F407140

General Info

Members Datasets Scaffolds Average Seq Length
323 232 646 330

Family's Representative Sequence

Representative Sequence 3300053733|Ga0500552_000497|Ga0500552_000497_846_2024
Length 392
Sequence MAVWTFMVSFLLGLTLAPQVRFDEGDLGSVVPTTNDWASAMLDTASEIPSLAAKASGSLVPVPGRGKMASDALSDLLKTVRLTGATFFDVVARNPWVAEQPTREMVLPKVLPGAEHLISYHVITEGRCFAGIVGQAPIAVDAGEVIVFTRGDPHVVSSDPGMRAQPVTPAEMAAATAGPLPFFKSLGGEGPPSVKMVCGFLACDAHPFNPLLDNLPPVIKAGKPRGDDANWLSQFIRLARNESADKRAGGESVLAKLSELMFIEVVRQYLEALPPEQAGWLAGLRDPFVGKALSMMHASPARNWTIEELAKDVGLSRSVLAERFTDLVGMPPMHYLAKWRMQIASGLLSGGNANMATIAAEIGYGSEAAFSRAFKNVVGVPPSAWRRRSVAA

Samples

Sample ID Description Type Environment
1 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
220 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
221 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
222 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
226 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
232 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.43
Nodule 0.62
Rhizoplane 10.53
Rhizosphere 79.26
Stem 0
Stem Tuber 0
Unclassified 7.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500552_000497 3300053733 Bacteria 3629
2 JGI25159J45721_1000779 3300002987 Bacteria 13860
3 rootH2_10001552 3300003320 Bacteria 19514
4 rootL2_10218426 3300003322 Bacteria 1662
5 Ga0070676_10061136 3300005328 Bacteria 2239
6 Ga0068869_100150609 3300005334 Bacteria 1804
7 Ga0070682_100006350 3300005337 Bacteria 6636
8 Ga0068868_100009933 3300005338 Bacteria 6874
9 Ga0068868_100052024 3300005338 Bacteria 3224
10 Ga0070689_100019897 3300005340 Bacteria 4971
11 Ga0070675_100044877 3300005354 Bacteria 3615
12 Ga0070674_100123905 3300005356 Bacteria 1917
13 Ga0070673_100043202 3300005364 Bacteria 3481
14 Ga0070688_100019902 3300005365 Bacteria 3894
15 Ga0070688_100053373 3300005365 Unclassified 2528
16 Ga0070688_100173590 3300005365 Bacteria 1490
17 Ga0070659_100043715 3300005366 Bacteria 3504
18 Ga0070659_100067654 3300005366 Bacteria 2833
19 Ga0070659_100361814 3300005366 Unclassified 1219
20 Ga0070705_100007412 3300005440 Bacteria 5395
21 Ga0070694_100066103 3300005444 Bacteria 2480
22 Ga0070694_100166044 3300005444 Bacteria 1623
23 Ga0070663_100004225 3300005455 Bacteria 8403
24 Ga0070663_100129345 3300005455 Bacteria 1916
25 Ga0070678_100076276 3300005456 Bacteria 2524
26 Ga0068867_100031492 3300005459 Bacteria 3830
27 Ga0070685_10045344 3300005466 Bacteria 2521
28 Ga0070685_10301927 3300005466 Bacteria 1079
29 Ga0070706_100384577 3300005467 Bacteria 1307
30 Ga0070698_100002746 3300005471 Bacteria 19357
31 Ga0070679_100333103 3300005530 Unclassified 1466
32 Ga0070684_100155639 3300005535 Bacteria 2072
33 Ga0068853_100002917 3300005539 Bacteria 13004
34 Ga0070672_100072784 3300005543 Bacteria 2737
35 Ga0070672_100152236 3300005543 Bacteria 1914
36 Ga0070695_100006320 3300005545 Bacteria 7001
37 Ga0070695_100013095 3300005545 Bacteria 4983
38 Ga0070696_100005386 3300005546 Bacteria 8533
39 Ga0070693_100001111 3300005547 Bacteria 12067
40 Ga0070693_100001674 3300005547 Bacteria 10044
41 Ga0070665_100157533 3300005548 Bacteria 2272
42 Ga0070704_100182162 3300005549 Bacteria 1681
43 Ga0068855_100034267 3300005563 Bacteria 6057
44 Ga0068855_100034921 3300005563 Bacteria 5992
45 Ga0068855_100045547 3300005563 Bacteria 5189
46 Ga0068855_100052605 3300005563 Bacteria 4794
47 Ga0068855_100153473 3300005563 Bacteria 2617
48 Ga0068857_100062503 3300005577 Bacteria 3310
49 Ga0068854_100158249 3300005578 Bacteria 1752
50 Ga0070702_100036091 3300005615 Bacteria 2736
51 Ga0070702_100227046 3300005615 Bacteria 1252
52 Ga0068852_100159925 3300005616 Unclassified 2102
53 Ga0068852_100341811 3300005616 Unclassified 1459
54 Ga0068864_100106744 3300005618 Bacteria 2490
55 Ga0068866_10105359 3300005718 Bacteria 1563
56 Ga0068861_100090974 3300005719 Bacteria 2408
57 Ga0068858_100074038 3300005842 Bacteria 3162
58 Ga0068858_100117752 3300005842 Bacteria 2483
59 Ga0068858_100384463 3300005842 Bacteria 1347
60 Ga0068860_100212399 3300005843 Bacteria 1877
61 Ga0068862_100010061 3300005844 Bacteria 7808
62 Ga0070717_10114258 3300006028 Bacteria 2306
63 Ga0075365_10095982 3300006038 Bacteria 2026
64 Ga0075368_10079849 3300006042 Bacteria 1330
65 Ga0075364_10044318 3300006051 Bacteria 2893
66 Ga0070715_10006309 3300006163 Bacteria 4022
67 Ga0075362_10007911 3300006177 Bacteria 4045
68 Ga0075367_10029927 3300006178 Bacteria 3118
69 Ga0075366_10018510 3300006195 Bacteria 4022
70 Ga0097621_100024079 3300006237 Bacteria 4749
71 Ga0068871_100109766 3300006358 Bacteria 2320
72 Ga0075433_10118614 3300006852 Bacteria 2348
73 Ga0068865_100032564 3300006881 Bacteria 3483
74 Ga0068865_100096883 3300006881 Bacteria 2152
75 Ga0068865_100148381 3300006881 Bacteria 1776
76 Ga0111539_10032293 3300009094 Bacteria 6358
77 Ga0111539_10076118 3300009094 Bacteria 3952
78 Ga0105245_10035616 3300009098 Bacteria 4418
79 Ga0105245_10070244 3300009098 Bacteria 3177
80 Ga0105245_10143632 3300009098 Bacteria 2250
81 Ga0105245_10156673 3300009098 Unclassified 2157
82 Ga0105245_10160952 3300009098 Bacteria 2130
83 Ga0105247_10089446 3300009101 Bacteria 1952
84 Ga0105243_10508650 3300009148 Bacteria 1143
85 Ga0105241_10116583 3300009174 Bacteria 2145
86 Ga0105242_10111238 3300009176 Bacteria 2335
87 Ga0105237_10066376 3300009545 Unclassified 3603
88 Ga0105238_10002687 3300009551 Bacteria 17688
89 Ga0105249_10011440 3300009553 Bacteria 7795
90 Ga0105239_10060688 3300010375 Bacteria 4150
91 Ga0105239_10067972 3300010375 Bacteria 3916
92 Ga0105239_10091842 3300010375 Bacteria 3351
93 Ga0105246_10045869 3300011119 Bacteria 2979
94 Ga0105246_10126589 3300011119 Bacteria 1901
95 Ga0157370_10076184 3300013104 Bacteria 3160
96 Ga0157370_10126019 3300013104 Bacteria 2390
97 Ga0157370_10166421 3300013104 Bacteria 2050
98 Ga0157374_10004175 3300013296 Bacteria 12132
99 Ga0157374_10032269 3300013296 Bacteria 4767
100 Ga0157378_10044567 3300013297 Bacteria 3939
101 Ga0157378_10355970 3300013297 Bacteria 1431
102 Ga0163162_10037413 3300013306 Bacteria 4843
103 Ga0163162_10213362 3300013306 Bacteria 2060
104 Ga0163162_10335579 3300013306 Unclassified 1644
105 Ga0157372_10267339 3300013307 Bacteria 1986
106 Ga0163163_10044079 3300014325 Bacteria 4375
107 Ga0157380_10236057 3300014326 Bacteria 1645
108 Ga0157376_10038425 3300014969 Bacteria 3895
109 Ga0157376_10042294 3300014969 Bacteria 3735
110 Ga0163161_10025363 3300017792 Bacteria 4195
111 Ga0213876_10056988 3300021384 Bacteria 2063
112 Ga0207692_10048919 3300025898 Bacteria 2131
113 Ga0207710_10088355 3300025900 Bacteria 1447
114 Ga0207685_10023367 3300025905 Bacteria 2104
115 Ga0207699_10068203 3300025906 Bacteria 2165
116 Ga0207643_10057375 3300025908 Bacteria 2216
117 Ga0207705_10001189 3300025909 Bacteria 21103
118 Ga0207707_10009787 3300025912 Bacteria 8314
119 Ga0207707_10021030 3300025912 Bacteria 5699
120 Ga0207707_10062288 3300025912 Bacteria 3246
121 Ga0207663_10126888 3300025916 Bacteria 1756
122 Ga0207660_10006700 3300025917 Bacteria 7461
123 Ga0207660_10014154 3300025917 Bacteria 5238
124 Ga0207657_10000144 3300025919 Bacteria 72030
125 Ga0207652_10013528 3300025921 Bacteria 6601
126 Ga0207681_10070089 3300025923 Bacteria 2441
127 Ga0207659_10027841 3300025926 Bacteria 3832
128 Ga0207659_10195527 3300025926 Bacteria 1612
129 Ga0207687_10105956 3300025927 Bacteria 2078
130 Ga0207700_10286697 3300025928 Bacteria 1418
131 Ga0207664_10226855 3300025929 Bacteria 1622
132 Ga0207690_10035229 3300025932 Bacteria 3231
133 Ga0207690_10201883 3300025932 Unclassified 1510
134 Ga0207690_10320101 3300025932 Unclassified 1219
135 Ga0207709_10154424 3300025935 Bacteria 1593
136 Ga0207670_10069026 3300025936 Bacteria 2437
137 Ga0207670_10205895 3300025936 Bacteria 1497
138 Ga0207704_10018619 3300025938 Bacteria 3630
139 Ga0207665_10084206 3300025939 Bacteria 2194
140 Ga0207691_10048085 3300025940 Bacteria 3912
141 Ga0207691_10104689 3300025940 Bacteria 2521
142 Ga0207711_10156855 3300025941 Bacteria 2058
143 Ga0207689_10021836 3300025942 Bacteria 5382
144 Ga0207689_10082007 3300025942 Bacteria 2651
145 Ga0207679_10332081 3300025945 Bacteria 1320
146 Ga0207667_10107840 3300025949 Bacteria 2874
147 Ga0207651_10007492 3300025960 Bacteria 5818
148 Ga0207651_10065856 3300025960 Bacteria 2543
149 Ga0207668_10114759 3300025972 Bacteria 2028
150 Ga0207668_10398456 3300025972 Bacteria 1163
151 Ga0207677_10194586 3300026023 Bacteria 1607
152 Ga0207678_10000193 3300026067 Bacteria 52686
153 Ga0207678_10051844 3300026067 Bacteria 3541
154 Ga0207678_10109067 3300026067 Bacteria 2361
155 Ga0207708_10108380 3300026075 Bacteria 2154
156 Ga0207702_10263066 3300026078 Bacteria 1625
157 Ga0207641_10389525 3300026088 Bacteria 1336
158 Ga0207648_10043701 3300026089 Bacteria 3933
159 Ga0207648_10208603 3300026089 Bacteria 1734
160 Ga0207674_10093580 3300026116 Bacteria 2993
161 Ga0207674_10176352 3300026116 Bacteria 2089
162 Ga0207675_100015554 3300026118 Bacteria 7097
163 Ga0207683_10055900 3300026121 Bacteria 3461
164 Ga0207683_10085079 3300026121 Bacteria 2811
165 Ga0209813_10079323 3300027866 Bacteria 1082
166 Ga0207428_10261833 3300027907 Bacteria 1288
167 Ga0268266_10002515 3300028379 Bacteria 19525
168 Ga0268266_10459596 3300028379 Bacteria 1211
169 Ga0268264_10284827 3300028381 Bacteria 1549
170 Ga0265332_10001709 3300031238 Bacteria 11962
171 Ga0265340_10001308 3300031247 Bacteria 14259
172 Ga0265339_10007062 3300031249 Bacteria 7289
173 Ga0265331_10036265 3300031250 Bacteria 2421
174 Ga0265316_10161340 3300031344 Bacteria 1676
175 Ga0307408_100062418 3300031548 Bacteria 2723
176 Ga0265314_10003459 3300031711 Bacteria 15256
177 Ga0265314_10126594 3300031711 Bacteria 1599
178 Ga0265342_10006882 3300031712 Bacteria 8401
179 Ga0316576_10133862 3300031727 Bacteria 1865
180 Ga0307413_10005472 3300031824 Bacteria 5675
181 Ga0307410_10027451 3300031852 Bacteria 3598
182 Ga0307406_10025212 3300031901 Bacteria 3558
183 Ga0307409_100038694 3300031995 Bacteria 3530
184 Ga0307415_100028854 3300032126 Bacteria 3537
185 Ga0307415_100064051 3300032126 Bacteria 2557
186 Ga0316583_10071825 3300032133 Bacteria 1211
187 Ga0373943_0055558 3300035170 Unclassified 1962
188 Ga0316574_0137631 3300035398 Bacteria 1572
189 Ga0373931_0025481 3300035691 Bacteria 3004
190 Ga0373935_0095698 3300035692 Bacteria 1951
191 Ga0373927_0302557 3300035695 Unclassified 1052
192 Ga0373933_0123826 3300035724 Bacteria 1621
193 Ga0373947_0043502 3300035725 Bacteria 2683
194 Ga0373937_0136259 3300036401 Bacteria 2296
195 Ga0373937_0325547 3300036401 Unclassified 1454
196 Ga0395899_0021089 3300037312 Bacteria 4941
197 Ga0395900_0048193 3300037418 Bacteria 4389
198 Ga0395898_0036626 3300037466 Bacteria 4871
199 Ga0395901_0026501 3300038443 Bacteria 5952
200 Ga0436365_1362430 3300039437 Bacteria 2236
201 Ga0436365_1772565 3300039437 Bacteria 1731
202 Ga0436363_0119989 3300039450 Bacteria 2371
203 Ga0466957_0081274 3300044842 Bacteria 2018
204 Ga0451576_0013022 3300045051 Bacteria 9317
205 Ga0451576_0151790 3300045051 Bacteria 2416
206 Ga0495603_0112256 3300046455 Unclassified 1589
207 Ga0495629_0007260 3300046459 Bacteria 8161
208 Ga0495629_0153294 3300046459 Bacteria 1601
209 Ga0495629_0199925 3300046459 Bacteria 1382
210 Ga0495651_0078608 3300046462 Unclassified 2495
211 Ga0495580_0033527 3300046472 Bacteria 3699
212 Ga0495594_0001434 3300046499 Bacteria 12358
213 Ga0495606_0124773 3300046507 Bacteria 1537
214 Ga0495652_0027392 3300046529 Bacteria 5021
215 Ga0495640_0166148 3300046533 Bacteria 1412
216 Ga0495587_0123714 3300046536 Bacteria 1480
217 Ga0495645_0001793 3300046543 Bacteria 14565
218 Ga0495622_0015319 3300046557 Bacteria 3565
219 Ga0495634_0025204 3300046642 Bacteria 4167
220 Ga0495647_0117268 3300046681 Unclassified 1116
221 Ga0495658_0030311 3300046683 Bacteria 2936
222 Ga0495669_0061597 3300046684 Bacteria 1698
223 Ga0495613_0023776 3300046689 Bacteria 4566
224 Ga0495600_0024268 3300046809 Bacteria 3903
225 Ga0495600_0050683 3300046809 Bacteria 2709
226 Ga0495581_0013845 3300047315 Bacteria 4675
227 Ga0495604_0077362 3300047317 Unclassified 2501
228 Ga0495680_0029438 3300047322 Bacteria 4497
229 Ga0495680_0067634 3300047322 Bacteria 2731
230 Ga0495684_0041192 3300047471 Bacteria 3540
231 Ga0495686_0014185 3300047472 Bacteria 5494
232 Ga0495593_0016191 3300047673 Bacteria 4208
233 Ga0495602_0095270 3300048088 Unclassified 2458
234 Ga0495614_0038916 3300048089 Bacteria 2041
235 Ga0496100_0039405 3300048903 Bacteria 3001
236 Ga0496100_0040041 3300048903 Bacteria 2979
237 Ga0496101_0018479 3300048904 Bacteria 4741
238 Ga0496102_0052039 3300048905 Unclassified 3730
239 Ga0496102_0094149 3300048905 Bacteria 2775
240 Ga0496102_0374220 3300048905 Bacteria 1340
241 Ga0496103_0079297 3300048906 Bacteria 2063
242 Ga0496103_0208701 3300048906 Bacteria 1256
243 Ga0496104_0028556 3300048907 Bacteria 5170
244 Ga0496104_0101901 3300048907 Bacteria 2749
245 Ga0496105_0081560 3300048908 Bacteria 2672
246 Ga0496106_0092717 3300048909 Bacteria 2333
247 Ga0496106_0093704 3300048909 Bacteria 2321
248 Ga0496106_0158497 3300048909 Bacteria 1789
249 Ga0496106_0205524 3300048909 Bacteria 1568
250 Ga0496106_0208718 3300048909 Bacteria 1555
251 Ga0496107_0004961 3300048910 Bacteria 9055
252 Ga0496107_0292312 3300048910 Bacteria 1213
253 Ga0496108_0003198 3300048911 Bacteria 13178
254 Ga0496108_0177433 3300048911 Unclassified 1845
255 Ga0496108_0214914 3300048911 Bacteria 1670
256 Ga0496108_0319729 3300048911 Bacteria 1353
257 Ga0496109_0042214 3300048912 Bacteria 4131
258 Ga0496109_0045194 3300048912 Bacteria 3995
259 Ga0496110_0059605 3300048913 Bacteria 3365
260 Ga0496112_0100730 3300048915 Bacteria 2858
261 Ga0496112_0462579 3300048915 Bacteria 1206
262 Ga0496113_0084648 3300048916 Bacteria 2435
263 Ga0496114_0000652 3300048917 Bacteria 25611
264 Ga0496114_0016358 3300048917 Bacteria 5975
265 Ga0496114_0045995 3300048917 Bacteria 3626
266 Ga0496114_0108063 3300048917 Bacteria 2381
267 Ga0496114_0140582 3300048917 Bacteria 2090
268 Ga0496115_0002627 3300048918 Bacteria 12899
269 Ga0496126_0166945 3300048929 Bacteria 1878
270 Ga0501031_0017276 3300049568 Bacteria 4688
271 Ga0501033_0076163 3300049570 Bacteria 2463
272 Ga0501036_0082303 3300049572 Bacteria 2720
273 Ga0501037_0097746 3300049573 Bacteria 2121
274 Ga0501039_0026405 3300049575 Bacteria 4462
275 Ga0501039_0099570 3300049575 Bacteria 2268
276 Ga0501040_0071353 3300049576 Bacteria 2397
277 Ga0501041_0025991 3300049577 Bacteria 3519
278 Ga0501048_0070086 3300049582 Bacteria 2476
279 Ga0501067_0000247 3300049583 Bacteria 29692
280 Ga0501068_0020443 3300049584 Bacteria 3857
281 Ga0501070_0128547 3300049586 Bacteria 2093
282 Ga0501071_0058624 3300049587 Bacteria 2784
283 Ga0501072_0041569 3300049588 Bacteria 3611
284 Ga0501073_0020648 3300049589 Bacteria 4750
285 Ga0501073_0049405 3300049589 Bacteria 2950
286 Ga0501075_0279325 3300049591 Bacteria 1272
287 Ga0501079_0041824 3300049741 Bacteria 3538
288 Ga0501079_0139632 3300049741 Bacteria 1887
289 Ga0501080_0082100 3300049742 Bacteria 2994
290 Ga0501081_0145655 3300049743 Bacteria 1699
291 Ga0501035_0095464 3300049822 Bacteria 2614
292 Ga0501045_0051207 3300049824 Bacteria 3013
293 nmdc:mga03683_10669_c1 3300050489 Bacteria 3301
294 nmdc:mga00v17_17608_c1 3300050491 Bacteria 4048
295 nmdc:mga0yw44_125722_c1 3300050492 Bacteria 1656
296 nmdc:mga0k408_14689_c1 3300050493 Bacteria 4319
297 nmdc:mga06z11_19955_c1 3300050494 Bacteria 3091
298 nmdc:mga06r32_225598_c1 3300050510 Bacteria 1862
299 nmdc:mga08y16_174379_c1 3300050511 Bacteria 2233
300 nmdc:mga08y16_21515_c1 3300050511 Bacteria 6809
301 Ga0495601_0016392 3300053077 Bacteria 4489
302 Ga0495601_0067680 3300053077 Bacteria 2275
303 Ga0495601_0100822 3300053077 Unclassified 1865
304 Ga0495601_0275718 3300053077 Unclassified 1097
305 Ga0495655_0014337 3300053083 Bacteria 1660
306 Ga0495619_0001452 3300053085 Bacteria 15602
307 Ga0500566_0082847 3300053094 Bacteria 1782
308 Ga0500595_012665 3300053119 Bacteria 3254
309 Ga0500595_060499 3300053119 Bacteria 1146
310 Ga0500597_003514 3300053120 Unclassified 4646
311 Ga0500614_027273 3300053123 Bacteria 1371
312 Ga0500658_0064432 3300053134 Bacteria 1533
313 Ga0500616_0000501 3300053153 Bacteria 50041
314 Ga0500616_0006535 3300053153 Bacteria 7617
315 Ga0500636_0023304 3300053177 Plasmid 3661
316 Ga0500645_002121 3300053730 Bacteria 9148
317 Ga0501084_0070456 3300054114 Bacteria 2927
318 Ga0501082_0077972 3300060353 Bacteria 2857
319 Ga0466962_0070197 3300061719 Bacteria 1673
320 Ga0530510_0023814 3300061734 Bacteria 4365
321 Ga0530510_0109623 3300061734 Bacteria 2021
322 2509143874 2508501127 Bacteria 7037543
323 8055619867 8055617313 Bacteria 7548464
324 Ga0500552_000497
325 JGI25159J45721_1000779
326 rootH2_10001552
327 rootL2_10218426
328 Ga0070676_10061136
329 Ga0068869_100150609
330 Ga0070682_100006350
331 Ga0068868_100009933
332 Ga0068868_100052024
333 Ga0070689_100019897
334 Ga0070675_100044877
335 Ga0070674_100123905
336 Ga0070673_100043202
337 Ga0070688_100019902
338 Ga0070688_100053373
339 Ga0070688_100173590
340 Ga0070659_100043715
341 Ga0070659_100067654
342 Ga0070659_100361814
343 Ga0070705_100007412
344 Ga0070694_100066103
345 Ga0070694_100166044
346 Ga0070663_100004225
347 Ga0070663_100129345
348 Ga0070678_100076276
349 Ga0068867_100031492
350 Ga0070685_10045344
351 Ga0070685_10301927
352 Ga0070706_100384577
353 Ga0070698_100002746
354 Ga0070679_100333103
355 Ga0070684_100155639
356 Ga0068853_100002917
357 Ga0070672_100072784
358 Ga0070672_100152236
359 Ga0070695_100006320
360 Ga0070695_100013095
361 Ga0070696_100005386
362 Ga0070693_100001111
363 Ga0070693_100001674
364 Ga0070665_100157533
365 Ga0070704_100182162
366 Ga0068855_100034267
367 Ga0068855_100034921
368 Ga0068855_100045547
369 Ga0068855_100052605
370 Ga0068855_100153473
371 Ga0068857_100062503
372 Ga0068854_100158249
373 Ga0070702_100036091
374 Ga0070702_100227046
375 Ga0068852_100159925
376 Ga0068852_100341811
377 Ga0068864_100106744
378 Ga0068866_10105359
379 Ga0068861_100090974
380 Ga0068858_100074038
381 Ga0068858_100117752
382 Ga0068858_100384463
383 Ga0068860_100212399
384 Ga0068862_100010061
385 Ga0070717_10114258
386 Ga0075365_10095982
387 Ga0075368_10079849
388 Ga0075364_10044318
389 Ga0070715_10006309
390 Ga0075362_10007911
391 Ga0075367_10029927
392 Ga0075366_10018510
393 Ga0097621_100024079
394 Ga0068871_100109766
395 Ga0075433_10118614
396 Ga0068865_100032564
397 Ga0068865_100096883
398 Ga0068865_100148381
399 Ga0111539_10032293
400 Ga0111539_10076118
401 Ga0105245_10035616
402 Ga0105245_10070244
403 Ga0105245_10143632
404 Ga0105245_10156673
405 Ga0105245_10160952
406 Ga0105247_10089446
407 Ga0105243_10508650
408 Ga0105241_10116583
409 Ga0105242_10111238
410 Ga0105237_10066376
411 Ga0105238_10002687
412 Ga0105249_10011440
413 Ga0105239_10060688
414 Ga0105239_10067972
415 Ga0105239_10091842
416 Ga0105246_10045869
417 Ga0105246_10126589
418 Ga0157370_10076184
419 Ga0157370_10126019
420 Ga0157370_10166421
421 Ga0157374_10004175
422 Ga0157374_10032269
423 Ga0157378_10044567
424 Ga0157378_10355970
425 Ga0163162_10037413
426 Ga0163162_10213362
427 Ga0163162_10335579
428 Ga0157372_10267339
429 Ga0163163_10044079
430 Ga0157380_10236057
431 Ga0157376_10038425
432 Ga0157376_10042294
433 Ga0163161_10025363
434 Ga0213876_10056988
435 Ga0207692_10048919
436 Ga0207710_10088355
437 Ga0207685_10023367
438 Ga0207699_10068203
439 Ga0207643_10057375
440 Ga0207705_10001189
441 Ga0207707_10009787
442 Ga0207707_10021030
443 Ga0207707_10062288
444 Ga0207663_10126888
445 Ga0207660_10006700
446 Ga0207660_10014154
447 Ga0207657_10000144
448 Ga0207652_10013528
449 Ga0207681_10070089
450 Ga0207659_10027841
451 Ga0207659_10195527
452 Ga0207687_10105956
453 Ga0207700_10286697
454 Ga0207664_10226855
455 Ga0207690_10035229
456 Ga0207690_10201883
457 Ga0207690_10320101
458 Ga0207709_10154424
459 Ga0207670_10069026
460 Ga0207670_10205895
461 Ga0207704_10018619
462 Ga0207665_10084206
463 Ga0207691_10048085
464 Ga0207691_10104689
465 Ga0207711_10156855
466 Ga0207689_10021836
467 Ga0207689_10082007
468 Ga0207679_10332081
469 Ga0207667_10107840
470 Ga0207651_10007492
471 Ga0207651_10065856
472 Ga0207668_10114759
473 Ga0207668_10398456
474 Ga0207677_10194586
475 Ga0207678_10000193
476 Ga0207678_10051844
477 Ga0207678_10109067
478 Ga0207708_10108380
479 Ga0207702_10263066
480 Ga0207641_10389525
481 Ga0207648_10043701
482 Ga0207648_10208603
483 Ga0207674_10093580
484 Ga0207674_10176352
485 Ga0207675_100015554
486 Ga0207683_10055900
487 Ga0207683_10085079
488 Ga0209813_10079323
489 Ga0207428_10261833
490 Ga0268266_10002515
491 Ga0268266_10459596
492 Ga0268264_10284827
493 Ga0265332_10001709
494 Ga0265340_10001308
495 Ga0265339_10007062
496 Ga0265331_10036265
497 Ga0265316_10161340
498 Ga0307408_100062418
499 Ga0265314_10003459
500 Ga0265314_10126594
501 Ga0265342_10006882
502 Ga0316576_10133862
503 Ga0307413_10005472
504 Ga0307410_10027451
505 Ga0307406_10025212
506 Ga0307409_100038694
507 Ga0307415_100028854
508 Ga0307415_100064051
509 Ga0316583_10071825
510 Ga0373943_0055558
511 Ga0316574_0137631
512 Ga0373931_0025481
513 Ga0373935_0095698
514 Ga0373927_0302557
515 Ga0373933_0123826
516 Ga0373947_0043502
517 Ga0373937_0136259
518 Ga0373937_0325547
519 Ga0395899_0021089
520 Ga0395900_0048193
521 Ga0395898_0036626
522 Ga0395901_0026501
523 Ga0436365_1362430
524 Ga0436365_1772565
525 Ga0436363_0119989
526 Ga0466957_0081274
527 Ga0451576_0013022
528 Ga0451576_0151790
529 Ga0495603_0112256
530 Ga0495629_0007260
531 Ga0495629_0153294
532 Ga0495629_0199925
533 Ga0495651_0078608
534 Ga0495580_0033527
535 Ga0495594_0001434
536 Ga0495606_0124773
537 Ga0495652_0027392
538 Ga0495640_0166148
539 Ga0495587_0123714
540 Ga0495645_0001793
541 Ga0495622_0015319
542 Ga0495634_0025204
543 Ga0495647_0117268
544 Ga0495658_0030311
545 Ga0495669_0061597
546 Ga0495613_0023776
547 Ga0495600_0024268
548 Ga0495600_0050683
549 Ga0495581_0013845
550 Ga0495604_0077362
551 Ga0495680_0029438
552 Ga0495680_0067634
553 Ga0495684_0041192
554 Ga0495686_0014185
555 Ga0495593_0016191
556 Ga0495602_0095270
557 Ga0495614_0038916
558 Ga0496100_0039405
559 Ga0496100_0040041
560 Ga0496101_0018479
561 Ga0496102_0052039
562 Ga0496102_0094149
563 Ga0496102_0374220
564 Ga0496103_0079297
565 Ga0496103_0208701
566 Ga0496104_0028556
567 Ga0496104_0101901
568 Ga0496105_0081560
569 Ga0496106_0092717
570 Ga0496106_0093704
571 Ga0496106_0158497
572 Ga0496106_0205524
573 Ga0496106_0208718
574 Ga0496107_0004961
575 Ga0496107_0292312
576 Ga0496108_0003198
577 Ga0496108_0177433
578 Ga0496108_0214914
579 Ga0496108_0319729
580 Ga0496109_0042214
581 Ga0496109_0045194
582 Ga0496110_0059605
583 Ga0496112_0100730
584 Ga0496112_0462579
585 Ga0496113_0084648
586 Ga0496114_0000652
587 Ga0496114_0016358
588 Ga0496114_0045995
589 Ga0496114_0108063
590 Ga0496114_0140582
591 Ga0496115_0002627
592 Ga0496126_0166945
593 Ga0501031_0017276
594 Ga0501033_0076163
595 Ga0501036_0082303
596 Ga0501037_0097746
597 Ga0501039_0026405
598 Ga0501039_0099570
599 Ga0501040_0071353
600 Ga0501041_0025991
601 Ga0501048_0070086
602 Ga0501067_0000247
603 Ga0501068_0020443
604 Ga0501070_0128547
605 Ga0501071_0058624
606 Ga0501072_0041569
607 Ga0501073_0020648
608 Ga0501073_0049405
609 Ga0501075_0279325
610 Ga0501079_0041824
611 Ga0501079_0139632
612 Ga0501080_0082100
613 Ga0501081_0145655
614 Ga0501035_0095464
615 Ga0501045_0051207
616 nmdc:mga03683_10669_c1
617 nmdc:mga00v17_17608_c1
618 nmdc:mga0yw44_125722_c1
619 nmdc:mga0k408_14689_c1
620 nmdc:mga06z11_19955_c1
621 nmdc:mga06r32_225598_c1
622 nmdc:mga08y16_174379_c1
623 nmdc:mga08y16_21515_c1
624 Ga0495601_0016392
625 Ga0495601_0067680
626 Ga0495601_0100822
627 Ga0495601_0275718
628 Ga0495655_0014337
629 Ga0495619_0001452
630 Ga0500566_0082847
631 Ga0500595_012665
632 Ga0500595_060499
633 Ga0500597_003514
634 Ga0500614_027273
635 Ga0500658_0064432
636 Ga0500616_0000501
637 Ga0500616_0006535
638 Ga0500636_0023304
639 Ga0500645_002121
640 Ga0501084_0070456
641 Ga0501082_0077972
642 Ga0466962_0070197
643 Ga0530510_0023814
644 Ga0530510_0109623
645 2509143874
646 8055619867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

309

388

0.97

PF12852

Cupin_6

Cupin

71

271

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9546 274 376
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9431 274 378
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.9294 274 375
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9216 274 374
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8965 274 374
ID Description Score Start End Superfamily
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9915 332 374 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9754 327 376 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9716 328 375 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9565 330 374 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9485 321 374 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A069SXS9-F1-model_v4 deleted 0.983 283 378
AF-A0A525D3U8-F1-model_v4 Helix-turn-helix domain-containing protein 0.9726 274 375 GO:0003700
GO:0043565
AF-A0A0R2K511-F1-model_v4 Putative ada regulatory protein 0.9717 276 376 GO:0003700
GO:0006281
GO:0008168
GO:0008270
GO:0032259
GO:0043565
AF-A0A0Q8F2A2-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.971 275 375 GO:0003700
GO:0043565
AF-A0A172TL64-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9707 276 375 GO:0003700
GO:0006281
GO:0008168
GO:0008270
GO:0032259
GO:0043565

Map