F407083

General Info

Members Datasets Scaffolds Average Seq Length
323 158 646 217

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0055054|Ga0496113_0055054_1650_2297
Length 198
Sequence MTEAVVFDLDGVLLQSEEVWDSVRERYVRERGGRYDEEVQRAMMGMSAPEWARYLHDAAGVPDAPDAINREVVQRMLEAAAEAFPLALASSSNREVFEEVLELAGLADCFRATVSSEEAARGKPAPDVYLEAARRLGVAPESCSAVEDSHAGIRSAKSAGMRVIAIPNAAYPPDEEALELADAVVRSLDELTIDVLRG

Samples

Sample ID Description Type Environment
1 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
66 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
155 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 10.22
Rhizosphere 89.16
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496113_0055054 3300048916 Unclassified 2981
2 Ga0070658_10035124 3300005327 Bacteria 4036
3 Ga0070658_10207874 3300005327 Bacteria 1653
4 Ga0070683_100322789 3300005329 Bacteria 1469
5 Ga0070680_100013950 3300005336 Bacteria 6271
6 Ga0070680_100017526 3300005336 Bacteria 5648
7 Ga0070682_100009316 3300005337 Bacteria 5559
8 Ga0070682_100026952 3300005337 Bacteria 3444
9 Ga0070660_100024580 3300005339 Bacteria 4469
10 Ga0070660_100188190 3300005339 Bacteria 1671
11 Ga0070691_10040702 3300005341 Bacteria 2197
12 Ga0070671_100057278 3300005355 Bacteria 3243
13 Ga0070659_100076035 3300005366 Bacteria 2678
14 Ga0070714_100007455 3300005435 Bacteria 8516
15 Ga0070714_100052153 3300005435 Bacteria 3488
16 Ga0070714_100083706 3300005435 Bacteria 2782
17 Ga0070714_100099163 3300005435 Bacteria 2563
18 Ga0070714_100139333 3300005435 Bacteria 2175
19 Ga0070713_100019797 3300005436 Bacteria 5150
20 Ga0070713_100033294 3300005436 Bacteria 4126
21 Ga0070710_10019450 3300005437 Bacteria 3509
22 Ga0070711_100053364 3300005439 Bacteria 2786
23 Ga0070711_100255514 3300005439 Bacteria 1376
24 Ga0070681_10022923 3300005458 Bacteria 6274
25 Ga0070681_10033960 3300005458 Bacteria 5121
26 Ga0070681_10047797 3300005458 Bacteria 4277
27 Ga0070681_10082262 3300005458 Bacteria 3175
28 Ga0070679_100108089 3300005530 Bacteria 2767
29 Ga0070679_100224756 3300005530 Bacteria 1838
30 Ga0070684_100086607 3300005535 Bacteria 2780
31 Ga0070693_100226401 3300005547 Bacteria 1228
32 Ga0070704_100521110 3300005549 Bacteria 1035
33 Ga0068856_100067304 3300005614 Bacteria 3539
34 Ga0068863_100352723 3300005841 Bacteria 1433
35 Ga0070717_10006751 3300006028 Bacteria 8466
36 Ga0070717_10009595 3300006028 Bacteria 7281
37 Ga0070717_10029074 3300006028 Bacteria 4431
38 Ga0070715_10005318 3300006163 Bacteria 4286
39 Ga0070716_100016366 3300006173 Bacteria 3825
40 Ga0097621_100250377 3300006237 Bacteria 1551
41 Ga0097621_101051795 3300006237 Bacteria 763
42 Ga0075433_10123396 3300006852 Bacteria 2301
43 Ga0075434_100002396 3300006871 Bacteria 16448
44 Ga0075435_100297412 3300007076 Bacteria 1380
45 Ga0105240_10109230 3300009093 Bacteria 3350
46 Ga0105245_10050507 3300009098 Bacteria 3727
47 Ga0105245_10719510 3300009098 Bacteria 1032
48 Ga0105245_11012409 3300009098 Bacteria 875
49 Ga0105247_10078102 3300009101 Bacteria 2081
50 Ga0105248_10107441 3300009177 Bacteria 3147
51 Ga0105237_10122956 3300009545 Bacteria 2589
52 Ga0105237_10463430 3300009545 Bacteria 1273
53 Ga0105238_10071350 3300009551 Bacteria 3471
54 Ga0105238_11369113 3300009551 Bacteria 734
55 Ga0157369_10442407 3300013105 Bacteria 1346
56 Ga0157372_10130779 3300013307 Bacteria 2888
57 Ga0157372_10922499 3300013307 Bacteria 1013
58 Ga0157372_11083818 3300013307 Bacteria 927
59 Ga0157375_10232681 3300013308 Bacteria 2002
60 Ga0157376_10117787 3300014969 Bacteria 2349
61 Ga0157376_10287152 3300014969 Bacteria 1552
62 Ga0206356_10860444 3300020070 Bacteria 3374
63 Ga0206354_10611556 3300020081 Bacteria 3321
64 Ga0207692_10013246 3300025898 Bacteria 3571
65 Ga0207692_10025104 3300025898 Bacteria 2779
66 Ga0207699_10012533 3300025906 Bacteria 4314
67 Ga0207705_10171421 3300025909 Bacteria 1634
68 Ga0207705_10224296 3300025909 Bacteria 1428
69 Ga0207707_10049407 3300025912 Bacteria 3664
70 Ga0207707_10279152 3300025912 Bacteria 1447
71 Ga0207707_10413333 3300025912 Bacteria 1157
72 Ga0207695_10229492 3300025913 Bacteria 1761
73 Ga0207695_10244764 3300025913 Unclassified 1694
74 Ga0207695_10343746 3300025913 Bacteria 1379
75 Ga0207663_10032485 3300025916 Bacteria 3099
76 Ga0207663_10100989 3300025916 Bacteria 1937
77 Ga0207660_10111036 3300025917 Bacteria 2063
78 Ga0207660_10116472 3300025917 Bacteria 2018
79 Ga0207657_10002842 3300025919 Bacteria 18604
80 Ga0207657_10003902 3300025919 Bacteria 15819
81 Ga0207657_10249640 3300025919 Bacteria 1415
82 Ga0207652_10211880 3300025921 Bacteria 1745
83 Ga0207646_10004001 3300025922 Bacteria 16316
84 Ga0207687_10049312 3300025927 Bacteria 2927
85 Ga0207700_10317470 3300025928 Bacteria 1349
86 Ga0207664_10006858 3300025929 Bacteria 7873
87 Ga0207664_10016431 3300025929 Bacteria 5399
88 Ga0207664_10030561 3300025929 Bacteria 4114
89 Ga0207664_10056377 3300025929 Bacteria 3121
90 Ga0207664_10080460 3300025929 Bacteria 2648
91 Ga0207644_10139361 3300025931 Bacteria 1866
92 Ga0207704_10193163 3300025938 Bacteria 1483
93 Ga0207665_10028148 3300025939 Bacteria 3711
94 Ga0207665_10260028 3300025939 Bacteria 1286
95 Ga0207711_10187926 3300025941 Bacteria 1882
96 Ga0207661_10512008 3300025944 Bacteria 1097
97 Ga0207679_10205363 3300025945 Unclassified 1648
98 Ga0207677_10296074 3300026023 Bacteria 1335
99 Ga0207639_10723730 3300026041 Bacteria 924
100 Ga0207702_10074336 3300026078 Bacteria 2933
101 Ga0207702_10217383 3300026078 Bacteria 1780
102 Ga0265334_10047879 3300028573 Bacteria 1648
103 Ga0265338_10002351 3300028800 Bacteria 28551
104 Ga0265338_10008834 3300028800 Bacteria 12156
105 Ga0265338_10009388 3300028800 Bacteria 11676
106 Ga0373943_0006312 3300035170 Bacteria 5320
107 Ga0373946_0103576 3300035171 Bacteria 1279
108 Ga0373955_0207667 3300035172 Bacteria 1167
109 Ga0373931_0024195 3300035691 Bacteria 3074
110 Ga0373935_0048329 3300035692 Bacteria 2694
111 Ga0373935_0200585 3300035692 Bacteria 1378
112 Ga0373947_0117993 3300035725 Bacteria 1683
113 Ga0373925_0119528 3300037068 Bacteria 2044
114 Ga0395905_0335035 3300037471 Bacteria 1404
115 Ga0395901_0136192 3300038443 Bacteria 2581
116 Ga0436360_0378923 3300039438 Bacteria 7707
117 Ga0451853_1197696 3300041512 Bacteria 1140
118 Ga0466969_0146576 3300044656 Bacteria 1089
119 Ga0466965_0032617 3300044683 Bacteria 2543
120 Ga0466965_0046916 3300044683 Bacteria 2139
121 Ga0466966_0020324 3300044684 Bacteria 4368
122 Ga0466961_0005074 3300044693 Bacteria 8284
123 Ga0466961_0008015 3300044693 Bacteria 6734
124 Ga0466961_0068836 3300044693 Bacteria 2247
125 Ga0466961_0285925 3300044693 Bacteria 1009
126 Ga0466963_0000973 3300044694 Bacteria 14724
127 Ga0466963_0006197 3300044694 Bacteria 7064
128 Ga0466963_0020549 3300044694 Bacteria 4151
129 Ga0466963_0031862 3300044694 Bacteria 3409
130 Ga0466963_0144070 3300044694 Bacteria 1652
131 Ga0466963_0225657 3300044694 Bacteria 1312
132 Ga0466963_0258078 3300044694 Bacteria 1223
133 Ga0466963_0260907 3300044694 Bacteria 1216
134 Ga0466963_0270991 3300044694 Bacteria 1192
135 Ga0466963_0652936 3300044694 Bacteria 742
136 Ga0466964_0032115 3300044706 Bacteria 2085
137 Ga0466964_0373099 3300044706 Bacteria 739
138 Ga0466964_0376947 3300044706 Bacteria 735
139 Ga0466971_0001635 3300044719 Bacteria 9455
140 Ga0466971_0010306 3300044719 Bacteria 4082
141 Ga0466971_0037503 3300044719 Bacteria 2172
142 Ga0466971_0063232 3300044719 Bacteria 1675
143 Ga0466971_0070938 3300044719 Bacteria 1582
144 Ga0466968_0004960 3300044735 Bacteria 4987
145 Ga0466968_0060088 3300044735 Bacteria 1638
146 Ga0466968_0077660 3300044735 Unclassified 1454
147 Ga0466957_0001047 3300044842 Bacteria 14263
148 Ga0466957_0005964 3300044842 Bacteria 6871
149 Ga0466957_0165916 3300044842 Bacteria 1436
150 Ga0466957_0193816 3300044842 Bacteria 1332
151 Ga0466957_0231524 3300044842 Bacteria 1223
152 Ga0466960_0003569 3300044901 Bacteria 6001
153 Ga0466960_0039708 3300044901 Bacteria 2221
154 Ga0466960_0100515 3300044901 Bacteria 1489
155 Ga0466960_0114261 3300044901 Bacteria 1407
156 Ga0466959_0038031 3300045049 Bacteria 3556
157 Ga0466959_0140451 3300045049 Bacteria 1707
158 Ga0466959_0162747 3300045049 Bacteria 1568
159 Ga0466959_0219358 3300045049 Bacteria 1319
160 Ga0466959_0227753 3300045049 Bacteria 1291
161 Ga0466958_0001642 3300045836 Bacteria 10774
162 Ga0466958_0108914 3300045836 Bacteria 1728
163 Ga0466958_0135330 3300045836 Bacteria 1549
164 Ga0466967_0000427 3300045976 Bacteria 20041
165 Ga0466967_0000515 3300045976 Bacteria 18885
166 Ga0466967_0005935 3300045976 Bacteria 8567
167 Ga0466967_0015356 3300045976 Bacteria 5999
168 Ga0466967_0035612 3300045976 Bacteria 4240
169 Ga0466967_0048090 3300045976 Bacteria 3723
170 Ga0466967_0060299 3300045976 Bacteria 3361
171 Ga0466967_0093626 3300045976 Bacteria 2734
172 Ga0466967_0095923 3300045976 Bacteria 2704
173 Ga0466967_0099852 3300045976 Bacteria 2651
174 Ga0466967_0105832 3300045976 Bacteria 2577
175 Ga0466967_0122106 3300045976 Bacteria 2408
176 Ga0466967_0169646 3300045976 Bacteria 2052
177 Ga0466967_0288072 3300045976 Bacteria 1577
178 Ga0466967_0380460 3300045976 Bacteria 1370
179 Ga0466967_0404530 3300045976 Bacteria 1329
180 Ga0495592_0000506 3300046454 Bacteria 28374
181 Ga0495603_0325524 3300046455 Bacteria 882
182 Ga0495629_0018937 3300046459 Bacteria 4923
183 Ga0495629_0046523 3300046459 Bacteria 3043
184 Ga0495641_0055112 3300046461 Bacteria 1806
185 Ga0495641_0100943 3300046461 Bacteria 1287
186 Ga0495641_0290595 3300046461 Bacteria 736
187 Ga0495651_0000053 3300046462 Bacteria 85191
188 Ga0495653_0003595 3300046463 Bacteria 12501
189 Ga0495653_0070623 3300046463 Bacteria 2613
190 Ga0495653_0107411 3300046463 Bacteria 2011
191 Ga0495653_0224450 3300046463 Bacteria 1261
192 Ga0495582_0006800 3300046473 Bacteria 6363
193 Ga0495582_0009281 3300046473 Bacteria 5426
194 Ga0495582_0012992 3300046473 Bacteria 4587
195 Ga0495639_0025359 3300046475 Bacteria 2614
196 Ga0495662_0026248 3300046476 Bacteria 2813
197 Ga0495662_0068633 3300046476 Bacteria 1717
198 Ga0495664_0018315 3300046477 Bacteria 4010
199 Ga0495607_0130829 3300046501 Bacteria 1306
200 Ga0495608_0002717 3300046511 Bacteria 12713
201 Ga0495608_0012868 3300046511 Bacteria 5805
202 Ga0495618_0040821 3300046514 Bacteria 2921
203 Ga0495618_0041130 3300046514 Bacteria 2910
204 Ga0495618_0051578 3300046514 Bacteria 2599
205 Ga0495618_0344280 3300046514 Bacteria 920
206 Ga0495628_0000047 3300046516 Bacteria 97852
207 Ga0495628_0215004 3300046516 Bacteria 1445
208 Ga0495628_0443323 3300046516 Bacteria 944
209 Ga0495630_0018267 3300046517 Bacteria 5149
210 Ga0495644_0012847 3300046523 Bacteria 3220
211 Ga0495666_0002780 3300046526 Bacteria 8742
212 Ga0495652_0002275 3300046529 Bacteria 20029
213 Ga0495652_0019756 3300046529 Bacteria 5993
214 Ga0495652_0171546 3300046529 Bacteria 1674
215 Ga0495652_0293748 3300046529 Archaea 1184
216 Ga0495665_0020725 3300046531 Bacteria 3530
217 Ga0495640_0022002 3300046533 Bacteria 4669
218 Ga0495587_0000418 3300046536 Bacteria 29887
219 Ga0495587_0052306 3300046536 Bacteria 2410
220 Ga0495645_0000016 3300046543 Bacteria 158415
221 Ga0495645_0315524 3300046543 Bacteria 1017
222 Ga0495667_0031901 3300046559 Bacteria 3533
223 Ga0495667_0045352 3300046559 Bacteria 2911
224 Ga0495667_0600357 3300046559 Bacteria 686
225 Ga0495656_0029361 3300046615 Bacteria 2213
226 Ga0495634_0064434 3300046642 Bacteria 2429
227 Ga0495634_0149780 3300046642 Bacteria 1476
228 Ga0495635_0052463 3300046663 Bacteria 2809
229 Ga0495635_0149027 3300046663 Bacteria 1592
230 Ga0495635_0252764 3300046663 Bacteria 1188
231 Ga0495661_0069589 3300046665 Bacteria 2062
232 Ga0495657_0021627 3300046675 Bacteria 4614
233 Ga0495599_0000016 3300046678 Bacteria 169605
234 Ga0495599_0179119 3300046678 Bacteria 1307
235 Ga0495623_0000320 3300046679 Bacteria 31219
236 Ga0495623_0034399 3300046679 Bacteria 3250
237 Ga0495646_0002371 3300046680 Bacteria 11549
238 Ga0495647_0054771 3300046681 Bacteria 1559
239 Ga0495658_0066005 3300046683 Bacteria 2089
240 Ga0495658_0069860 3300046683 Bacteria 2036
241 Ga0495658_0426220 3300046683 Bacteria 846
242 Ga0495658_0489936 3300046683 Bacteria 786
243 Ga0495613_0087750 3300046689 Bacteria 2254
244 Ga0495613_0360758 3300046689 Bacteria 996
245 Ga0495624_0033566 3300046690 Bacteria 3323
246 Ga0495624_0035948 3300046690 Bacteria 3195
247 Ga0495624_0160060 3300046690 Bacteria 1376
248 Ga0495670_0118713 3300046691 Bacteria 1373
249 Ga0495600_0045425 3300046809 Bacteria 2866
250 Ga0495600_0233968 3300046809 Bacteria 1172
251 Ga0495604_0000004 3300047317 Bacteria 456385
252 Ga0495604_0129778 3300047317 Bacteria 1813
253 Ga0495674_0007669 3300047319 Bacteria 10308
254 Ga0495674_0076041 3300047319 Bacteria 2888
255 Ga0495676_0065068 3300047321 Bacteria 2832
256 Ga0495676_0149801 3300047321 Bacteria 1662
257 Ga0495676_0248746 3300047321 Bacteria 1214
258 Ga0495680_0002564 3300047322 Bacteria 18528
259 Ga0495680_0038072 3300047322 Bacteria 3847
260 Ga0495680_0200064 3300047322 Bacteria 1433
261 Ga0495680_0287886 3300047322 Bacteria 1156
262 Ga0495675_0003345 3300047444 Bacteria 9654
263 Ga0495677_0053679 3300047445 Bacteria 1486
264 Ga0495684_0056689 3300047471 Bacteria 2986
265 Ga0495684_0067136 3300047471 Bacteria 2727
266 Ga0495684_0299021 3300047471 Bacteria 1156
267 Ga0495684_0424072 3300047471 Bacteria 929
268 Ga0495593_0018855 3300047673 Bacteria 3872
269 Ga0495602_0000036 3300048088 Bacteria 133584
270 Ga0495602_0301173 3300048088 Archaea 1173
271 Ga0495614_0002281 3300048089 Bacteria 8519
272 Ga0496100_0007667 3300048903 Bacteria 5971
273 Ga0496100_0498258 3300048903 Bacteria 938
274 Ga0496101_0036179 3300048904 Bacteria 3496
275 Ga0496101_0169388 3300048904 Bacteria 1678
276 Ga0496101_0389831 3300048904 Bacteria 1096
277 Ga0496103_0063046 3300048906 Bacteria 2308
278 Ga0496104_0017377 3300048907 Bacteria 6549
279 Ga0496104_0061021 3300048907 Bacteria 3573
280 Ga0496104_0109226 3300048907 Bacteria 2651
281 Ga0496105_0015343 3300048908 Bacteria 6103
282 Ga0496105_0032617 3300048908 Bacteria 4275
283 Ga0496105_0202845 3300048908 Bacteria 1618
284 Ga0496106_0020221 3300048909 Bacteria 4939
285 Ga0496106_0113529 3300048909 Bacteria 2112
286 Ga0496106_0236754 3300048909 Bacteria 1458
287 Ga0496107_0006420 3300048910 Bacteria 8085
288 Ga0496107_0114200 3300048910 Bacteria 1987
289 Ga0496108_0008517 3300048911 Bacteria 8317
290 Ga0496108_0199422 3300048911 Bacteria 1736
291 Ga0496109_0013286 3300048912 Bacteria 7133
292 Ga0496109_0028287 3300048912 Bacteria 5011
293 Ga0496109_0414058 3300048912 Bacteria 1273
294 Ga0496110_0038645 3300048913 Bacteria 4154
295 Ga0496110_0273503 3300048913 Bacteria 1538
296 Ga0496111_0022763 3300048914 Bacteria 4391
297 Ga0496111_0037839 3300048914 Bacteria 3454
298 Ga0496112_0291806 3300048915 Bacteria 1577
299 Ga0496113_0078577 3300048916 Bacteria 2525
300 Ga0496114_0098031 3300048917 Bacteria 2498
301 Ga0496115_0040038 3300048918 Bacteria 3724
302 Ga0496115_0042105 3300048918 Bacteria 3637
303 Ga0496115_0055141 3300048918 Bacteria 3192
304 Ga0501069_0003948 3300049585 Bacteria 7648
305 Ga0501069_0280520 3300049585 Bacteria 975
306 nmdc:mga00v17_609888_c1 3300050491 Bacteria 703
307 nmdc:mga0n895_13217_c1 3300050512 Bacteria 7438
308 nmdc:mga0rr50_284490_c1 3300050513 Bacteria 1380
309 Ga0495601_0000287 3300053077 Bacteria 26962
310 Ga0495601_0039813 3300053077 Bacteria 2943
311 Ga0495601_0218401 3300053077 Bacteria 1245
312 Ga0495601_0218568 3300053077 Bacteria 1244
313 Ga0495601_0306370 3300053077 Bacteria 1034
314 Ga0495612_0077306 3300053078 Unclassified 1395
315 Ga0495655_0052678 3300053083 Bacteria 1083
316 Ga0495595_0025882 3300053084 Bacteria 2603
317 Ga0495595_0064445 3300053084 Bacteria 1722
318 Ga0495619_0012837 3300053085 Bacteria 5276
319 Ga0495619_0051390 3300053085 Bacteria 2723
320 Ga0466962_0003814 3300061719 Bacteria 7202
321 Ga0466962_0018018 3300061719 Bacteria 3397
322 Ga0466962_0026488 3300061719 Bacteria 2784
323 Ga0466962_0035422 3300061719 Bacteria 2390
324 Ga0496113_0055054
325 Ga0070658_10035124
326 Ga0070658_10207874
327 Ga0070683_100322789
328 Ga0070680_100013950
329 Ga0070680_100017526
330 Ga0070682_100009316
331 Ga0070682_100026952
332 Ga0070660_100024580
333 Ga0070660_100188190
334 Ga0070691_10040702
335 Ga0070671_100057278
336 Ga0070659_100076035
337 Ga0070714_100007455
338 Ga0070714_100052153
339 Ga0070714_100083706
340 Ga0070714_100099163
341 Ga0070714_100139333
342 Ga0070713_100019797
343 Ga0070713_100033294
344 Ga0070710_10019450
345 Ga0070711_100053364
346 Ga0070711_100255514
347 Ga0070681_10022923
348 Ga0070681_10033960
349 Ga0070681_10047797
350 Ga0070681_10082262
351 Ga0070679_100108089
352 Ga0070679_100224756
353 Ga0070684_100086607
354 Ga0070693_100226401
355 Ga0070704_100521110
356 Ga0068856_100067304
357 Ga0068863_100352723
358 Ga0070717_10006751
359 Ga0070717_10009595
360 Ga0070717_10029074
361 Ga0070715_10005318
362 Ga0070716_100016366
363 Ga0097621_100250377
364 Ga0097621_101051795
365 Ga0075433_10123396
366 Ga0075434_100002396
367 Ga0075435_100297412
368 Ga0105240_10109230
369 Ga0105245_10050507
370 Ga0105245_10719510
371 Ga0105245_11012409
372 Ga0105247_10078102
373 Ga0105248_10107441
374 Ga0105237_10122956
375 Ga0105237_10463430
376 Ga0105238_10071350
377 Ga0105238_11369113
378 Ga0157369_10442407
379 Ga0157372_10130779
380 Ga0157372_10922499
381 Ga0157372_11083818
382 Ga0157375_10232681
383 Ga0157376_10117787
384 Ga0157376_10287152
385 Ga0206356_10860444
386 Ga0206354_10611556
387 Ga0207692_10013246
388 Ga0207692_10025104
389 Ga0207699_10012533
390 Ga0207705_10171421
391 Ga0207705_10224296
392 Ga0207707_10049407
393 Ga0207707_10279152
394 Ga0207707_10413333
395 Ga0207695_10229492
396 Ga0207695_10244764
397 Ga0207695_10343746
398 Ga0207663_10032485
399 Ga0207663_10100989
400 Ga0207660_10111036
401 Ga0207660_10116472
402 Ga0207657_10002842
403 Ga0207657_10003902
404 Ga0207657_10249640
405 Ga0207652_10211880
406 Ga0207646_10004001
407 Ga0207687_10049312
408 Ga0207700_10317470
409 Ga0207664_10006858
410 Ga0207664_10016431
411 Ga0207664_10030561
412 Ga0207664_10056377
413 Ga0207664_10080460
414 Ga0207644_10139361
415 Ga0207704_10193163
416 Ga0207665_10028148
417 Ga0207665_10260028
418 Ga0207711_10187926
419 Ga0207661_10512008
420 Ga0207679_10205363
421 Ga0207677_10296074
422 Ga0207639_10723730
423 Ga0207702_10074336
424 Ga0207702_10217383
425 Ga0265334_10047879
426 Ga0265338_10002351
427 Ga0265338_10008834
428 Ga0265338_10009388
429 Ga0373943_0006312
430 Ga0373946_0103576
431 Ga0373955_0207667
432 Ga0373931_0024195
433 Ga0373935_0048329
434 Ga0373935_0200585
435 Ga0373947_0117993
436 Ga0373925_0119528
437 Ga0395905_0335035
438 Ga0395901_0136192
439 Ga0436360_0378923
440 Ga0451853_1197696
441 Ga0466969_0146576
442 Ga0466965_0032617
443 Ga0466965_0046916
444 Ga0466966_0020324
445 Ga0466961_0005074
446 Ga0466961_0008015
447 Ga0466961_0068836
448 Ga0466961_0285925
449 Ga0466963_0000973
450 Ga0466963_0006197
451 Ga0466963_0020549
452 Ga0466963_0031862
453 Ga0466963_0144070
454 Ga0466963_0225657
455 Ga0466963_0258078
456 Ga0466963_0260907
457 Ga0466963_0270991
458 Ga0466963_0652936
459 Ga0466964_0032115
460 Ga0466964_0373099
461 Ga0466964_0376947
462 Ga0466971_0001635
463 Ga0466971_0010306
464 Ga0466971_0037503
465 Ga0466971_0063232
466 Ga0466971_0070938
467 Ga0466968_0004960
468 Ga0466968_0060088
469 Ga0466968_0077660
470 Ga0466957_0001047
471 Ga0466957_0005964
472 Ga0466957_0165916
473 Ga0466957_0193816
474 Ga0466957_0231524
475 Ga0466960_0003569
476 Ga0466960_0039708
477 Ga0466960_0100515
478 Ga0466960_0114261
479 Ga0466959_0038031
480 Ga0466959_0140451
481 Ga0466959_0162747
482 Ga0466959_0219358
483 Ga0466959_0227753
484 Ga0466958_0001642
485 Ga0466958_0108914
486 Ga0466958_0135330
487 Ga0466967_0000427
488 Ga0466967_0000515
489 Ga0466967_0005935
490 Ga0466967_0015356
491 Ga0466967_0035612
492 Ga0466967_0048090
493 Ga0466967_0060299
494 Ga0466967_0093626
495 Ga0466967_0095923
496 Ga0466967_0099852
497 Ga0466967_0105832
498 Ga0466967_0122106
499 Ga0466967_0169646
500 Ga0466967_0288072
501 Ga0466967_0380460
502 Ga0466967_0404530
503 Ga0495592_0000506
504 Ga0495603_0325524
505 Ga0495629_0018937
506 Ga0495629_0046523
507 Ga0495641_0055112
508 Ga0495641_0100943
509 Ga0495641_0290595
510 Ga0495651_0000053
511 Ga0495653_0003595
512 Ga0495653_0070623
513 Ga0495653_0107411
514 Ga0495653_0224450
515 Ga0495582_0006800
516 Ga0495582_0009281
517 Ga0495582_0012992
518 Ga0495639_0025359
519 Ga0495662_0026248
520 Ga0495662_0068633
521 Ga0495664_0018315
522 Ga0495607_0130829
523 Ga0495608_0002717
524 Ga0495608_0012868
525 Ga0495618_0040821
526 Ga0495618_0041130
527 Ga0495618_0051578
528 Ga0495618_0344280
529 Ga0495628_0000047
530 Ga0495628_0215004
531 Ga0495628_0443323
532 Ga0495630_0018267
533 Ga0495644_0012847
534 Ga0495666_0002780
535 Ga0495652_0002275
536 Ga0495652_0019756
537 Ga0495652_0171546
538 Ga0495652_0293748
539 Ga0495665_0020725
540 Ga0495640_0022002
541 Ga0495587_0000418
542 Ga0495587_0052306
543 Ga0495645_0000016
544 Ga0495645_0315524
545 Ga0495667_0031901
546 Ga0495667_0045352
547 Ga0495667_0600357
548 Ga0495656_0029361
549 Ga0495634_0064434
550 Ga0495634_0149780
551 Ga0495635_0052463
552 Ga0495635_0149027
553 Ga0495635_0252764
554 Ga0495661_0069589
555 Ga0495657_0021627
556 Ga0495599_0000016
557 Ga0495599_0179119
558 Ga0495623_0000320
559 Ga0495623_0034399
560 Ga0495646_0002371
561 Ga0495647_0054771
562 Ga0495658_0066005
563 Ga0495658_0069860
564 Ga0495658_0426220
565 Ga0495658_0489936
566 Ga0495613_0087750
567 Ga0495613_0360758
568 Ga0495624_0033566
569 Ga0495624_0035948
570 Ga0495624_0160060
571 Ga0495670_0118713
572 Ga0495600_0045425
573 Ga0495600_0233968
574 Ga0495604_0000004
575 Ga0495604_0129778
576 Ga0495674_0007669
577 Ga0495674_0076041
578 Ga0495676_0065068
579 Ga0495676_0149801
580 Ga0495676_0248746
581 Ga0495680_0002564
582 Ga0495680_0038072
583 Ga0495680_0200064
584 Ga0495680_0287886
585 Ga0495675_0003345
586 Ga0495677_0053679
587 Ga0495684_0056689
588 Ga0495684_0067136
589 Ga0495684_0299021
590 Ga0495684_0424072
591 Ga0495593_0018855
592 Ga0495602_0000036
593 Ga0495602_0301173
594 Ga0495614_0002281
595 Ga0496100_0007667
596 Ga0496100_0498258
597 Ga0496101_0036179
598 Ga0496101_0169388
599 Ga0496101_0389831
600 Ga0496103_0063046
601 Ga0496104_0017377
602 Ga0496104_0061021
603 Ga0496104_0109226
604 Ga0496105_0015343
605 Ga0496105_0032617
606 Ga0496105_0202845
607 Ga0496106_0020221
608 Ga0496106_0113529
609 Ga0496106_0236754
610 Ga0496107_0006420
611 Ga0496107_0114200
612 Ga0496108_0008517
613 Ga0496108_0199422
614 Ga0496109_0013286
615 Ga0496109_0028287
616 Ga0496109_0414058
617 Ga0496110_0038645
618 Ga0496110_0273503
619 Ga0496111_0022763
620 Ga0496111_0037839
621 Ga0496112_0291806
622 Ga0496113_0078577
623 Ga0496114_0098031
624 Ga0496115_0040038
625 Ga0496115_0042105
626 Ga0496115_0055141
627 Ga0501069_0003948
628 Ga0501069_0280520
629 nmdc:mga00v17_609888_c1
630 nmdc:mga0n895_13217_c1
631 nmdc:mga0rr50_284490_c1
632 Ga0495601_0000287
633 Ga0495601_0039813
634 Ga0495601_0218401
635 Ga0495601_0218568
636 Ga0495601_0306370
637 Ga0495612_0077306
638 Ga0495655_0052678
639 Ga0495595_0025882
640 Ga0495595_0064445
641 Ga0495619_0012837
642 Ga0495619_0051390
643 Ga0466962_0003814
644 Ga0466962_0018018
645 Ga0466962_0026488
646 Ga0466962_0035422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

120

191

0.93

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

5

166

0.91

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

2

160

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1te2-assembly1.cif.gz_A putative phosphatase ynic from escherichia coli k12 0.8701 2 215
7ocr-assembly1.cif.gz_B nadph and fructose-6-phosphate bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.8692 2 207
7ocs-assembly1.cif.gz_D mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii 0.868 2 207
7ocs-assembly2.cif.gz_C mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii 0.8656 2 207
4uas-assembly2.cif.gz_B crystal structure of cbby from rhodobacter sphaeroides in complex with phosphate 0.8649 1 208
ID Description Score Start End Superfamily
af_Q9VQ01_41_108_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9339 18 76 3.40.50.1000
af_Q9VQ02_41_108_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9271 18 76 3.40.50.1000
af_D3ZEH4_27_94_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9263 17 76 3.40.50.1000
1te2B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9257 85 215 3.40.50.1000
3e58A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9129 2 208 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A538C598-F1-model_v4 HAD family hydrolase 0.9906 85 213 GO:0016787
AF-A0A7X6L5U3-F1-model_v4 HAD family phosphatase 0.9846 2 215
AF-W4A2B8-F1-model_v4 deleted 0.984 2 215
AF-A0A428XBU8-F1-model_v4 HAD family hydrolase 0.9826 2 214 GO:0016787
AF-A0A3N2PHD3-F1-model_v4 HAD family hydrolase 0.9823 1 213 GO:0016787

Map