F407036

General Info

Members Datasets Scaffolds Average Seq Length
323 171 646 156

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0009823|Ga0466967_0009823_3546_4100
Length 184
Sequence VRLLHVRFSGVIFGAQARRGLTTNGDTPSMQTFNLFDGATDIPPDGTEPPGYLAHAVRLGPKLGASRLGMSIYDLPPGEAICPYHFEWTDEEWLIVLAGSPTVRTPDEEVVLSPGDVACFPAGPSGAHSVRNASHESVRVAMISTKNEFGIAEYPDSDKVGVWAGEAHYMLRRGAHLDYWDGER

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
65 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
66 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
67 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
68 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
70 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
84 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
85 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
86 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 3.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 4.95
Rhizosphere 94.43
Stem 0
Stem Tuber 0
Unclassified 15.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0009823 3300045976 Bacteria 7138
2 Ga0070658_10012474 3300005327 Bacteria 6817
3 Ga0070658_10409844 3300005327 Unclassified 1165
4 Ga0070683_100073701 3300005329 Bacteria 3188
5 Ga0070680_100260671 3300005336 Bacteria 1466
6 Ga0070680_100798894 3300005336 Unclassified 813
7 Ga0070660_100139871 3300005339 Bacteria 1941
8 Ga0070660_100412501 3300005339 Bacteria 1118
9 Ga0070661_100062724 3300005344 Bacteria 2729
10 Ga0070668_101059063 3300005347 Unclassified 731
11 Ga0070659_100800025 3300005366 Unclassified 820
12 Ga0070709_10041565 3300005434 Bacteria 2834
13 Ga0070709_10453088 3300005434 Bacteria 967
14 Ga0070714_100001987 3300005435 Bacteria 14934
15 Ga0070714_100079644 3300005435 Bacteria 2848
16 Ga0070714_100116247 3300005435 Bacteria 2375
17 Ga0070714_100224048 3300005435 Bacteria 1729
18 Ga0070714_101665260 3300005435 Unclassified 623
19 Ga0070713_100837234 3300005436 Bacteria 883
20 Ga0070711_100752355 3300005439 Bacteria 824
21 Ga0070711_101083384 3300005439 Unclassified 690
22 Ga0070711_101534218 3300005439 Bacteria 582
23 Ga0070681_10078444 3300005458 Bacteria 3259
24 Ga0070681_10123875 3300005458 Bacteria 2517
25 Ga0070681_10138472 3300005458 Bacteria 2364
26 Ga0070681_10314702 3300005458 Bacteria 1475
27 Ga0070699_100268923 3300005518 Unclassified 1525
28 Ga0070679_100043774 3300005530 Bacteria 4458
29 Ga0070679_100243931 3300005530 Bacteria 1754
30 Ga0070684_100066862 3300005535 Bacteria 3156
31 Ga0070684_100278681 3300005535 Bacteria 1532
32 Ga0068855_101144058 3300005563 Bacteria 812
33 Ga0068856_100972725 3300005614 Unclassified 867
34 Ga0068856_101738841 3300005614 Unclassified 636
35 Ga0068852_100453558 3300005616 Unclassified 1270
36 Ga0068852_102100872 3300005616 Unclassified 587
37 Ga0081455_10024962 3300005937 Bacteria 5523
38 Ga0081540_1020136 3300005983 Bacteria 4024
39 Ga0070717_10063729 3300006028 Bacteria 3060
40 Ga0075432_10004414 3300006058 Bacteria 4790
41 Ga0070716_100255753 3300006173 Bacteria 1196
42 Ga0070716_100281437 3300006173 Unclassified 1148
43 Ga0070712_100119367 3300006175 Bacteria 1982
44 Ga0075367_10818651 3300006178 Unclassified 593
45 Ga0075428_100080455 3300006844 Bacteria 3556
46 Ga0075429_100205293 3300006880 Bacteria 1727
47 Ga0075436_100149399 3300006914 Bacteria 1644
48 Ga0075436_100237882 3300006914 Unclassified 1294
49 Ga0105240_10006949 3300009093 Bacteria 16532
50 Ga0105240_10365872 3300009093 Bacteria 1632
51 Ga0111539_10096335 3300009094 Bacteria 3475
52 Ga0111539_10228140 3300009094 Bacteria 2169
53 Ga0111539_10730688 3300009094 Bacteria 1152
54 Ga0105245_10140748 3300009098 Bacteria 2272
55 Ga0105245_11503257 3300009098 Unclassified 724
56 Ga0114129_10254074 3300009147 Bacteria 2358
57 Ga0105249_10152752 3300009553 Bacteria 2224
58 Ga0105239_11656455 3300010375 Bacteria 740
59 Ga0157373_10150970 3300013100 Bacteria 1634
60 Ga0157373_10443539 3300013100 Bacteria 933
61 Ga0157370_10074372 3300013104 Bacteria 3205
62 Ga0157370_10096489 3300013104 Bacteria 2774
63 Ga0157369_10001510 3300013105 Bacteria 28541
64 Ga0157369_10100063 3300013105 Bacteria 3090
65 Ga0157372_10253339 3300013307 Bacteria 2044
66 Ga0157372_10644607 3300013307 Bacteria 1234
67 Ga0157372_10944089 3300013307 Unclassified 1000
68 Ga0182008_10052411 3300014497 Bacteria 2022
69 Ga0182008_10085114 3300014497 Bacteria 1557
70 Ga0182008_10105056 3300014497 Bacteria 1397
71 Ga0197907_10642339 3300020069 Bacteria 1120
72 Ga0197907_10973596 3300020069 Bacteria 2357
73 Ga0206356_10377864 3300020070 Bacteria 849
74 Ga0206356_10468328 3300020070 Bacteria 3936
75 Ga0206356_11911997 3300020070 Bacteria 1678
76 Ga0206354_10436767 3300020081 Bacteria 4046
77 Ga0206354_11504838 3300020081 Bacteria 2326
78 Ga0206353_10473901 3300020082 Bacteria 1330
79 Ga0206353_10539610 3300020082 Bacteria 11664
80 Ga0206353_11841177 3300020082 Unclassified 851
81 Ga0207699_10034682 3300025906 Bacteria 2865
82 Ga0207699_10392579 3300025906 Bacteria 987
83 Ga0207699_10723146 3300025906 Unclassified 729
84 Ga0207705_10106094 3300025909 Bacteria 2071
85 Ga0207705_10197590 3300025909 Bacteria 1523
86 Ga0207705_10327260 3300025909 Bacteria 1178
87 Ga0207707_10095846 3300025912 Bacteria 2593
88 Ga0207707_10161112 3300025912 Bacteria 1961
89 Ga0207707_10622133 3300025912 Unclassified 912
90 Ga0207660_10075489 3300025917 Bacteria 2463
91 Ga0207657_10008303 3300025919 Bacteria 10563
92 Ga0207657_10036990 3300025919 Bacteria 4365
93 Ga0207649_10065679 3300025920 Bacteria 2297
94 Ga0207652_10047636 3300025921 Bacteria 3662
95 Ga0207652_10184133 3300025921 Bacteria 1878
96 Ga0207687_10550697 3300025927 Bacteria 968
97 Ga0207700_10100448 3300025928 Unclassified 2306
98 Ga0207700_10392904 3300025928 Bacteria 1214
99 Ga0207664_10003675 3300025929 Bacteria 10280
100 Ga0207664_10102961 3300025929 Bacteria 2361
101 Ga0207664_10327823 3300025929 Bacteria 1352
102 Ga0207664_10432496 3300025929 Bacteria 1173
103 Ga0207690_10439519 3300025932 Bacteria 1047
104 Ga0207690_11329669 3300025932 Bacteria 601
105 Ga0207665_10368995 3300025939 Bacteria 1087
106 Ga0207661_10935252 3300025944 Unclassified 798
107 Ga0207667_10379082 3300025949 Bacteria 1441
108 Ga0207667_11459997 3300025949 Bacteria 656
109 Ga0207712_10170148 3300025961 Bacteria 1702
110 Ga0207698_11210469 3300026142 Unclassified 769
111 Ga0209998_10027925 3300027717 Bacteria 1239
112 Ga0207428_10003447 3300027907 Bacteria 15358
113 Ga0265342_10119705 3300031712 Bacteria 1484
114 Ga0373926_0139327 3300035083 Bacteria 921
115 Ga0373934_0145297 3300035086 Bacteria 970
116 Ga0373944_0055117 3300035089 Bacteria 1262
117 Ga0373932_0249066 3300035112 Bacteria 648
118 Ga0373936_0040511 3300035113 Bacteria 1866
119 Ga0373941_0462508 3300035115 Unclassified 534
120 Ga0373945_0008789 3300035116 Bacteria 3298
121 Ga0373943_0004283 3300035170 Bacteria 6479
122 Ga0373946_0006669 3300035171 Bacteria 4195
123 Ga0373927_0224192 3300035695 Bacteria 1235
124 Ga0373947_0009946 3300035725 Bacteria 5463
125 Ga0373937_0022571 3300036401 Bacteria 5660
126 Ga0373925_0001456 3300037068 Bacteria 20442
127 Ga0395899_0003189 3300037312 Bacteria 12994
128 Ga0395899_0008110 3300037312 Bacteria 8091
129 Ga0395899_0029452 3300037312 Bacteria 4129
130 Ga0395899_0055726 3300037312 Bacteria 2923
131 Ga0395899_0434021 3300037312 Bacteria 863
132 Ga0395900_0005574 3300037418 Bacteria 13175
133 Ga0395900_0006146 3300037418 Bacteria 12533
134 Ga0395900_0008253 3300037418 Bacteria 10722
135 Ga0395900_0299910 3300037418 Unclassified 1593
136 Ga0395900_0496524 3300037418 Unclassified 1171
137 Ga0395898_0021922 3300037466 Bacteria 6470
138 Ga0395898_0064257 3300037466 Bacteria 3559
139 Ga0395898_0108318 3300037466 Bacteria 2664
140 Ga0395898_0128898 3300037466 Unclassified 2423
141 Ga0395898_0151645 3300037466 Bacteria 2217
142 Ga0395898_0234294 3300037466 Bacteria 1751
143 Ga0395898_0268067 3300037466 Bacteria 1628
144 Ga0395898_0549662 3300037466 Unclassified 1097
145 Ga0395898_0985472 3300037466 Bacteria 779
146 Ga0395905_0004748 3300037471 Bacteria 14041
147 Ga0395905_0010354 3300037471 Bacteria 9078
148 Ga0395905_0028859 3300037471 Bacteria 5229
149 Ga0395905_0031538 3300037471 Bacteria 4989
150 Ga0395905_0044701 3300037471 Bacteria 4155
151 Ga0395905_0054636 3300037471 Bacteria 3737
152 Ga0395901_0017092 3300038443 Bacteria 7395
153 Ga0395901_0022524 3300038443 Bacteria 6457
154 Ga0395901_0120472 3300038443 Bacteria 2757
155 Ga0395901_0579492 3300038443 Bacteria 1134
156 Ga0395901_0933384 3300038443 Unclassified 848
157 Ga0436362_0844244 3300039453 Bacteria 968
158 Ga0439448_0006091 3300042005 Bacteria 3460
159 Ga0439448_0034677 3300042005 Bacteria 1614
160 Ga0439448_0132613 3300042005 Archaea 859
161 Ga0439455_0009092 3300042012 Bacteria 2148
162 Ga0439463_080525 3300042016 Unclassified 837
163 Ga0439458_0022255 3300042157 Unclassified 1471
164 Ga0466965_0106671 3300044683 Bacteria 1437
165 Ga0466966_0405787 3300044684 Bacteria 819
166 Ga0466961_0010222 3300044693 Bacteria 5978
167 Ga0466961_0028369 3300044693 Bacteria 3599
168 Ga0466961_0457122 3300044693 Bacteria 772
169 Ga0466961_0832450 3300044693 Bacteria 550
170 Ga0466963_0003671 3300044694 Bacteria 8831
171 Ga0466963_0008548 3300044694 Bacteria 6144
172 Ga0466963_0010598 3300044694 Bacteria 5587
173 Ga0466963_0017122 3300044694 Bacteria 4514
174 Ga0466963_0017562 3300044694 Bacteria 4462
175 Ga0466963_0088505 3300044694 Unclassified 2106
176 Ga0466963_0132689 3300044694 Bacteria 1721
177 Ga0466963_0174829 3300044694 Bacteria 1498
178 Ga0466963_0235574 3300044694 Bacteria 1283
179 Ga0466963_0250633 3300044694 Unclassified 1242
180 Ga0466963_0261751 3300044694 Bacteria 1214
181 Ga0466963_0401350 3300044694 Viruses 967
182 Ga0466964_0008657 3300044706 Bacteria 3826
183 Ga0466964_0176015 3300044706 Unclassified 1011
184 Ga0466964_0200503 3300044706 Bacteria 958
185 Ga0466964_0397029 3300044706 Unclassified 720
186 Ga0466971_0276793 3300044719 Unclassified 803
187 Ga0466968_0279585 3300044735 Bacteria 798
188 Ga0466970_0019788 3300044765 Bacteria 3493
189 Ga0466957_0019067 3300044842 Bacteria 4034
190 Ga0466957_0047796 3300044842 Bacteria 2600
191 Ga0466957_0240793 3300044842 Unclassified 1200
192 Ga0466957_0454148 3300044842 Bacteria 883
193 Ga0466959_0084174 3300045049 Bacteria 2289
194 Ga0466959_0117532 3300045049 Bacteria 1893
195 Ga0466959_0595247 3300045049 Bacteria 744
196 Ga0466958_0003906 3300045836 Bacteria 7804
197 Ga0466958_0010282 3300045836 Bacteria 5237
198 Ga0466958_0027360 3300045836 Bacteria 3375
199 Ga0466958_0094379 3300045836 Unclassified 1854
200 Ga0466958_0292887 3300045836 Unclassified 1044
201 Ga0466958_0295470 3300045836 Unclassified 1039
202 Ga0466967_0002659 3300045976 Bacteria 11268
203 Ga0466967_0004181 3300045976 Bacteria 9663
204 Ga0466967_0049618 3300045976 Bacteria 3671
205 Ga0466967_0049703 3300045976 Bacteria 3668
206 Ga0466967_0051243 3300045976 Bacteria 3616
207 Ga0466967_0063001 3300045976 Bacteria 3293
208 Ga0466967_0084728 3300045976 Bacteria 2868
209 Ga0466967_0090655 3300045976 Bacteria 2777
210 Ga0466967_0101229 3300045976 Bacteria 2633
211 Ga0466967_0191763 3300045976 Unclassified 1932
212 Ga0466967_0268622 3300045976 Unclassified 1634
213 Ga0466967_0270463 3300045976 Bacteria 1628
214 Ga0466967_0320451 3300045976 Bacteria 1495
215 Ga0466967_0365639 3300045976 Bacteria 1398
216 Ga0466967_0801649 3300045976 Bacteria 935
217 Ga0466967_1170510 3300045976 Bacteria 766
218 Ga0466967_1566590 3300045976 Bacteria 656
219 Ga0495592_0010828 3300046454 Bacteria 6878
220 Ga0495629_0003233 3300046459 Bacteria 12343
221 Ga0495629_0034468 3300046459 Bacteria 3578
222 Ga0495641_0001513 3300046461 Bacteria 19794
223 Ga0495651_0004596 3300046462 Bacteria 10548
224 Ga0495651_0057772 3300046462 Bacteria 2978
225 Ga0495653_0016121 3300046463 Bacteria 6089
226 Ga0495653_0028982 3300046463 Bacteria 4424
227 Ga0495653_0058219 3300046463 Bacteria 2938
228 Ga0495580_0039178 3300046472 Bacteria 3390
229 Ga0495582_0000711 3300046473 Bacteria 18383
230 Ga0495639_0000520 3300046475 Bacteria 18060
231 Ga0495662_0012569 3300046476 Bacteria 4129
232 Ga0495664_0002367 3300046477 Bacteria 10105
233 Ga0495608_0007449 3300046511 Bacteria 7733
234 Ga0495618_0010249 3300046514 Bacteria 5669
235 Ga0495618_0066594 3300046514 Bacteria 2289
236 Ga0495628_0004896 3300046516 Bacteria 11788
237 Ga0495628_0088660 3300046516 Bacteria 2397
238 Ga0495628_0769654 3300046516 Unclassified 675
239 Ga0495666_0000272 3300046526 Bacteria 22361
240 Ga0495652_0007602 3300046529 Bacteria 9985
241 Ga0495652_0053336 3300046529 Bacteria 3446
242 Ga0495665_0001436 3300046531 Bacteria 12777
243 Ga0495586_0006708 3300046535 Bacteria 6148
244 Ga0495587_0018022 3300046536 Bacteria 4377
245 Ga0495645_0000261 3300046543 Bacteria 38834
246 Ga0495645_0006462 3300046543 Bacteria 8133
247 Ga0495645_0066159 3300046543 Bacteria 2613
248 Ga0495667_0493345 3300046559 Bacteria 767
249 Ga0495635_0025990 3300046663 Bacteria 4077
250 Ga0495657_0038008 3300046675 Bacteria 3314
251 Ga0495599_0001850 3300046678 Bacteria 12252
252 Ga0495599_0067222 3300046678 Bacteria 2239
253 Ga0495599_0161986 3300046678 Bacteria 1382
254 Ga0495623_0000578 3300046679 Bacteria 24437
255 Ga0495646_0023408 3300046680 Bacteria 3889
256 Ga0495646_0064735 3300046680 Bacteria 2166
257 Ga0495647_0001653 3300046681 Bacteria 6905
258 Ga0495658_0000675 3300046683 Bacteria 18488
259 Ga0495658_0602474 3300046683 Bacteria 704
260 Ga0495613_0007635 3300046689 Bacteria 8045
261 Ga0495613_0036779 3300046689 Bacteria 3630
262 Ga0495600_0012052 3300046809 Bacteria 5401
263 Ga0495581_0002214 3300047315 Bacteria 10948
264 Ga0495604_0002870 3300047317 Bacteria 13823
265 Ga0495674_0140599 3300047319 Bacteria 2029
266 Ga0495680_0013115 3300047322 Bacteria 7243
267 Ga0495680_0019199 3300047322 Bacteria 5781
268 Ga0495680_0152986 3300047322 Bacteria 1680
269 Ga0495675_0002687 3300047444 Bacteria 10651
270 Ga0495684_0233507 3300047471 Bacteria 1344
271 Ga0495684_0268632 3300047471 Bacteria 1235
272 Ga0495593_0000863 3300047673 Bacteria 17564
273 Ga0495602_0004513 3300048088 Bacteria 14521
274 Ga0495614_0000132 3300048089 Bacteria 26286
275 Ga0496100_0241604 3300048903 Bacteria 1333
276 Ga0496102_0425707 3300048905 Bacteria 1247
277 Ga0496104_0025548 3300048907 Bacteria 5446
278 Ga0496104_0517904 3300048907 Bacteria 1104
279 Ga0496107_0676156 3300048910 Unclassified 760
280 Ga0496108_0084330 3300048911 Unclassified 2696
281 Ga0496109_0001124 3300048912 Bacteria 22257
282 Ga0496109_0517479 3300048912 Bacteria 1126
283 Ga0496110_0003497 3300048913 Bacteria 12053
284 Ga0496111_0013287 3300048914 Bacteria 5598
285 Ga0496112_0008444 3300048915 Bacteria 9226
286 Ga0496112_0056679 3300048915 Bacteria 3857
287 Ga0496113_0052300 3300048916 Bacteria 3050
288 Ga0496113_0833248 3300048916 Bacteria 732
289 Ga0496114_0211414 3300048917 Bacteria 1701
290 Ga0496115_0263093 3300048918 Unclassified 1418
291 Ga0501041_0841324 3300049577 Bacteria 589
292 Ga0501046_1160484 3300049580 Unclassified 532
293 Ga0501047_0151741 3300049581 Bacteria 2193
294 Ga0501067_0505290 3300049583 Unclassified 676
295 Ga0501070_0008037 3300049586 Bacteria 8931
296 Ga0501070_0010337 3300049586 Bacteria 7888
297 Ga0501072_0012778 3300049588 Bacteria 6418
298 Ga0501073_0018848 3300049589 Bacteria 4987
299 Ga0501073_0039659 3300049589 Bacteria 3335
300 Ga0501074_0487676 3300049590 Bacteria 873
301 Ga0501079_0097176 3300049741 Bacteria 2283
302 Ga0501080_0000972 3300049742 Bacteria 23429
303 Ga0501080_0038982 3300049742 Bacteria 4433
304 Ga0501083_0001397 3300049744 Bacteria 16415
305 nmdc:mga05p37_84117_c1 3300050507 Bacteria 3920
306 nmdc:mga09592_108224_c1 3300050508 Bacteria 2384
307 nmdc:mga06r32_64436_c2 3300050510 Unclassified 2347
308 nmdc:mga08y16_221394_c1 3300050511 Unclassified 1959
309 nmdc:mga08x19_104241_c1 3300050514 Bacteria 1885
310 nmdc:mga08x19_222236_c1 3300050514 Bacteria 1298
311 nmdc:mga08x19_493176_c1 3300050514 Bacteria 864
312 nmdc:mga0a205_96230_c1 3300050515 Bacteria 2860
313 Ga0495601_0001177 3300053077 Bacteria 14290
314 Ga0495601_0028142 3300053077 Bacteria 3479
315 Ga0495612_0003031 3300053078 Bacteria 6969
316 Ga0495612_0267169 3300053078 Unclassified 763
317 Ga0495595_0017709 3300053084 Bacteria 3068
318 Ga0495619_0005903 3300053085 Bacteria 7759
319 Ga0495619_0019670 3300053085 Bacteria 4294
320 Ga0500566_0031214 3300053094 Bacteria 3107
321 Ga0466962_0009352 3300061719 Bacteria 4696
322 Ga0466962_0328949 3300061719 Bacteria 759
323 Ga0530510_0717605 3300061734 Bacteria 762
324 Ga0466967_0009823
325 Ga0070658_10012474
326 Ga0070658_10409844
327 Ga0070683_100073701
328 Ga0070680_100260671
329 Ga0070680_100798894
330 Ga0070660_100139871
331 Ga0070660_100412501
332 Ga0070661_100062724
333 Ga0070668_101059063
334 Ga0070659_100800025
335 Ga0070709_10041565
336 Ga0070709_10453088
337 Ga0070714_100001987
338 Ga0070714_100079644
339 Ga0070714_100116247
340 Ga0070714_100224048
341 Ga0070714_101665260
342 Ga0070713_100837234
343 Ga0070711_100752355
344 Ga0070711_101083384
345 Ga0070711_101534218
346 Ga0070681_10078444
347 Ga0070681_10123875
348 Ga0070681_10138472
349 Ga0070681_10314702
350 Ga0070699_100268923
351 Ga0070679_100043774
352 Ga0070679_100243931
353 Ga0070684_100066862
354 Ga0070684_100278681
355 Ga0068855_101144058
356 Ga0068856_100972725
357 Ga0068856_101738841
358 Ga0068852_100453558
359 Ga0068852_102100872
360 Ga0081455_10024962
361 Ga0081540_1020136
362 Ga0070717_10063729
363 Ga0075432_10004414
364 Ga0070716_100255753
365 Ga0070716_100281437
366 Ga0070712_100119367
367 Ga0075367_10818651
368 Ga0075428_100080455
369 Ga0075429_100205293
370 Ga0075436_100149399
371 Ga0075436_100237882
372 Ga0105240_10006949
373 Ga0105240_10365872
374 Ga0111539_10096335
375 Ga0111539_10228140
376 Ga0111539_10730688
377 Ga0105245_10140748
378 Ga0105245_11503257
379 Ga0114129_10254074
380 Ga0105249_10152752
381 Ga0105239_11656455
382 Ga0157373_10150970
383 Ga0157373_10443539
384 Ga0157370_10074372
385 Ga0157370_10096489
386 Ga0157369_10001510
387 Ga0157369_10100063
388 Ga0157372_10253339
389 Ga0157372_10644607
390 Ga0157372_10944089
391 Ga0182008_10052411
392 Ga0182008_10085114
393 Ga0182008_10105056
394 Ga0197907_10642339
395 Ga0197907_10973596
396 Ga0206356_10377864
397 Ga0206356_10468328
398 Ga0206356_11911997
399 Ga0206354_10436767
400 Ga0206354_11504838
401 Ga0206353_10473901
402 Ga0206353_10539610
403 Ga0206353_11841177
404 Ga0207699_10034682
405 Ga0207699_10392579
406 Ga0207699_10723146
407 Ga0207705_10106094
408 Ga0207705_10197590
409 Ga0207705_10327260
410 Ga0207707_10095846
411 Ga0207707_10161112
412 Ga0207707_10622133
413 Ga0207660_10075489
414 Ga0207657_10008303
415 Ga0207657_10036990
416 Ga0207649_10065679
417 Ga0207652_10047636
418 Ga0207652_10184133
419 Ga0207687_10550697
420 Ga0207700_10100448
421 Ga0207700_10392904
422 Ga0207664_10003675
423 Ga0207664_10102961
424 Ga0207664_10327823
425 Ga0207664_10432496
426 Ga0207690_10439519
427 Ga0207690_11329669
428 Ga0207665_10368995
429 Ga0207661_10935252
430 Ga0207667_10379082
431 Ga0207667_11459997
432 Ga0207712_10170148
433 Ga0207698_11210469
434 Ga0209998_10027925
435 Ga0207428_10003447
436 Ga0265342_10119705
437 Ga0373926_0139327
438 Ga0373934_0145297
439 Ga0373944_0055117
440 Ga0373932_0249066
441 Ga0373936_0040511
442 Ga0373941_0462508
443 Ga0373945_0008789
444 Ga0373943_0004283
445 Ga0373946_0006669
446 Ga0373927_0224192
447 Ga0373947_0009946
448 Ga0373937_0022571
449 Ga0373925_0001456
450 Ga0395899_0003189
451 Ga0395899_0008110
452 Ga0395899_0029452
453 Ga0395899_0055726
454 Ga0395899_0434021
455 Ga0395900_0005574
456 Ga0395900_0006146
457 Ga0395900_0008253
458 Ga0395900_0299910
459 Ga0395900_0496524
460 Ga0395898_0021922
461 Ga0395898_0064257
462 Ga0395898_0108318
463 Ga0395898_0128898
464 Ga0395898_0151645
465 Ga0395898_0234294
466 Ga0395898_0268067
467 Ga0395898_0549662
468 Ga0395898_0985472
469 Ga0395905_0004748
470 Ga0395905_0010354
471 Ga0395905_0028859
472 Ga0395905_0031538
473 Ga0395905_0044701
474 Ga0395905_0054636
475 Ga0395901_0017092
476 Ga0395901_0022524
477 Ga0395901_0120472
478 Ga0395901_0579492
479 Ga0395901_0933384
480 Ga0436362_0844244
481 Ga0439448_0006091
482 Ga0439448_0034677
483 Ga0439448_0132613
484 Ga0439455_0009092
485 Ga0439463_080525
486 Ga0439458_0022255
487 Ga0466965_0106671
488 Ga0466966_0405787
489 Ga0466961_0010222
490 Ga0466961_0028369
491 Ga0466961_0457122
492 Ga0466961_0832450
493 Ga0466963_0003671
494 Ga0466963_0008548
495 Ga0466963_0010598
496 Ga0466963_0017122
497 Ga0466963_0017562
498 Ga0466963_0088505
499 Ga0466963_0132689
500 Ga0466963_0174829
501 Ga0466963_0235574
502 Ga0466963_0250633
503 Ga0466963_0261751
504 Ga0466963_0401350
505 Ga0466964_0008657
506 Ga0466964_0176015
507 Ga0466964_0200503
508 Ga0466964_0397029
509 Ga0466971_0276793
510 Ga0466968_0279585
511 Ga0466970_0019788
512 Ga0466957_0019067
513 Ga0466957_0047796
514 Ga0466957_0240793
515 Ga0466957_0454148
516 Ga0466959_0084174
517 Ga0466959_0117532
518 Ga0466959_0595247
519 Ga0466958_0003906
520 Ga0466958_0010282
521 Ga0466958_0027360
522 Ga0466958_0094379
523 Ga0466958_0292887
524 Ga0466958_0295470
525 Ga0466967_0002659
526 Ga0466967_0004181
527 Ga0466967_0049618
528 Ga0466967_0049703
529 Ga0466967_0051243
530 Ga0466967_0063001
531 Ga0466967_0084728
532 Ga0466967_0090655
533 Ga0466967_0101229
534 Ga0466967_0191763
535 Ga0466967_0268622
536 Ga0466967_0270463
537 Ga0466967_0320451
538 Ga0466967_0365639
539 Ga0466967_0801649
540 Ga0466967_1170510
541 Ga0466967_1566590
542 Ga0495592_0010828
543 Ga0495629_0003233
544 Ga0495629_0034468
545 Ga0495641_0001513
546 Ga0495651_0004596
547 Ga0495651_0057772
548 Ga0495653_0016121
549 Ga0495653_0028982
550 Ga0495653_0058219
551 Ga0495580_0039178
552 Ga0495582_0000711
553 Ga0495639_0000520
554 Ga0495662_0012569
555 Ga0495664_0002367
556 Ga0495608_0007449
557 Ga0495618_0010249
558 Ga0495618_0066594
559 Ga0495628_0004896
560 Ga0495628_0088660
561 Ga0495628_0769654
562 Ga0495666_0000272
563 Ga0495652_0007602
564 Ga0495652_0053336
565 Ga0495665_0001436
566 Ga0495586_0006708
567 Ga0495587_0018022
568 Ga0495645_0000261
569 Ga0495645_0006462
570 Ga0495645_0066159
571 Ga0495667_0493345
572 Ga0495635_0025990
573 Ga0495657_0038008
574 Ga0495599_0001850
575 Ga0495599_0067222
576 Ga0495599_0161986
577 Ga0495623_0000578
578 Ga0495646_0023408
579 Ga0495646_0064735
580 Ga0495647_0001653
581 Ga0495658_0000675
582 Ga0495658_0602474
583 Ga0495613_0007635
584 Ga0495613_0036779
585 Ga0495600_0012052
586 Ga0495581_0002214
587 Ga0495604_0002870
588 Ga0495674_0140599
589 Ga0495680_0013115
590 Ga0495680_0019199
591 Ga0495680_0152986
592 Ga0495675_0002687
593 Ga0495684_0233507
594 Ga0495684_0268632
595 Ga0495593_0000863
596 Ga0495602_0004513
597 Ga0495614_0000132
598 Ga0496100_0241604
599 Ga0496102_0425707
600 Ga0496104_0025548
601 Ga0496104_0517904
602 Ga0496107_0676156
603 Ga0496108_0084330
604 Ga0496109_0001124
605 Ga0496109_0517479
606 Ga0496110_0003497
607 Ga0496111_0013287
608 Ga0496112_0008444
609 Ga0496112_0056679
610 Ga0496113_0052300
611 Ga0496113_0833248
612 Ga0496114_0211414
613 Ga0496115_0263093
614 Ga0501041_0841324
615 Ga0501046_1160484
616 Ga0501047_0151741
617 Ga0501067_0505290
618 Ga0501070_0008037
619 Ga0501070_0010337
620 Ga0501072_0012778
621 Ga0501073_0018848
622 Ga0501073_0039659
623 Ga0501074_0487676
624 Ga0501079_0097176
625 Ga0501080_0000972
626 Ga0501080_0038982
627 Ga0501083_0001397
628 nmdc:mga05p37_84117_c1
629 nmdc:mga09592_108224_c1
630 nmdc:mga06r32_64436_c2
631 nmdc:mga08y16_221394_c1
632 nmdc:mga08x19_104241_c1
633 nmdc:mga08x19_222236_c1
634 nmdc:mga08x19_493176_c1
635 nmdc:mga0a205_96230_c1
636 Ga0495601_0001177
637 Ga0495601_0028142
638 Ga0495612_0003031
639 Ga0495612_0267169
640 Ga0495595_0017709
641 Ga0495619_0005903
642 Ga0495619_0019670
643 Ga0500566_0031214
644 Ga0466962_0009352
645 Ga0466962_0328949
646 Ga0530510_0717605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

71

144

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.863 40 118
5wse-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8555 40 116
6b8w-assembly1.cif.gz_B 1.9 angstrom resolution crystal structure of cupin_2 domain (pfam 07883) of xre family transcriptional regulator from enterobacter cloacae. 0.8325 26 120
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.8229 40 119
2vpv-assembly1.cif.gz_B dimerization domain of mif2p 0.8201 40 118
ID Description Score Start End Superfamily
af_Q2G2I7_34_148_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9048 121 144 2.40.50.140
af_P77626_84_178_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8522 40 120 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8433 40 118 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.838 40 118 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8362 40 118 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Y9MVT0-F1-model_v4 Cupin domain-containing protein 0.8661 40 118 GO:0003677
GO:0003700
GO:0005829
AF-A0A7V0SDS3-F1-model_v4 XRE family transcriptional regulator 0.8642 40 117 GO:0003677
GO:0003700
GO:0005829
AF-A0A7C6IK09-F1-model_v4 deleted 0.8633 40 117
AF-A0A415EIY3-F1-model_v4 XRE family transcriptional regulator 0.8575 40 120 GO:0003677
GO:0003700
GO:0005829
AF-A0A1S9BSN1-F1-model_v4 HTH cro/C1-type domain-containing protein 0.8539 40 120 GO:0003677
GO:0003700
GO:0005829

Map