 3300048915 | Bacteria | 2169 |
| 260 | Ga0496112_0569481 | 3300048915 | Bacteria | 1066 |
| 261 | Ga0501031_0290955 | 3300049568 | Bacteria | 1059 |
| 262 | Ga0501034_0121360 | 3300049571 | Unclassified | 2600 |
| 263 | Ga0501036_0174065 | 3300049572 | Bacteria | 1813 |
| 264 | Ga0501037_0625200 | 3300049573 | Bacteria | 721 |
| 265 | Ga0501040_0105790 | 3300049576 | Bacteria | 1966 |
| 266 | Ga0501040_1026782 | 3300049576 | Unclassified | 598 |
| 267 | Ga0501041_0079376 | 3300049577 | Bacteria | 2020 |
| 268 | Ga0501047_0172995 | 3300049581 | Bacteria | 2028 |
| 269 | Ga0501048_0148236 | 3300049582 | Bacteria | 1659 |
| 270 | Ga0501067_0339703 | 3300049583 | Unclassified | 837 |
| 271 | Ga0501071_0019435 | 3300049587 | Bacteria | 4714 |
| 272 | Ga0501072_0147124 | 3300049588 | Bacteria | 1878 |
| 273 | Ga0501074_0486693 | 3300049590 | Unclassified | 874 |
| 274 | Ga0501075_0024911 | 3300049591 | Bacteria | 4393 |
| 275 | Ga0501075_1401623 | 3300049591 | Unclassified | 529 |
| 276 | Ga0501079_0225440 | 3300049741 | Bacteria | 1464 |
| 277 | Ga0501080_1444607 | 3300049742 | Archaea | 586 |
| 278 | Ga0501045_0020822 | 3300049824 | Bacteria | 4687 |
| 279 | Ga0501045_0082828 | 3300049824 | Bacteria | 2366 |
| 280 | Ga0501045_0586551 | 3300049824 | Unclassified | 826 |
| 281 | Ga0501045_0921912 | 3300049824 | Bacteria | 641 |
| 282 | nmdc:mga03683_312978_c1 | 3300050489 | Unclassified | 738 |
| 283 | nmdc:mga00v17_4326_c1 | 3300050491 | Bacteria | 7376 |
| 284 | nmdc:mga0yw44_65710_c1 | 3300050492 | Bacteria | 1937 |
| 285 | nmdc:mga0k408_152201_c1 | 3300050493 | Bacteria | 1378 |
| 286 | nmdc:mga0k408_222942_c1 | 3300050493 | Unclassified | 1125 |
| 287 | nmdc:mga06z11_305603_c1 | 3300050494 | Bacteria | 946 |
| 288 | nmdc:mga04h51_135328_c1 | 3300050495 | Unclassified | 930 |
| 289 | nmdc:mga04h51_97392_c1 | 3300050495 | Bacteria | 1067 |
| 290 | nmdc:mga05p37_23262_c1 | 3300050507 | Bacteria | 7517 |
| 291 | nmdc:mga05p37_348758_c1 | 3300050507 | Bacteria | 1743 |
| 292 | nmdc:mga05p37_60499_c1 | 3300050507 | Bacteria | 4663 |
| 293 | nmdc:mga05p37_891143_c1 | 3300050507 | Bacteria | 961 |
| 294 | nmdc:mga05p37_979418_c1 | 3300050507 | Bacteria | 901 |
| 295 | nmdc:mga09592_176589_c1 | 3300050508 | Bacteria | 1847 |
| 296 | nmdc:mga09592_220973_c1 | 3300050508 | Bacteria | 1641 |
| 297 | nmdc:mga09592_53479_c1 | 3300050508 | Bacteria | 3409 |
| 298 | nmdc:mga0qj67_331330_c1 | 3300050509 | Unclassified | 1232 |
| 299 | nmdc:mga06r32_1125621_c1 | 3300050510 | Bacteria | 733 |
| 300 | nmdc:mga08y16_1363987_c1 | 3300050511 | Unclassified | 673 |
| 301 | nmdc:mga08y16_152247_c1 | 3300050511 | Bacteria | 2404 |
| 302 | nmdc:mga08y16_280856_c1 | 3300050511 | Bacteria | 1717 |
| 303 | nmdc:mga0n895_237354_c1 | 3300050512 | Bacteria | 1850 |
| 304 | nmdc:mga0n895_467523_c1 | 3300050512 | Bacteria | 1272 |
| 305 | nmdc:mga0n895_73465_c1 | 3300050512 | Unclassified | 3395 |
| 306 | nmdc:mga0n895_74988_c1 | 3300050512 | Bacteria | 3362 |
| 307 | nmdc:mga0n895_81_c1 | 3300050512 | Bacteria | 54736 |
| 308 | nmdc:mga0rr50_1054834_c1 | 3300050513 | Unclassified | 692 |
| 309 | nmdc:mga0rr50_1_c1 | 3300050513 | Bacteria | 558123 |
| 310 | nmdc:mga0rr50_29040_c1 | 3300050513 | Bacteria | 3895 |
| 311 | nmdc:mga0rr50_349890_c1 | 3300050513 | Bacteria | 1243 |
| 312 | nmdc:mga0rr50_631101_c1 | 3300050513 | Bacteria | 914 |
| 313 | nmdc:mga08x19_265_c1 | 3300050514 | Bacteria | 39740 |
| 314 | nmdc:mga08x19_290731_c1 | 3300050514 | Bacteria | 1134 |
| 315 | nmdc:mga0a205_1493661_c1 | 3300050515 | Bacteria | 524 |
| 316 | nmdc:mga0a205_25115_c1 | 3300050515 | Bacteria | 5673 |
| 317 | nmdc:mga0a205_34582_c2 | 3300050515 | Bacteria | 4443 |
| 318 | nmdc:mga0a205_856216_c1 | 3300050515 | Bacteria | 756 |
| 319 | nmdc:mga0a205_92323_c1 | 3300050515 | Bacteria | 2925 |
| 320 | Ga0501084_0317716 | 3300054114 | Bacteria | 1315 |
| 321 | Ga0590077_008274 | 3300059426 | Bacteria | 2130 |
| 322 | Ga0501082_0442578 | 3300060353 | Bacteria | 1135 |
| 323 | Ga0501082_0816925 | 3300060353 | Bacteria | 815 |
| 324 | Ga0530510_0627762 | 3300061734 | Archaea | 818 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047317 | Ga0495604_0775981 | Ga0495604_0775981_181_582 | 129 |
| 2 | 3300049591 | Ga0501075_1401623 | Ga0501075_1401623_16_432 | 138 |
| 3 | 3300025321 | Ga0207656_10423218 | Ga0207656_104232181 | 139 |
| 4 | 3300005471 | Ga0070698_100008414 | Ga0070698_1000084144 | 141 |
| 5 | 3300028380 | Ga0268265_11331638 | Ga0268265_113316381 | 141 |
| 6 | 3300006844 | Ga0075428_101029824 | Ga0075428_1010298243 | 145 |
| 7 | 3300006847 | Ga0075431_100491241 | Ga0075431_1004912413 | 145 |
| 8 | 3300005295 | Ga0065707_10561154 | Ga0065707_105611541 | 146 |
| 9 | 3300006852 | Ga0075433_10974872 | Ga0075433_109748721 | 147 |
| 10 | 3300050515 | nmdc:mga0a205_856216_c1 | nmdc:mga0a205_856216_c1_35_514 | 147 |
| 11 | 3300050508 | nmdc:mga09592_176589_c1 | nmdc:mga09592_176589_c1_824_1276 | 148 |
| 12 | 3300005471 | Ga0070698_101149614 | Ga0070698_1011496142 | 150 |
| 13 | 3300014325 | Ga0163163_10681266 | Ga0163163_106812662 | 151 |
| 14 | 3300050510 | nmdc:mga06r32_1125621_c1 | nmdc:mga06r32_1125621_c1_112_603 | 151 |
| 15 | 3300031548 | Ga0307408_100324019 | Ga0307408_1003240192 | 153 |
| 16 | 3300059426 | Ga0590077_008274 | Ga0590077_008274_1561_2046 | 154 |
| 17 | 3300005456 | Ga0070678_101716289 | Ga0070678_1017162891 | 155 |
| 18 | 3300005719 | Ga0068861_100278338 | Ga0068861_1002783382 | 155 |
| 19 | 3300006852 | Ga0075433_10203121 | Ga0075433_102031212 | 156 |
| 20 | 3300006871 | Ga0075434_100465658 | Ga0075434_1004656581 | 156 |
| 21 | 3300007076 | Ga0075435_100566206 | Ga0075435_1005662062 | 156 |
| 22 | 3300009147 | Ga0114129_10052262 | Ga0114129_100522623 | 156 |
| 23 | 3300026078 | Ga0207702_10695250 | Ga0207702_106952501 | 156 |
| 24 | 3300031548 | Ga0307408_100801130 | Ga0307408_1008011301 | 156 |
| 25 | 3300031852 | Ga0307410_10574006 | Ga0307410_105740061 | 156 |
| 26 | 3300031995 | Ga0307409_101167480 | Ga0307409_1011674802 | 156 |
| 27 | 3300032002 | Ga0307416_100616154 | Ga0307416_1006161542 | 156 |
| 28 | 3300045976 | Ga0466967_0340134 | Ga0466967_0340134_57_530 | 156 |
| 29 | 3300046648 | Ga0495611_0385840 | Ga0495611_0385840_29_523 | 156 |
| 30 | 3300050507 | nmdc:mga05p37_891143_c1 | nmdc:mga05p37_891143_c1_302_781 | 156 |
| 31 | 3300050511 | nmdc:mga08y16_280856_c1 | nmdc:mga08y16_280856_c1_147_617 | 156 |
| 32 | 3300050512 | nmdc:mga0n895_467523_c1 | nmdc:mga0n895_467523_c1_680_1168 | 156 |
| 33 | 3300050515 | nmdc:mga0a205_34582_c2 | nmdc:mga0a205_34582_c2_3746_4225 | 156 |
| 34 | 3300005290 | Ga0065712_10045174 | Ga0065712_100451741 | 157 |
| 35 | 3300005290 | Ga0065712_10483172 | Ga0065712_104831721 | 157 |
| 36 | 3300005293 | Ga0065715_10001764 | Ga0065715_100017642 | 157 |
| 37 | 3300005293 | Ga0065715_10180957 | Ga0065715_101809571 | 157 |
| 38 | 3300005295 | Ga0065707_10087327 | Ga0065707_100873273 | 157 |
| 39 | 3300005328 | Ga0070676_10006898 | Ga0070676_100068981 | 157 |
| 40 | 3300005330 | Ga0070690_100068330 | Ga0070690_1000683302 | 157 |
| 41 | 3300005330 | Ga0070690_100611298 | Ga0070690_1006112982 | 157 |
| 42 | 3300005330 | Ga0070690_100890419 | Ga0070690_1008904191 | 157 |
| 43 | 3300005334 | Ga0068869_100142018 | Ga0068869_1001420181 | 157 |
| 44 | 3300005340 | Ga0070689_100042701 | Ga0070689_1000427012 | 157 |
| 45 | 3300005340 | Ga0070689_100060996 | Ga0070689_1000609962 | 157 |
| 46 | 3300005343 | Ga0070687_100034419 | Ga0070687_1000344192 | 157 |
| 47 | 3300005344 | Ga0070661_100099484 | Ga0070661_1000994842 | 157 |
| 48 | 3300005344 | Ga0070661_100147673 | Ga0070661_1001476732 | 157 |
| 49 | 3300005347 | Ga0070668_100462164 | Ga0070668_1004621642 | 157 |
| 50 | 3300005353 | Ga0070669_100049207 | Ga0070669_1000492072 | 157 |
| 51 | 3300005353 | Ga0070669_100066514 | Ga0070669_1000665142 | 157 |
| 52 | 3300005353 | Ga0070669_100428883 | Ga0070669_1004288832 | 157 |
| 53 | 3300005354 | Ga0070675_100256631 | Ga0070675_1002566312 | 157 |
| 54 | 3300005354 | Ga0070675_101238748 | Ga0070675_1012387481 | 157 |
| 55 | 3300005354 | Ga0070675_101647718 | Ga0070675_1016477181 | 157 |
| 56 | 3300005355 | Ga0070671_100170462 | Ga0070671_1001704623 | 157 |
| 57 | 3300005355 | Ga0070671_100922238 | Ga0070671_1009222381 | 157 |
| 58 | 3300005356 | Ga0070674_100004180 | Ga0070674_1000041802 | 157 |
| 59 | 3300005356 | Ga0070674_100072026 | Ga0070674_1000720262 | 157 |
| 60 | 3300005356 | Ga0070674_100419508 | Ga0070674_1004195081 | 157 |
| 61 | 3300005364 | Ga0070673_100031205 | Ga0070673_1000312054 | 157 |
| 62 | 3300005365 | Ga0070688_100015804 | Ga0070688_1000158044 | 157 |
| 63 | 3300005367 | Ga0070667_100177644 | Ga0070667_1001776442 | 157 |
| 64 | 3300005367 | Ga0070667_100418341 | Ga0070667_1004183411 | 157 |
| 65 | 3300005406 | Ga0070703_10029021 | Ga0070703_100290212 | 157 |
| 66 | 3300005438 | Ga0070701_10022090 | Ga0070701_100220903 | 157 |
| 67 | 3300005438 | Ga0070701_10112909 | Ga0070701_101129091 | 157 |
| 68 | 3300005440 | Ga0070705_100010243 | Ga0070705_1000102432 | 157 |
| 69 | 3300005441 | Ga0070700_100023316 | Ga0070700_1000233162 | 157 |
| 70 | 3300005441 | Ga0070700_100112138 | Ga0070700_1001121382 | 157 |
| 71 | 3300005444 | Ga0070694_100008902 | Ga0070694_1000089023 | 157 |
| 72 | 3300005444 | Ga0070694_100103396 | Ga0070694_1001033962 | 157 |
| 73 | 3300005445 | Ga0070708_100030062 | Ga0070708_1000300622 | 157 |
| 74 | 3300005456 | Ga0070678_100003694 | Ga0070678_1000036945 | 157 |
| 75 | 3300005456 | Ga0070678_100111387 | Ga0070678_1001113872 | 157 |
| 76 | 3300005456 | Ga0070678_100584835 | Ga0070678_1005848352 | 157 |
| 77 | 3300005457 | Ga0070662_100065605 | Ga0070662_1000656053 | 157 |
| 78 | 3300005457 | Ga0070662_100946810 | Ga0070662_1009468101 | 157 |
| 79 | 3300005458 | Ga0070681_10235016 | Ga0070681_102350161 | 157 |
| 80 | 3300005459 | Ga0068867_100239670 | Ga0068867_1002396702 | 157 |
| 81 | 3300005459 | Ga0068867_100262314 | Ga0068867_1002623141 | 157 |
| 82 | 3300005466 | Ga0070685_10048679 | Ga0070685_100486792 | 157 |
| 83 | 3300005466 | Ga0070685_10100375 | Ga0070685_101003752 | 157 |
| 84 | 3300005468 | Ga0070707_100209108 | Ga0070707_1002091082 | 157 |
| 85 | 3300005468 | Ga0070707_100472751 | Ga0070707_1004727511 | 157 |
| 86 | 3300005471 | Ga0070698_100004169 | Ga0070698_1000041696 | 157 |
| 87 | 3300005518 | Ga0070699_100125571 | Ga0070699_1001255712 | 157 |
| 88 | 3300005536 | Ga0070697_100690674 | Ga0070697_1006906742 | 157 |
| 89 | 3300005543 | Ga0070672_100012101 | Ga0070672_1000121016 | 157 |
| 90 | 3300005544 | Ga0070686_100006661 | Ga0070686_1000066611 | 157 |
| 91 | 3300005544 | Ga0070686_100084663 | Ga0070686_1000846633 | 157 |
| 92 | 3300005545 | Ga0070695_100002747 | Ga0070695_1000027474 | 157 |
| 93 | 3300005545 | Ga0070695_100291073 | Ga0070695_1002910732 | 157 |
| 94 | 3300005545 | Ga0070695_101029279 | Ga0070695_1010292791 | 157 |
| 95 | 3300005546 | Ga0070696_100107268 | Ga0070696_1001072682 | 157 |
| 96 | 3300005546 | Ga0070696_100259312 | Ga0070696_1002593122 | 157 |
| 97 | 3300005546 | Ga0070696_100483550 | Ga0070696_1004835501 | 157 |
| 98 | 3300005547 | Ga0070693_100039718 | Ga0070693_1000397182 | 157 |
| 99 | 3300005549 | Ga0070704_100025207 | Ga0070704_1000252072 | 157 |
| 100 | 3300005549 | Ga0070704_100220954 | Ga0070704_1002209542 | 157 |
| 101 | 3300005563 | Ga0068855_100279011 | Ga0068855_1002790111 | 157 |
| 102 | 3300005577 | Ga0068857_100299269 | Ga0068857_1002992692 | 157 |
| 103 | 3300005578 | Ga0068854_100007862 | Ga0068854_1000078624 | 157 |
| 104 | 3300005615 | Ga0070702_100014967 | Ga0070702_1000149672 | 157 |
| 105 | 3300005616 | Ga0068852_100447608 | Ga0068852_1004476082 | 157 |
| 106 | 3300005616 | Ga0068852_100890580 | Ga0068852_1008905801 | 157 |
| 107 | 3300005617 | Ga0068859_100046548 | Ga0068859_1000465482 | 157 |
| 108 | 3300005617 | Ga0068859_100112100 | Ga0068859_1001121002 | 157 |
| 109 | 3300005618 | Ga0068864_100928808 | Ga0068864_1009288081 | 157 |
| 110 | 3300005719 | Ga0068861_100319888 | Ga0068861_1003198881 | 157 |
| 111 | 3300005840 | Ga0068870_10002928 | Ga0068870_100029287 | 157 |
| 112 | 3300005840 | Ga0068870_10728759 | Ga0068870_107287592 | 157 |
| 113 | 3300005841 | Ga0068863_100073208 | Ga0068863_1000732082 | 157 |
| 114 | 3300005841 | Ga0068863_100156549 | Ga0068863_1001565492 | 157 |
| 115 | 3300005842 | Ga0068858_100281107 | Ga0068858_1002811072 | 157 |
| 116 | 3300005842 | Ga0068858_100946823 | Ga0068858_1009468232 | 157 |
| 117 | 3300005844 | Ga0068862_100108519 | Ga0068862_1001085192 | 157 |
| 118 | 3300006038 | Ga0075365_10133851 | Ga0075365_101338512 | 157 |
| 119 | 3300006042 | Ga0075368_10048081 | Ga0075368_100480812 | 157 |
| 120 | 3300006048 | Ga0075363_100251884 | Ga0075363_1002518842 | 157 |
| 121 | 3300006051 | Ga0075364_10008936 | Ga0075364_100089362 | 157 |
| 122 | 3300006173 | Ga0070716_101095149 | Ga0070716_1010951491 | 157 |
| 123 | 3300006177 | Ga0075362_10225948 | Ga0075362_102259482 | 157 |
| 124 | 3300006178 | Ga0075367_10002624 | Ga0075367_100026242 | 157 |
| 125 | 3300006195 | Ga0075366_10006306 | Ga0075366_100063062 | 157 |
| 126 | 3300006195 | Ga0075366_10140861 | Ga0075366_101408612 | 157 |
| 127 | 3300006195 | Ga0075366_10225650 | Ga0075366_102256502 | 157 |
| 128 | 3300006237 | Ga0097621_100136431 | Ga0097621_1001364312 | 157 |
| 129 | 3300006353 | Ga0075370_10339593 | Ga0075370_103395932 | 157 |
| 130 | 3300006358 | Ga0068871_100079479 | Ga0068871_1000794792 | 157 |
| 131 | 3300006844 | Ga0075428_100025403 | Ga0075428_1000254033 | 157 |
| 132 | 3300006844 | Ga0075428_100028777 | Ga0075428_1000287772 | 157 |
| 133 | 3300006846 | Ga0075430_100159458 | Ga0075430_1001594582 | 157 |
| 134 | 3300006847 | Ga0075431_100949213 | Ga0075431_1009492131 | 157 |
| 135 | 3300006852 | Ga0075433_10043744 | Ga0075433_100437442 | 157 |
| 136 | 3300006852 | Ga0075433_10078599 | Ga0075433_100785992 | 157 |
| 137 | 3300006852 | Ga0075433_10885450 | Ga0075433_108854501 | 157 |
| 138 | 3300006871 | Ga0075434_100000019 | Ga0075434_10000001946 | 157 |
| 139 | 3300006871 | Ga0075434_100026598 | Ga0075434_1000265982 | 157 |
| 140 | 3300006871 | Ga0075434_100029485 | Ga0075434_1000294852 | 157 |
| 141 | 3300006871 | Ga0075434_100567823 | Ga0075434_1005678232 | 157 |
| 142 | 3300006880 | Ga0075429_100164787 | Ga0075429_1001647872 | 157 |
| 143 | 3300006880 | Ga0075429_100182896 | Ga0075429_1001828962 | 157 |
| 144 | 3300006880 | Ga0075429_100230618 | Ga0075429_1002306182 | 157 |
| 145 | 3300006880 | Ga0075429_100478782 | Ga0075429_1004787821 | 157 |
| 146 | 3300006880 | Ga0075429_101243264 | Ga0075429_1012432641 | 157 |
| 147 | 3300006914 | Ga0075436_100000160 | Ga0075436_1000001609 | 157 |
| 148 | 3300006914 | Ga0075436_100016389 | Ga0075436_1000163892 | 157 |
| 149 | 3300006914 | Ga0075436_100432609 | Ga0075436_1004326092 | 157 |
| 150 | 3300006914 | Ga0075436_101134992 | Ga0075436_1011349921 | 157 |
| 151 | 3300006931 | Ga0097620_100046545 | Ga0097620_1000465452 | 157 |
| 152 | 3300006931 | Ga0097620_100112098 | Ga0097620_1001120982 | 157 |
| 153 | 3300007076 | Ga0075435_100000041 | Ga0075435_10000004112 | 157 |
| 154 | 3300007076 | Ga0075435_100010076 | Ga0075435_1000100763 | 157 |
| 155 | 3300007076 | Ga0075435_100776278 | Ga0075435_1007762781 | 157 |
| 156 | 3300007265 | Ga0099794_10452413 | Ga0099794_104524131 | 157 |
| 157 | 3300009093 | Ga0105240_10188145 | Ga0105240_101881451 | 157 |
| 158 | 3300009094 | Ga0111539_10092037 | Ga0111539_100920372 | 157 |
| 159 | 3300009098 | Ga0105245_10668288 | Ga0105245_106682882 | 157 |
| 160 | 3300009098 | Ga0105245_10693795 | Ga0105245_106937952 | 157 |
| 161 | 3300009147 | Ga0114129_10017195 | Ga0114129_100171954 | 157 |
| 162 | 3300009147 | Ga0114129_10026239 | Ga0114129_100262392 | 157 |
| 163 | 3300009147 | Ga0114129_10309419 | Ga0114129_103094192 | 157 |
| 164 | 3300009148 | Ga0105243_10189483 | Ga0105243_101894832 | 157 |
| 165 | 3300009174 | Ga0105241_10318745 | Ga0105241_103187452 | 157 |
| 166 | 3300009177 | Ga0105248_10018671 | Ga0105248_100186714 | 157 |
| 167 | 3300009177 | Ga0105248_10020246 | Ga0105248_100202468 | 157 |
| 168 | 3300009177 | Ga0105248_10509876 | Ga0105248_105098762 | 157 |
| 169 | 3300009177 | Ga0105248_10767557 | Ga0105248_107675572 | 157 |
| 170 | 3300009177 | Ga0105248_11591798 | Ga0105248_115917981 | 157 |
| 171 | 3300009553 | Ga0105249_10007162 | Ga0105249_100071622 | 157 |
| 172 | 3300009553 | Ga0105249_10128718 | Ga0105249_101287182 | 157 |
| 173 | 3300010375 | Ga0105239_10164540 | Ga0105239_101645402 | 157 |
| 174 | 3300011119 | Ga0105246_10843920 | Ga0105246_108439202 | 157 |
| 175 | 3300013104 | Ga0157370_10196081 | Ga0157370_101960812 | 157 |
| 176 | 3300013105 | Ga0157369_10924424 | Ga0157369_109244241 | 157 |
| 177 | 3300013306 | Ga0163162_10145993 | Ga0163162_101459932 | 157 |
| 178 | 3300013308 | Ga0157375_10291738 | Ga0157375_102917382 | 157 |
| 179 | 3300014326 | Ga0157380_10000616 | Ga0157380_1000061621 | 157 |
| 180 | 3300014326 | Ga0157380_10007312 | Ga0157380_100073129 | 157 |
| 181 | 3300014326 | Ga0157380_10175185 | Ga0157380_101751853 | 157 |
| 182 | 3300014326 | Ga0157380_10452141 | Ga0157380_104521413 | 157 |
| 183 | 3300014326 | Ga0157380_10571178 | Ga0157380_105711782 | 157 |
| 184 | 3300014326 | Ga0157380_12867223 | Ga0157380_128672231 | 157 |
| 185 | 3300014745 | Ga0157377_10450044 | Ga0157377_104500441 | 157 |
| 186 | 3300014968 | Ga0157379_10262772 | Ga0157379_102627722 | 157 |
| 187 | 3300014968 | Ga0157379_11061069 | Ga0157379_110610692 | 157 |
| 188 | 3300014969 | Ga0157376_10311964 | Ga0157376_103119642 | 157 |
| 189 | 3300025315 | Ga0207697_10039844 | Ga0207697_100398442 | 157 |
| 190 | 3300025893 | Ga0207682_10006053 | Ga0207682_100060534 | 157 |
| 191 | 3300025893 | Ga0207682_10032108 | Ga0207682_100321082 | 157 |
| 192 | 3300025901 | Ga0207688_10056169 | Ga0207688_100561693 | 157 |
| 193 | 3300025901 | Ga0207688_10297312 | Ga0207688_102973122 | 157 |
| 194 | 3300025903 | Ga0207680_10391340 | Ga0207680_103913402 | 157 |
| 195 | 3300025907 | Ga0207645_10054513 | Ga0207645_100545132 | 157 |
| 196 | 3300025908 | Ga0207643_10000586 | Ga0207643_100005862 | 157 |
| 197 | 3300025911 | Ga0207654_10223324 | Ga0207654_102233242 | 157 |
| 198 | 3300025912 | Ga0207707_10226042 | Ga0207707_102260421 | 157 |
| 199 | 3300025919 | Ga0207657_10189278 | Ga0207657_101892782 | 157 |
| 200 | 3300025920 | Ga0207649_10039377 | Ga0207649_100393773 | 157 |
| 201 | 3300025920 | Ga0207649_10188810 | Ga0207649_101888102 | 157 |
| 202 | 3300025922 | Ga0207646_10133897 | Ga0207646_101338972 | 157 |
| 203 | 3300025922 | Ga0207646_10457764 | Ga0207646_104577642 | 157 |
| 204 | 3300025922 | Ga0207646_11135104 | Ga0207646_111351041 | 157 |
| 205 | 3300025923 | Ga0207681_10184304 | Ga0207681_101843041 | 157 |
| 206 | 3300025923 | Ga0207681_10249798 | Ga0207681_102497982 | 157 |
| 207 | 3300025923 | Ga0207681_10402477 | Ga0207681_104024772 | 157 |
| 208 | 3300025926 | Ga0207659_10000495 | Ga0207659_1000049519 | 157 |
| 209 | 3300025926 | Ga0207659_10096068 | Ga0207659_100960683 | 157 |
| 210 | 3300025926 | Ga0207659_10355822 | Ga0207659_103558222 | 157 |
| 211 | 3300025931 | Ga0207644_10027834 | Ga0207644_100278343 | 157 |
| 212 | 3300025931 | Ga0207644_10134631 | Ga0207644_101346312 | 157 |
| 213 | 3300025932 | Ga0207690_10164663 | Ga0207690_101646631 | 157 |
| 214 | 3300025933 | Ga0207706_10202109 | Ga0207706_102021093 | 157 |
| 215 | 3300025934 | Ga0207686_10095782 | Ga0207686_100957822 | 157 |
| 216 | 3300025935 | Ga0207709_10108386 | Ga0207709_101083861 | 157 |
| 217 | 3300025936 | Ga0207670_10037919 | Ga0207670_100379192 | 157 |
| 218 | 3300025936 | Ga0207670_11122101 | Ga0207670_111221011 | 157 |
| 219 | 3300025937 | Ga0207669_10000542 | Ga0207669_100005426 | 157 |
| 220 | 3300025937 | Ga0207669_10060399 | Ga0207669_100603992 | 157 |
| 221 | 3300025937 | Ga0207669_10100078 | Ga0207669_101000783 | 157 |
| 222 | 3300025938 | Ga0207704_10219465 | Ga0207704_102194652 | 157 |
| 223 | 3300025939 | Ga0207665_10944265 | Ga0207665_109442651 | 157 |
| 224 | 3300025940 | Ga0207691_10006977 | Ga0207691_100069775 | 157 |
| 225 | 3300025940 | Ga0207691_10439583 | Ga0207691_104395832 | 157 |
| 226 | 3300025941 | Ga0207711_10055138 | Ga0207711_100551382 | 157 |
| 227 | 3300025941 | Ga0207711_10824682 | Ga0207711_108246821 | 157 |
| 228 | 3300025941 | Ga0207711_10849122 | Ga0207711_108491222 | 157 |
| 229 | 3300025942 | Ga0207689_10173671 | Ga0207689_101736712 | 157 |
| 230 | 3300025945 | Ga0207679_10018474 | Ga0207679_100184742 | 157 |
| 231 | 3300025949 | Ga0207667_10238227 | Ga0207667_102382271 | 157 |
| 232 | 3300025960 | Ga0207651_10172887 | Ga0207651_101728872 | 157 |
| 233 | 3300025961 | Ga0207712_10336492 | Ga0207712_103364922 | 157 |
| 234 | 3300025972 | Ga0207668_10146749 | Ga0207668_101467492 | 157 |
| 235 | 3300025981 | Ga0207640_10028655 | Ga0207640_100286552 | 157 |
| 236 | 3300025986 | Ga0207658_10564168 | Ga0207658_105641681 | 157 |
| 237 | 3300026035 | Ga0207703_10036611 | Ga0207703_100366112 | 157 |
| 238 | 3300026035 | Ga0207703_11094242 | Ga0207703_110942422 | 157 |
| 239 | 3300026067 | Ga0207678_10207154 | Ga0207678_102071541 | 157 |
| 240 | 3300026075 | Ga0207708_10021427 | Ga0207708_100214274 | 157 |
| 241 | 3300026075 | Ga0207708_10036827 | Ga0207708_100368272 | 157 |
| 242 | 3300026088 | Ga0207641_10050607 | Ga0207641_100506072 | 157 |
| 243 | 3300026089 | Ga0207648_10011300 | Ga0207648_100113004 | 157 |
| 244 | 3300026089 | Ga0207648_10137453 | Ga0207648_101374532 | 157 |
| 245 | 3300026095 | Ga0207676_10199729 | Ga0207676_101997292 | 157 |
| 246 | 3300026095 | Ga0207676_11306583 | Ga0207676_113065831 | 157 |
| 247 | 3300026118 | Ga0207675_100112990 | Ga0207675_1001129902 | 157 |
| 248 | 3300026121 | Ga0207683_10010838 | Ga0207683_100108386 | 157 |
| 249 | 3300026121 | Ga0207683_10034828 | Ga0207683_100348282 | 157 |
| 250 | 3300026121 | Ga0207683_10260070 | Ga0207683_102600702 | 157 |
| 251 | 3300026142 | Ga0207698_10351544 | Ga0207698_103515442 | 157 |
| 252 | 3300027907 | Ga0207428_10006512 | Ga0207428_100065126 | 157 |
| 253 | 3300031824 | Ga0307413_11171066 | Ga0307413_111710662 | 157 |
| 254 | 3300031995 | Ga0307409_100760098 | Ga0307409_1007600982 | 157 |
| 255 | 3300035090 | Ga0373949_0122504 | Ga0373949_0122504_181_654 | 157 |
| 256 | 3300035091 | Ga0373951_0032422 | Ga0373951_0032422_727_1200 | 157 |
| 257 | 3300035114 | Ga0373939_0084782 | Ga0373939_0084782_264_767 | 157 |
| 258 | 3300042133 | Ga0450896_008875 | Ga0450896_008875_24_500 | 157 |
| 259 | 3300042436 | Ga0439435_0242658 | Ga0439435_0242658_88_567 | 157 |
| 260 | 3300042531 | Ga0450918_009046 | Ga0450918_009046_78_554 | 157 |
| 261 | 3300042876 | Ga0451577_0018105 | Ga0451577_0018105_4081_4569 | 157 |
| 262 | 3300044712 | Ga0453684_0075341 | Ga0453684_0075341_1789_2277 | 157 |
| 263 | 3300045976 | Ga0466967_0902812 | Ga0466967_0902812_187_660 | 157 |
| 264 | 3300048904 | Ga0496101_0556695 | Ga0496101_0556695_210_683 | 157 |
| 265 | 3300048909 | Ga0496106_0169669 | Ga0496106_0169669_36_509 | 157 |
| 266 | 3300048910 | Ga0496107_0407103 | Ga0496107_0407103_55_537 | 157 |
| 267 | 3300048912 | Ga0496109_1944747 | Ga0496109_1944747_20_493 | 157 |
| 268 | 3300048915 | Ga0496112_0166642 | Ga0496112_0166642_311_784 | 157 |
| 269 | 3300048915 | Ga0496112_0569481 | Ga0496112_0569481_17_490 | 157 |
| 270 | 3300049568 | Ga0501031_0290955 | Ga0501031_0290955_349_822 | 157 |
| 271 | 3300049571 | Ga0501034_0121360 | Ga0501034_0121360_1313_1786 | 157 |
| 272 | 3300049572 | Ga0501036_0174065 | Ga0501036_0174065_261_734 | 157 |
| 273 | 3300049573 | Ga0501037_0625200 | Ga0501037_0625200_170_643 | 157 |
| 274 | 3300049576 | Ga0501040_0105790 | Ga0501040_0105790_215_688 | 157 |
| 275 | 3300049576 | Ga0501040_1026782 | Ga0501040_1026782_82_555 | 157 |
| 276 | 3300049577 | Ga0501041_0079376 | Ga0501041_0079376_365_838 | 157 |
| 277 | 3300049581 | Ga0501047_0172995 | Ga0501047_0172995_847_1320 | 157 |
| 278 | 3300049582 | Ga0501048_0148236 | Ga0501048_0148236_171_644 | 157 |
| 279 | 3300049583 | Ga0501067_0339703 | Ga0501067_0339703_178_651 | 157 |
| 280 | 3300049587 | Ga0501071_0019435 | Ga0501071_0019435_2960_3433 | 157 |
| 281 | 3300049588 | Ga0501072_0147124 | Ga0501072_0147124_180_653 | 157 |
| 282 | 3300049590 | Ga0501074_0486693 | Ga0501074_0486693_295_768 | 157 |
| 283 | 3300049591 | Ga0501075_0024911 | Ga0501075_0024911_954_1427 | 157 |
| 284 | 3300049741 | Ga0501079_0225440 | Ga0501079_0225440_876_1349 | 157 |
| 285 | 3300049742 | Ga0501080_1444607 | Ga0501080_1444607_15_497 | 157 |
| 286 | 3300049824 | Ga0501045_0020822 | Ga0501045_0020822_1271_1744 | 157 |
| 287 | 3300049824 | Ga0501045_0082828 | Ga0501045_0082828_1737_2219 | 157 |
| 288 | 3300049824 | Ga0501045_0586551 | Ga0501045_0586551_144_617 | 157 |
| 289 | 3300049824 | Ga0501045_0921912 | Ga0501045_0921912_112_585 | 157 |
| 290 | 3300050489 | nmdc:mga03683_312978_c1 | nmdc:mga03683_312978_c1_18_500 | 157 |
| 291 | 3300050491 | nmdc:mga00v17_4326_c1 | nmdc:mga00v17_4326_c1_4968_5468 | 157 |
| 292 | 3300050492 | nmdc:mga0yw44_65710_c1 | nmdc:mga0yw44_65710_c1_963_1463 | 157 |
| 293 | 3300050493 | nmdc:mga0k408_152201_c1 | nmdc:mga0k408_152201_c1_398_898 | 157 |
| 294 | 3300050493 | nmdc:mga0k408_222942_c1 | nmdc:mga0k408_222942_c1_163_645 | 157 |
| 295 | 3300050494 | nmdc:mga06z11_305603_c1 | nmdc:mga06z11_305603_c1_166_672 | 157 |
| 296 | 3300050495 | nmdc:mga04h51_135328_c1 | nmdc:mga04h51_135328_c1_255_737 | 157 |
| 297 | 3300050495 | nmdc:mga04h51_97392_c1 | nmdc:mga04h51_97392_c1_19_501 | 157 |
| 298 | 3300050507 | nmdc:mga05p37_23262_c1 | nmdc:mga05p37_23262_c1_1153_1635 | 157 |
| 299 | 3300050507 | nmdc:mga05p37_348758_c1 | nmdc:mga05p37_348758_c1_891_1376 | 157 |
| 300 | 3300050507 | nmdc:mga05p37_60499_c1 | nmdc:mga05p37_60499_c1_1632_2117 | 157 |
| 301 | 3300050507 | nmdc:mga05p37_979418_c1 | nmdc:mga05p37_979418_c1_241_717 | 157 |
| 302 | 3300050508 | nmdc:mga09592_220973_c1 | nmdc:mga09592_220973_c1_690_1175 | 157 |
| 303 | 3300050508 | nmdc:mga09592_53479_c1 | nmdc:mga09592_53479_c1_752_1255 | 157 |
| 304 | 3300050509 | nmdc:mga0qj67_331330_c1 | nmdc:mga0qj67_331330_c1_468_947 | 157 |
| 305 | 3300050511 | nmdc:mga08y16_1363987_c1 | nmdc:mga08y16_1363987_c1_135_611 | 157 |
| 306 | 3300050511 | nmdc:mga08y16_152247_c1 | nmdc:mga08y16_152247_c1_134_619 | 157 |
| 307 | 3300050512 | nmdc:mga0n895_237354_c1 | nmdc:mga0n895_237354_c1_1250_1735 | 157 |
| 308 | 3300050512 | nmdc:mga0n895_73465_c1 | nmdc:mga0n895_73465_c1_179_655 | 157 |
| 309 | 3300050512 | nmdc:mga0n895_74988_c1 | nmdc:mga0n895_74988_c1_42_518 | 157 |
| 310 | 3300050512 | nmdc:mga0n895_81_c1 | nmdc:mga0n895_81_c1_14696_15220 | 157 |
| 311 | 3300050513 | nmdc:mga0rr50_1054834_c1 | nmdc:mga0rr50_1054834_c1_97_579 | 157 |
| 312 | 3300050513 | nmdc:mga0rr50_1_c1 | nmdc:mga0rr50_1_c1_129831_130355 | 157 |
| 313 | 3300050513 | nmdc:mga0rr50_29040_c1 | nmdc:mga0rr50_29040_c1_111_587 | 157 |
| 314 | 3300050513 | nmdc:mga0rr50_349890_c1 | nmdc:mga0rr50_349890_c1_390_863 | 157 |
| 315 | 3300050513 | nmdc:mga0rr50_631101_c1 | nmdc:mga0rr50_631101_c1_299_775 | 157 |
| 316 | 3300050514 | nmdc:mga08x19_265_c1 | nmdc:mga08x19_265_c1_13134_13658 | 157 |
| 317 | 3300050514 | nmdc:mga08x19_290731_c1 | nmdc:mga08x19_290731_c1_357_833 | 157 |
| 318 | 3300050515 | nmdc:mga0a205_1493661_c1 | nmdc:mga0a205_1493661_c1_18_497 | 157 |
| 319 | 3300050515 | nmdc:mga0a205_25115_c1 | nmdc:mga0a205_25115_c1_4961_5437 | 157 |
| 320 | 3300050515 | nmdc:mga0a205_92323_c1 | nmdc:mga0a205_92323_c1_456_938 | 157 |
| 321 | 3300054114 | Ga0501084_0317716 | Ga0501084_0317716_369_842 | 157 |
| 322 | 3300060353 | Ga0501082_0442578 | Ga0501082_0442578_604_1098 | 157 |
| 323 | 3300060353 | Ga0501082_0816925 | Ga0501082_0816925_49_522 | 157 |
| 324 | 3300061734 | Ga0530510_0627762 | Ga0530510_0627762_166_660 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rxq-assembly1.cif.gz_B | yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology | 0.8471 | 1 | 155 |
| 1rxq-assembly1.cif.gz_B | yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology | 0.8269 | 1 | 155 |
| 2p1a-assembly1.cif.gz_A | crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution | 0.8261 | 14 | 155 |
| 2rd9-assembly3.cif.gz_B | crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution | 0.8251 | 14 | 155 |
| 2yqy-assembly2.cif.gz_B | crystal structure of tt2238, a four-helix bundle protein | 0.8117 | 14 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1rxqD00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8512 | 1 | 155 | 1.20.120.450 |
| 2rd9B01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8258 | 14 | 153 | 1.20.120.450 |
| 1rxqD00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8207 | 1 | 155 | 1.20.120.450 |
| 2yqyB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8117 | 14 | 153 | 1.20.120.450 |
| 5cogA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7679 | 14 | 153 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8EKY6-F1-model_v4 | DinB-like domain-containing protein | 0.9715 | 31 | 155 |
|
| AF-A0A2V7ZGD2-F1-model_v4 | DinB-like domain-containing protein | 0.9711 | 3 | 155 |
|
| AF-A0A2V8B7D9-F1-model_v4 | DinB-like domain-containing protein | 0.9705 | 20 | 155 |
|
| AF-A0A2V8CGZ6-F1-model_v4 | DinB-like domain-containing protein | 0.967 | 53 | 153 |
|
| AF-A0A2V7IRB1-F1-model_v4 | DinB-like domain-containing protein | 0.9616 | 1 | 152 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar