F407013

General Info

Members Datasets Scaffolds Average Seq Length
323 248 322 98

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0482045|Ga0436362_0482045_393_695
Length 100
Sequence MVIVAGHITVEPQQRESDLAGCVRIVEHARRAVGCLDVAICEGPGRPQPCRHLQVLGVAGGAGDLPQPAAQTRNRPAMLTVSVQECDIADVRPVFGKGAE

Samples

Sample ID Description Type Environment
1 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
177 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
180 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
181 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
182 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
183 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
186 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
187 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0.93
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.81
Nodule 0
Rhizoplane 7.74
Rhizosphere 83.59
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10060994 3300003373 Bacteria 948
2 Ga0070658_10638395 3300005327 Bacteria 924
3 Ga0070683_100240001 3300005329 Bacteria 1724
4 Ga0070683_100528429 3300005329 Bacteria 1127
5 Ga0070670_101031111 3300005331 Bacteria 749
6 Ga0068869_100455933 3300005334 Bacteria 1060
7 Ga0068869_100900609 3300005334 Bacteria 765
8 Ga0070666_10260785 3300005335 Bacteria 1229
9 Ga0070680_100525249 3300005336 Bacteria 1013
10 Ga0070682_100040132 3300005337 Bacteria 2879
11 Ga0068868_100318932 3300005338 Bacteria 1323
12 Ga0070660_100486697 3300005339 Bacteria 1025
13 Ga0070689_101216111 3300005340 Bacteria 677
14 Ga0070689_101334469 3300005340 Bacteria 647
15 Ga0070691_10171489 3300005341 Bacteria 1124
16 Ga0070687_100015263 3300005343 Bacteria 3469
17 Ga0070668_100668837 3300005347 Bacteria 914
18 Ga0070669_102021035 3300005353 Bacteria 504
19 Ga0070671_100565030 3300005355 Bacteria 981
20 Ga0070673_101081812 3300005364 Bacteria 749
21 Ga0070659_100026261 3300005366 Bacteria 4479
22 Ga0070667_101048065 3300005367 Bacteria 761
23 Ga0070709_10074332 3300005434 Bacteria 2202
24 Ga0070709_10096966 3300005434 Bacteria 1956
25 Ga0070709_10746280 3300005434 Bacteria 765
26 Ga0070714_101985747 3300005435 Bacteria 567
27 Ga0070713_100103440 3300005436 Bacteria 2471
28 Ga0070713_100297202 3300005436 Bacteria 1486
29 Ga0070713_101493075 3300005436 Unclassified 656
30 Ga0070710_10247104 3300005437 Bacteria 1145
31 Ga0070710_10476443 3300005437 Bacteria 850
32 Ga0070710_11210281 3300005437 Bacteria 559
33 Ga0070711_100432124 3300005439 Unclassified 1075
34 Ga0070705_100084337 3300005440 Bacteria 1960
35 Ga0070708_100239188 3300005445 Unclassified 1705
36 Ga0070708_100267777 3300005445 Bacteria 1607
37 Ga0070678_100188152 3300005456 Bacteria 1695
38 Ga0070662_100098470 3300005457 Bacteria 2209
39 Ga0070662_100240808 3300005457 Bacteria 1451
40 Ga0070681_10255753 3300005458 Bacteria 1663
41 Ga0068867_101837672 3300005459 Bacteria 570
42 Ga0070685_10280408 3300005466 Bacteria 1115
43 Ga0070706_100058361 3300005467 Bacteria 3562
44 Ga0070707_100069815 3300005468 Bacteria 3383
45 Ga0070707_100246499 3300005468 Unclassified 1738
46 Ga0070698_100289781 3300005471 Bacteria 1568
47 Ga0070698_100514242 3300005471 Archaea 1136
48 Ga0070699_100005849 3300005518 Bacteria 10748
49 Ga0070699_101312849 3300005518 Bacteria 664
50 Ga0070679_100244423 3300005530 Bacteria 1751
51 Ga0070684_100264274 3300005535 Bacteria 1574
52 Ga0070684_100556160 3300005535 Bacteria 1065
53 Ga0070697_100238512 3300005536 Bacteria 1552
54 Ga0068853_100185654 3300005539 Bacteria 1887
55 Ga0070696_100280277 3300005546 Bacteria 1270
56 Ga0070693_101672013 3300005547 Bacteria 501
57 Ga0070665_100730139 3300005548 Bacteria 1003
58 Ga0068855_100060467 3300005563 Bacteria 4430
59 Ga0070664_100130583 3300005564 Bacteria 2206
60 Ga0068857_100128925 3300005577 Bacteria 2280
61 Ga0068854_100531730 3300005578 Bacteria 994
62 Ga0068856_100579373 3300005614 Unclassified 1143
63 Ga0068856_101196200 3300005614 Bacteria 776
64 Ga0068856_102703639 3300005614 Bacteria 501
65 Ga0070702_100234717 3300005615 Bacteria 1234
66 Ga0068852_101466421 3300005616 Bacteria 704
67 Ga0068866_10315847 3300005718 Bacteria 981
68 Ga0068861_100049723 3300005719 Bacteria 3175
69 Ga0068861_101106802 3300005719 Bacteria 761
70 Ga0068851_10419937 3300005834 Bacteria 790
71 Ga0068870_10021725 3300005840 Bacteria 3144
72 Ga0068863_100529368 3300005841 Bacteria 1162
73 Ga0068858_100560522 3300005842 Bacteria 1106
74 Ga0068858_101252613 3300005842 Bacteria 729
75 Ga0068860_100079732 3300005843 Bacteria 3113
76 Ga0068862_101239227 3300005844 Bacteria 746
77 Ga0081538_10000729 3300005981 Bacteria 35897
78 Ga0081538_10009443 3300005981 Bacteria 8146
79 Ga0081538_10017559 3300005981 Bacteria 5424
80 Ga0081538_10024267 3300005981 Bacteria 4325
81 Ga0081538_10065145 3300005981 Bacteria 2054
82 Ga0081538_10102478 3300005981 Bacteria 1435
83 Ga0081538_10327109 3300005981 Bacteria 558
84 Ga0070717_10054188 3300006028 Bacteria 3307
85 Ga0070717_11991641 3300006028 Bacteria 523
86 Ga0075365_10206400 3300006038 Bacteria 1377
87 Ga0075365_10357758 3300006038 Bacteria 1029
88 Ga0075363_100046890 3300006048 Bacteria 2293
89 Ga0075363_100234138 3300006048 Bacteria 1055
90 Ga0075364_10007375 3300006051 Bacteria 6528
91 Ga0075364_10162583 3300006051 Bacteria 1507
92 Ga0075364_10984493 3300006051 Bacteria 573
93 Ga0070715_10932533 3300006163 Bacteria 536
94 Ga0070716_100026262 3300006173 Bacteria 3117
95 Ga0075362_10341538 3300006177 Bacteria 748
96 Ga0075367_10449560 3300006178 Bacteria 816
97 Ga0075369_10061703 3300006186 Bacteria 1637
98 Ga0075369_10284193 3300006186 Bacteria 771
99 Ga0097621_100137895 3300006237 Bacteria 2082
100 Ga0075370_10040185 3300006353 Bacteria 2638
101 Ga0075428_100098450 3300006844 Bacteria 3188
102 Ga0075431_100137001 3300006847 Bacteria 2524
103 Ga0075434_101692594 3300006871 Bacteria 640
104 Ga0075429_100322908 3300006880 Bacteria 1351
105 Ga0075435_100609523 3300007076 Bacteria 947
106 Ga0075435_100851132 3300007076 Bacteria 794
107 Ga0099794_10415442 3300007265 Bacteria 703
108 Ga0105245_10193417 3300009098 Bacteria 1950
109 Ga0105245_10450841 3300009098 Bacteria 1295
110 Ga0105247_10236398 3300009101 Bacteria 1243
111 Ga0114129_10047730 3300009147 Bacteria 6015
112 Ga0105248_10000023 3300009177 Bacteria 264241
113 Ga0105248_10274720 3300009177 Bacteria 1897
114 Ga0105237_10269918 3300009545 Bacteria 1704
115 Ga0105238_11850613 3300009551 Bacteria 636
116 Ga0105249_11696819 3300009553 Bacteria 704
117 Ga0105249_13156510 3300009553 Bacteria 530
118 Ga0105246_10337817 3300011119 Bacteria 1230
119 Ga0157344_1013240 3300012476 Bacteria 630
120 Ga0157373_10056457 3300013100 Bacteria 2788
121 Ga0157370_10905739 3300013104 Bacteria 800
122 Ga0157369_12161864 3300013105 Unclassified 564
123 Ga0157374_10474289 3300013296 Bacteria 1254
124 Ga0163162_10495878 3300013306 Bacteria 1352
125 Ga0163162_12013928 3300013306 Bacteria 662
126 Ga0157372_12052057 3300013307 Bacteria 657
127 Ga0157375_10293189 3300013308 Bacteria 1790
128 Ga0163163_10024918 3300014325 Bacteria 5696
129 Ga0157377_10103710 3300014745 Bacteria 1699
130 Ga0157379_10649024 3300014968 Bacteria 988
131 Ga0157376_10737208 3300014969 Unclassified 993
132 Ga0163161_10123622 3300017792 Bacteria 1946
133 Ga0206354_10297545 3300020081 Bacteria 680
134 Ga0206354_10350604 3300020081 Bacteria 832
135 Ga0224712_10221157 3300022467 Bacteria 867
136 Ga0207656_10482820 3300025321 Bacteria 628
137 Ga0207653_10036902 3300025885 Bacteria 1593
138 Ga0207692_10126060 3300025898 Bacteria 1440
139 Ga0207642_10211302 3300025899 Bacteria 1078
140 Ga0207710_10230454 3300025900 Bacteria 922
141 Ga0207688_10012980 3300025901 Bacteria 4531
142 Ga0207680_10176136 3300025903 Bacteria 1443
143 Ga0207647_10216176 3300025904 Bacteria 1106
144 Ga0207685_10369835 3300025905 Bacteria 728
145 Ga0207699_10007253 3300025906 Bacteria 5413
146 Ga0207643_10031234 3300025908 Bacteria 2968
147 Ga0207684_10011206 3300025910 Bacteria 7852
148 Ga0207654_10105609 3300025911 Bacteria 1743
149 Ga0207695_10914930 3300025913 Bacteria 757
150 Ga0207671_10777712 3300025914 Bacteria 760
151 Ga0207693_10010810 3300025915 Bacteria 7410
152 Ga0207663_10040207 3300025916 Bacteria 2840
153 Ga0207660_10761349 3300025917 Bacteria 790
154 Ga0207662_10011250 3300025918 Bacteria 4954
155 Ga0207657_10024377 3300025919 Bacteria 5604
156 Ga0207649_10179047 3300025920 Bacteria 1482
157 Ga0207652_10139976 3300025921 Bacteria 2163
158 Ga0207646_10004250 3300025922 Bacteria 15652
159 Ga0207646_10423878 3300025922 Unclassified 1201
160 Ga0207694_10613668 3300025924 Bacteria 915
161 Ga0207700_10013009 3300025928 Bacteria 5394
162 Ga0207700_10253302 3300025928 Bacteria 1505
163 Ga0207700_11091596 3300025928 Unclassified 713
164 Ga0207664_10008157 3300025929 Bacteria 7290
165 Ga0207664_10041799 3300025929 Bacteria 3573
166 Ga0207664_10096486 3300025929 Bacteria 2434
167 Ga0207664_10871222 3300025929 Bacteria 809
168 Ga0207644_10087835 3300025931 Bacteria 2311
169 Ga0207690_10127398 3300025932 Bacteria 1858
170 Ga0207706_10007240 3300025933 Bacteria 10258
171 Ga0207706_10537411 3300025933 Bacteria 1007
172 Ga0207686_11397288 3300025934 Bacteria 576
173 Ga0207670_10515386 3300025936 Bacteria 973
174 Ga0207670_10553172 3300025936 Bacteria 940
175 Ga0207704_10081260 3300025938 Bacteria 2095
176 Ga0207665_10013915 3300025939 Bacteria 5291
177 Ga0207711_10000150 3300025941 Bacteria 74015
178 Ga0207661_10037370 3300025944 Bacteria 3798
179 Ga0207661_10137578 3300025944 Bacteria 2099
180 Ga0207679_10530209 3300025945 Bacteria 1054
181 Ga0207651_10379917 3300025960 Bacteria 1197
182 Ga0207712_10259298 3300025961 Bacteria 1409
183 Ga0207668_10340351 3300025972 Bacteria 1251
184 Ga0207668_11328726 3300025972 Bacteria 647
185 Ga0207640_10234044 3300025981 Bacteria 1415
186 Ga0207658_11151175 3300025986 Bacteria 709
187 Ga0207677_12215366 3300026023 Bacteria 511
188 Ga0207703_11807702 3300026035 Bacteria 587
189 Ga0207639_10552580 3300026041 Bacteria 1057
190 Ga0207678_10039863 3300026067 Bacteria 4074
191 Ga0207708_10166066 3300026075 Bacteria 1745
192 Ga0207702_10220296 3300026078 Bacteria 1768
193 Ga0207702_10264251 3300026078 Bacteria 1621
194 Ga0207702_10821955 3300026078 Unclassified 919
195 Ga0207702_11649480 3300026078 Bacteria 634
196 Ga0207641_11065057 3300026088 Bacteria 806
197 Ga0207676_10844463 3300026095 Bacteria 895
198 Ga0207674_10013795 3300026116 Bacteria 8939
199 Ga0207675_100087940 3300026118 Bacteria 2919
200 Ga0207683_10010574 3300026121 Bacteria 7873
201 Ga0268265_10096719 3300028380 Bacteria 2374
202 Ga0268264_11335039 3300028381 Bacteria 727
203 Ga0307408_101938461 3300031548 Bacteria 565
204 Ga0307405_10195047 3300031731 Bacteria 1466
205 Ga0307405_10547291 3300031731 Bacteria 936
206 Ga0307410_10465270 3300031852 Bacteria 1034
207 Ga0307406_10048347 3300031901 Bacteria 2686
208 Ga0307412_10496859 3300031911 Bacteria 1015
209 Ga0307409_102207638 3300031995 Bacteria 580
210 Ga0307416_101473335 3300032002 Bacteria 786
211 Ga0307411_10711213 3300032005 Bacteria 876
212 Ga0307415_100073134 3300032126 Bacteria 2417
213 Ga0307415_102295208 3300032126 Bacteria 529
214 Ga0307415_102564702 3300032126 Archaea 503
215 Ga0373929_0115342 3300035085 Bacteria 691
216 Ga0373932_0035984 3300035112 Bacteria 1403
217 Ga0373936_0284987 3300035113 Bacteria 743
218 Ga0373939_0002489 3300035114 Bacteria 4345
219 Ga0373941_0280071 3300035115 Bacteria 660
220 Ga0373956_0460914 3300035119 Unclassified 607
221 Ga0373960_0007304 3300035121 Bacteria 2616
222 Ga0373955_0547812 3300035172 Bacteria 708
223 Ga0373962_0087552 3300035242 Bacteria 955
224 Ga0373931_0089391 3300035691 Bacteria 1713
225 Ga0373925_0006510 3300037068 Bacteria 8587
226 Ga0373925_0922040 3300037068 Bacteria 720
227 Ga0373925_1109086 3300037068 Unclassified 651
228 Ga0395901_0617128 3300038443 Bacteria 1092
229 Ga0436362_0482045 3300039453 Bacteria 895
230 Ga0439461_0001873 3300041410 Bacteria 3311
231 Ga0439466_0029079 3300041411 Bacteria 1903
232 Ga0439465_0026286 3300041413 Bacteria 1840
233 Ga0451793_1446571 3300041452 Bacteria 1342
234 Ga0451833_0179826 3300041491 Unclassified 547
235 Ga0451835_0206950 3300041492 Bacteria 588
236 Ga0451837_1648737 3300041494 Bacteria 512
237 Ga0439431_0000401 3300041997 Bacteria 9161
238 Ga0439445_0004959 3300042004 Bacteria 3023
239 Ga0439451_006703 3300042009 Bacteria 2355
240 Ga0439454_002648 3300042011 Bacteria 1914
241 Ga0439456_049780 3300042013 Bacteria 915
242 Ga0466964_0207518 3300044706 Archaea 944
243 Ga0466967_0174490 3300045976 Bacteria 2024
244 Ga0466967_1099341 3300045976 Bacteria 792
245 Ga0495592_0769834 3300046454 Bacteria 574
246 Ga0495603_0387499 3300046455 Unclassified 801
247 Ga0495629_0052944 3300046459 Bacteria 2840
248 Ga0495641_0088218 3300046461 Unclassified 1387
249 Ga0495662_0189842 3300046476 Unclassified 1013
250 Ga0495608_0300490 3300046511 Unclassified 994
251 Ga0495608_0406747 3300046511 Unclassified 832
252 Ga0495665_0496397 3300046531 Bacteria 615
253 Ga0495640_0047015 3300046533 Bacteria 2987
254 Ga0495586_0305110 3300046535 Unclassified 912
255 Ga0495667_0340159 3300046559 Bacteria 949
256 Ga0495635_0356717 3300046663 Unclassified 975
257 Ga0495657_0185994 3300046675 Bacteria 1272
258 Ga0495658_0034547 3300046683 Bacteria 2775
259 Ga0495624_0006059 3300046690 Bacteria 8623
260 Ga0495581_0040799 3300047315 Bacteria 2685
261 Ga0495674_0056183 3300047319 Bacteria 3449
262 Ga0495676_0247534 3300047321 Bacteria 1217
263 Ga0495680_1016467 3300047322 Unclassified 529
264 Ga0495677_0398872 3300047445 Bacteria 544
265 Ga0495684_0820114 3300047471 Bacteria 606
266 Ga0495593_0002761 3300047673 Bacteria 10561
267 Ga0496100_0130088 3300048903 Bacteria 1772
268 Ga0496101_0209782 3300048904 Bacteria 1509
269 Ga0496102_0055553 3300048905 Bacteria 3610
270 Ga0496102_1113476 3300048905 Unclassified 709
271 Ga0496103_0595361 3300048906 Bacteria 704
272 Ga0496103_0686613 3300048906 Unclassified 649
273 Ga0496104_0033668 3300048907 Bacteria 4775
274 Ga0496105_0454048 3300048908 Bacteria 1011
275 Ga0496105_0827070 3300048908 Bacteria 702
276 Ga0496106_0015226 3300048909 Bacteria 5691
277 Ga0496107_0783214 3300048910 Bacteria 699
278 Ga0496108_0007928 3300048911 Bacteria 8608
279 Ga0496108_0362712 3300048911 Bacteria 1265
280 Ga0496108_0889137 3300048911 Unclassified 765
281 Ga0496109_0002784 3300048912 Bacteria 14654
282 Ga0496109_0467159 3300048912 Bacteria 1191
283 Ga0496109_0568835 3300048912 Bacteria 1069
284 Ga0496109_0593544 3300048912 Bacteria 1043
285 Ga0496110_0034769 3300048913 Bacteria 4368
286 Ga0496110_0072846 3300048913 Bacteria 3048
287 Ga0496112_0315819 3300048915 Unclassified 1507
288 Ga0496112_0401488 3300048915 Bacteria 1310
289 Ga0496113_0444560 3300048916 Bacteria 1041
290 Ga0496115_0586000 3300048918 Bacteria 888
291 Ga0496117_0058304 3300048920 Bacteria 2675
292 Ga0496118_0059121 3300048921 Bacteria 2857
293 Ga0496126_0193448 3300048929 Bacteria 1722
294 Ga0501045_0275033 3300049824 Bacteria 1254
295 nmdc:mga03683_17438_c1 3300050489 Bacteria 2717
296 nmdc:mga03n38_46642_c1 3300050490 Bacteria 1914
297 nmdc:mga00v17_12703_c1 3300050491 Bacteria 4651
298 nmdc:mga00v17_315162_c1 3300050491 Unclassified 1016
299 nmdc:mga0yw44_183717_c1 3300050492 Bacteria 1377
300 nmdc:mga0yw44_780232_c1 3300050492 Bacteria 649
301 nmdc:mga0yw44_846344_c1 3300050492 Bacteria 621
302 nmdc:mga06z11_969184_c1 3300050494 Bacteria 518
303 nmdc:mga07m45_100329_c1 3300050496 Bacteria 1662
304 nmdc:mga09592_270254_c1 3300050508 Bacteria 1474
305 nmdc:mga0qj67_835060_c1 3300050509 Bacteria 728
306 nmdc:mga06r32_178703_c1 3300050510 Bacteria 2107
307 nmdc:mga06r32_456753_c1 3300050510 Bacteria 1257
308 nmdc:mga0n895_1408091_c1 3300050512 Bacteria 665
309 nmdc:mga0n895_1472131_c1 3300050512 Bacteria 648
310 nmdc:mga0n895_516922_c1 3300050512 Bacteria 1202
311 nmdc:mga08x19_1025863_c1 3300050514 Bacteria 586
312 nmdc:mga0a205_214612_c1 3300050515 Bacteria 1811
313 nmdc:mga0sz30_324960_c1 3300050516 Bacteria 687
314 Ga0495601_0212402 3300053077 Bacteria 1264
315 Ga0495595_0107211 3300053084 Bacteria 1352
316 Ga0495619_0020411 3300053085 Bacteria 4219
317 Ga0590071_002978 3300059421 Bacteria 4206
318 Ga0590071_120755 3300059421 Bacteria 669
319 Ga0590071_121696 3300059421 Bacteria 667
320 Ga0590074_042430 3300059423 Bacteria 821
321 Ga0590075_007461 3300059424 Bacteria 2599
322 Ga0590077_005764 3300059426 Bacteria 2537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0482045 Ga0436362_0482045_393_695 87
2 iso_pu_bacteria 2939582691 2939585625 93
3 3300005327 Ga0070658_10638395 Ga0070658_106383952 95
4 3300005329 Ga0070683_100528429 Ga0070683_1005284292 95
5 3300005331 Ga0070670_101031111 Ga0070670_1010311111 95
6 3300005334 Ga0068869_100455933 Ga0068869_1004559331 95
7 3300005334 Ga0068869_100900609 Ga0068869_1009006092 95
8 3300005335 Ga0070666_10260785 Ga0070666_102607852 95
9 3300005336 Ga0070680_100525249 Ga0070680_1005252491 95
10 3300005337 Ga0070682_100040132 Ga0070682_1000401323 95
11 3300005338 Ga0068868_100318932 Ga0068868_1003189322 95
12 3300005339 Ga0070660_100486697 Ga0070660_1004866972 95
13 3300005340 Ga0070689_101216111 Ga0070689_1012161112 95
14 3300005341 Ga0070691_10171489 Ga0070691_101714892 95
15 3300005343 Ga0070687_100015263 Ga0070687_1000152633 95
16 3300005353 Ga0070669_102021035 Ga0070669_1020210351 95
17 3300005355 Ga0070671_100565030 Ga0070671_1005650301 95
18 3300005364 Ga0070673_101081812 Ga0070673_1010818122 95
19 3300005366 Ga0070659_100026261 Ga0070659_1000262613 95
20 3300005367 Ga0070667_101048065 Ga0070667_1010480652 95
21 3300005434 Ga0070709_10074332 Ga0070709_100743323 95
22 3300005434 Ga0070709_10096966 Ga0070709_100969663 95
23 3300005434 Ga0070709_10746280 Ga0070709_107462802 95
24 3300005435 Ga0070714_101985747 Ga0070714_1019857471 95
25 3300005436 Ga0070713_100103440 Ga0070713_1001034402 95
26 3300005436 Ga0070713_100297202 Ga0070713_1002972022 95
27 3300005436 Ga0070713_101493075 Ga0070713_1014930751 95
28 3300005437 Ga0070710_10247104 Ga0070710_102471042 95
29 3300005437 Ga0070710_10476443 Ga0070710_104764432 95
30 3300005437 Ga0070710_11210281 Ga0070710_112102812 95
31 3300005439 Ga0070711_100432124 Ga0070711_1004321242 95
32 3300005440 Ga0070705_100084337 Ga0070705_1000843373 95
33 3300005445 Ga0070708_100239188 Ga0070708_1002391881 95
34 3300005445 Ga0070708_100267777 Ga0070708_1002677772 95
35 3300005456 Ga0070678_100188152 Ga0070678_1001881522 95
36 3300005457 Ga0070662_100098470 Ga0070662_1000984703 95
37 3300005458 Ga0070681_10255753 Ga0070681_102557533 95
38 3300005459 Ga0068867_101837672 Ga0068867_1018376721 95
39 3300005466 Ga0070685_10280408 Ga0070685_102804083 95
40 3300005467 Ga0070706_100058361 Ga0070706_1000583612 95
41 3300005468 Ga0070707_100069815 Ga0070707_1000698153 95
42 3300005468 Ga0070707_100246499 Ga0070707_1002464992 95
43 3300005471 Ga0070698_100289781 Ga0070698_1002897812 95
44 3300005471 Ga0070698_100514242 Ga0070698_1005142422 95
45 3300005518 Ga0070699_100005849 Ga0070699_1000058494 95
46 3300005518 Ga0070699_101312849 Ga0070699_1013128491 95
47 3300005530 Ga0070679_100244423 Ga0070679_1002444232 95
48 3300005535 Ga0070684_100264274 Ga0070684_1002642743 95
49 3300005536 Ga0070697_100238512 Ga0070697_1002385122 95
50 3300005539 Ga0068853_100185654 Ga0068853_1001856541 95
51 3300005546 Ga0070696_100280277 Ga0070696_1002802772 95
52 3300005547 Ga0070693_101672013 Ga0070693_1016720131 95
53 3300005548 Ga0070665_100730139 Ga0070665_1007301392 95
54 3300005563 Ga0068855_100060467 Ga0068855_1000604671 95
55 3300005564 Ga0070664_100130583 Ga0070664_1001305834 95
56 3300005577 Ga0068857_100128925 Ga0068857_1001289253 95
57 3300005578 Ga0068854_100531730 Ga0068854_1005317302 95
58 3300005614 Ga0068856_100579373 Ga0068856_1005793732 95
59 3300005614 Ga0068856_101196200 Ga0068856_1011962002 95
60 3300005614 Ga0068856_102703639 Ga0068856_1027036391 95
61 3300005615 Ga0070702_100234717 Ga0070702_1002347172 95
62 3300005616 Ga0068852_101466421 Ga0068852_1014664212 95
63 3300005718 Ga0068866_10315847 Ga0068866_103158472 95
64 3300005719 Ga0068861_101106802 Ga0068861_1011068022 95
65 3300005834 Ga0068851_10419937 Ga0068851_104199371 95
66 3300005840 Ga0068870_10021725 Ga0068870_100217253 95
67 3300005841 Ga0068863_100529368 Ga0068863_1005293682 95
68 3300005842 Ga0068858_100560522 Ga0068858_1005605223 95
69 3300005842 Ga0068858_101252613 Ga0068858_1012526132 95
70 3300005843 Ga0068860_100079732 Ga0068860_1000797323 95
71 3300005844 Ga0068862_101239227 Ga0068862_1012392272 95
72 3300006028 Ga0070717_10054188 Ga0070717_100541883 95
73 3300006028 Ga0070717_11991641 Ga0070717_119916412 95
74 3300006038 Ga0075365_10206400 Ga0075365_102064003 95
75 3300006048 Ga0075363_100046890 Ga0075363_1000468903 95
76 3300006051 Ga0075364_10007375 Ga0075364_100073757 95
77 3300006051 Ga0075364_10162583 Ga0075364_101625831 95
78 3300006163 Ga0070715_10932533 Ga0070715_109325332 95
79 3300006173 Ga0070716_100026262 Ga0070716_1000262624 95
80 3300006177 Ga0075362_10341538 Ga0075362_103415382 95
81 3300006178 Ga0075367_10449560 Ga0075367_104495602 95
82 3300006186 Ga0075369_10061703 Ga0075369_100617033 95
83 3300006186 Ga0075369_10284193 Ga0075369_102841932 95
84 3300006237 Ga0097621_100137895 Ga0097621_1001378953 95
85 3300006353 Ga0075370_10040185 Ga0075370_100401853 95
86 3300007076 Ga0075435_100851132 Ga0075435_1008511322 95
87 3300007265 Ga0099794_10415442 Ga0099794_104154421 95
88 3300009098 Ga0105245_10193417 Ga0105245_101934173 95
89 3300009098 Ga0105245_10450841 Ga0105245_104508412 95
90 3300009177 Ga0105248_10000023 Ga0105248_10000023141 95
91 3300009177 Ga0105248_10274720 Ga0105248_102747203 95
92 3300009545 Ga0105237_10269918 Ga0105237_102699182 95
93 3300009551 Ga0105238_11850613 Ga0105238_118506131 95
94 3300009553 Ga0105249_11696819 Ga0105249_116968191 95
95 3300009553 Ga0105249_13156510 Ga0105249_131565101 95
96 3300011119 Ga0105246_10337817 Ga0105246_103378172 95
97 3300012476 Ga0157344_1013240 Ga0157344_10132401 95
98 3300013100 Ga0157373_10056457 Ga0157373_100564573 95
99 3300013104 Ga0157370_10905739 Ga0157370_109057392 95
100 3300013105 Ga0157369_12161864 Ga0157369_121618642 95
101 3300013296 Ga0157374_10474289 Ga0157374_104742892 95
102 3300013306 Ga0163162_10495878 Ga0163162_104958782 95
103 3300013307 Ga0157372_12052057 Ga0157372_120520572 95
104 3300013308 Ga0157375_10293189 Ga0157375_102931893 95
105 3300014325 Ga0163163_10024918 Ga0163163_100249186 95
106 3300014745 Ga0157377_10103710 Ga0157377_101037102 95
107 3300014969 Ga0157376_10737208 Ga0157376_107372082 95
108 3300020081 Ga0206354_10350604 Ga0206354_103506041 95
109 3300022467 Ga0224712_10221157 Ga0224712_102211572 95
110 3300025321 Ga0207656_10482820 Ga0207656_104828202 95
111 3300025885 Ga0207653_10036902 Ga0207653_100369023 95
112 3300025898 Ga0207692_10126060 Ga0207692_101260603 95
113 3300025899 Ga0207642_10211302 Ga0207642_102113022 95
114 3300025900 Ga0207710_10230454 Ga0207710_102304541 95
115 3300025901 Ga0207688_10012980 Ga0207688_100129802 95
116 3300025903 Ga0207680_10176136 Ga0207680_101761362 95
117 3300025904 Ga0207647_10216176 Ga0207647_102161762 95
118 3300025905 Ga0207685_10369835 Ga0207685_103698352 95
119 3300025906 Ga0207699_10007253 Ga0207699_100072534 95
120 3300025908 Ga0207643_10031234 Ga0207643_100312343 95
121 3300025910 Ga0207684_10011206 Ga0207684_100112065 95
122 3300025911 Ga0207654_10105609 Ga0207654_101056093 95
123 3300025913 Ga0207695_10914930 Ga0207695_109149302 95
124 3300025914 Ga0207671_10777712 Ga0207671_107777122 95
125 3300025915 Ga0207693_10010810 Ga0207693_100108103 95
126 3300025916 Ga0207663_10040207 Ga0207663_100402074 95
127 3300025917 Ga0207660_10761349 Ga0207660_107613492 95
128 3300025918 Ga0207662_10011250 Ga0207662_100112506 95
129 3300025919 Ga0207657_10024377 Ga0207657_100243779 95
130 3300025920 Ga0207649_10179047 Ga0207649_101790472 95
131 3300025921 Ga0207652_10139976 Ga0207652_101399761 95
132 3300025922 Ga0207646_10004250 Ga0207646_1000425012 95
133 3300025922 Ga0207646_10423878 Ga0207646_104238783 95
134 3300025924 Ga0207694_10613668 Ga0207694_106136682 95
135 3300025928 Ga0207700_10013009 Ga0207700_100130093 95
136 3300025928 Ga0207700_10253302 Ga0207700_102533022 95
137 3300025928 Ga0207700_11091596 Ga0207700_110915961 95
138 3300025929 Ga0207664_10008157 Ga0207664_100081577 95
139 3300025929 Ga0207664_10041799 Ga0207664_100417992 95
140 3300025929 Ga0207664_10096486 Ga0207664_100964863 95
141 3300025929 Ga0207664_10871222 Ga0207664_108712222 95
142 3300025931 Ga0207644_10087835 Ga0207644_100878353 95
143 3300025932 Ga0207690_10127398 Ga0207690_101273983 95
144 3300025933 Ga0207706_10007240 Ga0207706_100072405 95
145 3300025934 Ga0207686_11397288 Ga0207686_113972881 95
146 3300025936 Ga0207670_10553172 Ga0207670_105531722 95
147 3300025938 Ga0207704_10081260 Ga0207704_100812602 95
148 3300025939 Ga0207665_10013915 Ga0207665_100139153 95
149 3300025941 Ga0207711_10000150 Ga0207711_1000015063 95
150 3300025944 Ga0207661_10037370 Ga0207661_100373706 95
151 3300025945 Ga0207679_10530209 Ga0207679_105302092 95
152 3300025960 Ga0207651_10379917 Ga0207651_103799171 95
153 3300025961 Ga0207712_10259298 Ga0207712_102592983 95
154 3300025972 Ga0207668_10340351 Ga0207668_103403512 95
155 3300025981 Ga0207640_10234044 Ga0207640_102340442 95
156 3300025986 Ga0207658_11151175 Ga0207658_111511751 95
157 3300026023 Ga0207677_12215366 Ga0207677_122153662 95
158 3300026035 Ga0207703_11807702 Ga0207703_118077021 95
159 3300026041 Ga0207639_10552580 Ga0207639_105525802 95
160 3300026067 Ga0207678_10039863 Ga0207678_100398633 95
161 3300026075 Ga0207708_10166066 Ga0207708_101660663 95
162 3300026078 Ga0207702_10220296 Ga0207702_102202961 95
163 3300026078 Ga0207702_10264251 Ga0207702_102642513 95
164 3300026078 Ga0207702_10821955 Ga0207702_108219552 95
165 3300026078 Ga0207702_11649480 Ga0207702_116494801 95
166 3300026088 Ga0207641_11065057 Ga0207641_110650571 95
167 3300026095 Ga0207676_10844463 Ga0207676_108444632 95
168 3300026116 Ga0207674_10013795 Ga0207674_100137952 95
169 3300026121 Ga0207683_10010574 Ga0207683_100105743 95
170 3300028380 Ga0268265_10096719 Ga0268265_100967192 95
171 3300028381 Ga0268264_11335039 Ga0268264_113350391 95
172 3300031731 Ga0307405_10195047 Ga0307405_101950472 95
173 3300031901 Ga0307406_10048347 Ga0307406_100483473 95
174 3300031995 Ga0307409_102207638 Ga0307409_1022076381 95
175 3300035085 Ga0373929_0115342 Ga0373929_0115342_218_505 95
176 3300035112 Ga0373932_0035984 Ga0373932_0035984_248_583 95
177 3300035113 Ga0373936_0284987 Ga0373936_0284987_104_424 95
178 3300035114 Ga0373939_0002489 Ga0373939_0002489_3899_4219 95
179 3300035115 Ga0373941_0280071 Ga0373941_0280071_248_583 95
180 3300035119 Ga0373956_0460914 Ga0373956_0460914_167_487 95
181 3300035121 Ga0373960_0007304 Ga0373960_0007304_837_1172 95
182 3300035242 Ga0373962_0087552 Ga0373962_0087552_152_439 95
183 3300035691 Ga0373931_0089391 Ga0373931_0089391_243_578 95
184 3300037068 Ga0373925_0006510 Ga0373925_0006510_6335_6622 95
185 3300037068 Ga0373925_0922040 Ga0373925_0922040_256_591 95
186 3300037068 Ga0373925_1109086 Ga0373925_1109086_104_391 95
187 3300041410 Ga0439461_0001873 Ga0439461_0001873_1933_2220 95
188 3300041411 Ga0439466_0029079 Ga0439466_0029079_1177_1464 95
189 3300041413 Ga0439465_0026286 Ga0439465_0026286_268_555 95
190 3300041452 Ga0451793_1446571 Ga0451793_1446571_437_745 95
191 3300041491 Ga0451833_0179826 Ga0451833_0179826_132_440 95
192 3300041492 Ga0451835_0206950 Ga0451835_0206950_81_368 95
193 3300041494 Ga0451837_1648737 Ga0451837_1648737_94_402 95
194 3300041997 Ga0439431_0000401 Ga0439431_0000401_7932_8219 95
195 3300042004 Ga0439445_0004959 Ga0439445_0004959_1475_1762 95
196 3300044706 Ga0466964_0207518 Ga0466964_0207518_429_716 95
197 3300045976 Ga0466967_0174490 Ga0466967_0174490_692_979 95
198 3300045976 Ga0466967_1099341 Ga0466967_1099341_206_493 95
199 3300046454 Ga0495592_0769834 Ga0495592_0769834_81_368 95
200 3300046455 Ga0495603_0387499 Ga0495603_0387499_63_350 95
201 3300046459 Ga0495629_0052944 Ga0495629_0052944_607_894 95
202 3300046461 Ga0495641_0088218 Ga0495641_0088218_241_528 95
203 3300046476 Ga0495662_0189842 Ga0495662_0189842_143_430 95
204 3300046511 Ga0495608_0300490 Ga0495608_0300490_53_340 95
205 3300046511 Ga0495608_0406747 Ga0495608_0406747_142_462 95
206 3300046533 Ga0495640_0047015 Ga0495640_0047015_145_432 95
207 3300046535 Ga0495586_0305110 Ga0495586_0305110_104_391 95
208 3300046559 Ga0495667_0340159 Ga0495667_0340159_574_861 95
209 3300046663 Ga0495635_0356717 Ga0495635_0356717_142_429 95
210 3300046675 Ga0495657_0185994 Ga0495657_0185994_735_1022 95
211 3300046683 Ga0495658_0034547 Ga0495658_0034547_341_628 95
212 3300046690 Ga0495624_0006059 Ga0495624_0006059_1521_1808 95
213 3300047315 Ga0495581_0040799 Ga0495581_0040799_146_433 95
214 3300047319 Ga0495674_0056183 Ga0495674_0056183_1282_1569 95
215 3300047321 Ga0495676_0247534 Ga0495676_0247534_714_1001 95
216 3300047322 Ga0495680_1016467 Ga0495680_1016467_190_477 95
217 3300047471 Ga0495684_0820114 Ga0495684_0820114_142_462 95
218 3300047673 Ga0495593_0002761 Ga0495593_0002761_8215_8502 95
219 3300048903 Ga0496100_0130088 Ga0496100_0130088_541_876 95
220 3300048904 Ga0496101_0209782 Ga0496101_0209782_986_1273 95
221 3300048905 Ga0496102_0055553 Ga0496102_0055553_2230_2517 95
222 3300048905 Ga0496102_1113476 Ga0496102_1113476_192_479 95
223 3300048906 Ga0496103_0595361 Ga0496103_0595361_391_678 95
224 3300048906 Ga0496103_0686613 Ga0496103_0686613_183_470 95
225 3300048907 Ga0496104_0033668 Ga0496104_0033668_4352_4687 95
226 3300048908 Ga0496105_0827070 Ga0496105_0827070_88_423 95
227 3300048909 Ga0496106_0015226 Ga0496106_0015226_3463_3750 95
228 3300048910 Ga0496107_0783214 Ga0496107_0783214_88_375 95
229 3300048911 Ga0496108_0007928 Ga0496108_0007928_935_1222 95
230 3300048911 Ga0496108_0889137 Ga0496108_0889137_154_441 95
231 3300048912 Ga0496109_0002784 Ga0496109_0002784_9537_9824 95
232 3300048912 Ga0496109_0467159 Ga0496109_0467159_809_1096 95
233 3300048912 Ga0496109_0568835 Ga0496109_0568835_354_641 95
234 3300048912 Ga0496109_0593544 Ga0496109_0593544_53_340 95
235 3300048913 Ga0496110_0034769 Ga0496110_0034769_1762_2049 95
236 3300048913 Ga0496110_0072846 Ga0496110_0072846_2687_3022 95
237 3300048915 Ga0496112_0315819 Ga0496112_0315819_939_1226 95
238 3300048915 Ga0496112_0401488 Ga0496112_0401488_941_1228 95
239 3300048916 Ga0496113_0444560 Ga0496113_0444560_666_953 95
240 3300048918 Ga0496115_0586000 Ga0496115_0586000_274_609 95
241 3300048920 Ga0496117_0058304 Ga0496117_0058304_1485_1772 95
242 3300048921 Ga0496118_0059121 Ga0496118_0059121_1429_1716 95
243 3300048929 Ga0496126_0193448 Ga0496126_0193448_267_587 95
244 3300050489 nmdc:mga03683_17438_c1 nmdc:mga03683_17438_c1_146_433 95
245 3300050490 nmdc:mga03n38_46642_c1 nmdc:mga03n38_46642_c1_1288_1575 95
246 3300050491 nmdc:mga00v17_12703_c1 nmdc:mga00v17_12703_c1_2688_2975 95
247 3300050492 nmdc:mga0yw44_183717_c1 nmdc:mga0yw44_183717_c1_995_1282 95
248 3300050492 nmdc:mga0yw44_780232_c1 nmdc:mga0yw44_780232_c1_157_444 95
249 3300050494 nmdc:mga06z11_969184_c1 nmdc:mga06z11_969184_c1_216_503 95
250 3300050496 nmdc:mga07m45_100329_c1 nmdc:mga07m45_100329_c1_1125_1412 95
251 3300050512 nmdc:mga0n895_1408091_c1 nmdc:mga0n895_1408091_c1_268_588 95
252 3300050512 nmdc:mga0n895_516922_c1 nmdc:mga0n895_516922_c1_180_515 95
253 3300050514 nmdc:mga08x19_1025863_c1 nmdc:mga08x19_1025863_c1_112_447 95
254 3300050515 nmdc:mga0a205_214612_c1 nmdc:mga0a205_214612_c1_599_886 95
255 3300050516 nmdc:mga0sz30_324960_c1 nmdc:mga0sz30_324960_c1_57_344 95
256 3300053077 Ga0495601_0212402 Ga0495601_0212402_669_956 95
257 3300053084 Ga0495595_0107211 Ga0495595_0107211_829_1116 95
258 3300053085 Ga0495619_0020411 Ga0495619_0020411_882_1169 95
259 3300005340 Ga0070689_101334469 Ga0070689_1013344692 96
260 3300006038 Ga0075365_10357758 Ga0075365_103577582 96
261 3300006051 Ga0075364_10984493 Ga0075364_109844932 96
262 3300031548 Ga0307408_101938461 Ga0307408_1019384611 96
263 3300032126 Ga0307415_100073134 Ga0307415_1000731344 96
264 3300035172 Ga0373955_0547812 Ga0373955_0547812_144_434 96
265 3300050492 nmdc:mga0yw44_846344_c1 nmdc:mga0yw44_846344_c1_206_496 96
266 3300003373 JGI25407J50210_10060994 JGI25407J50210_100609942 97
267 3300005329 Ga0070683_100240001 Ga0070683_1002400012 97
268 3300005347 Ga0070668_100668837 Ga0070668_1006688372 97
269 3300005457 Ga0070662_100240808 Ga0070662_1002408082 97
270 3300005535 Ga0070684_100556160 Ga0070684_1005561602 97
271 3300005719 Ga0068861_100049723 Ga0068861_1000497235 97
272 3300005981 Ga0081538_10000729 Ga0081538_1000072939 97
273 3300005981 Ga0081538_10009443 Ga0081538_100094439 97
274 3300005981 Ga0081538_10017559 Ga0081538_100175592 97
275 3300005981 Ga0081538_10024267 Ga0081538_100242673 97
276 3300005981 Ga0081538_10065145 Ga0081538_100651452 97
277 3300005981 Ga0081538_10102478 Ga0081538_101024783 97
278 3300005981 Ga0081538_10327109 Ga0081538_103271091 97
279 3300006048 Ga0075363_100234138 Ga0075363_1002341382 97
280 3300006844 Ga0075428_100098450 Ga0075428_1000984502 97
281 3300006847 Ga0075431_100137001 Ga0075431_1001370011 97
282 3300006871 Ga0075434_101692594 Ga0075434_1016925942 97
283 3300006880 Ga0075429_100322908 Ga0075429_1003229082 97
284 3300007076 Ga0075435_100609523 Ga0075435_1006095232 97
285 3300009101 Ga0105247_10236398 Ga0105247_102363982 97
286 3300009147 Ga0114129_10047730 Ga0114129_100477302 97
287 3300013306 Ga0163162_12013928 Ga0163162_120139282 97
288 3300014968 Ga0157379_10649024 Ga0157379_106490242 97
289 3300017792 Ga0163161_10123622 Ga0163161_101236222 97
290 3300020081 Ga0206354_10297545 Ga0206354_102975452 97
291 3300025933 Ga0207706_10537411 Ga0207706_105374112 97
292 3300025936 Ga0207670_10515386 Ga0207670_105153862 97
293 3300025944 Ga0207661_10137578 Ga0207661_101375782 97
294 3300025972 Ga0207668_11328726 Ga0207668_113287262 97
295 3300026118 Ga0207675_100087940 Ga0207675_1000879403 97
296 3300031731 Ga0307405_10547291 Ga0307405_105472912 97
297 3300031852 Ga0307410_10465270 Ga0307410_104652701 97
298 3300031911 Ga0307412_10496859 Ga0307412_104968592 97
299 3300032002 Ga0307416_101473335 Ga0307416_1014733351 97
300 3300032005 Ga0307411_10711213 Ga0307411_107112132 97
301 3300032126 Ga0307415_102295208 Ga0307415_1022952081 97
302 3300032126 Ga0307415_102564702 Ga0307415_1025647022 97
303 3300038443 Ga0395901_0617128 Ga0395901_0617128_185_487 97
304 3300042009 Ga0439451_006703 Ga0439451_006703_1706_2008 97
305 3300042011 Ga0439454_002648 Ga0439454_002648_1170_1472 97
306 3300042013 Ga0439456_049780 Ga0439456_049780_355_657 97
307 3300046531 Ga0495665_0496397 Ga0495665_0496397_277_579 97
308 3300047445 Ga0495677_0398872 Ga0495677_0398872_124_426 97
309 3300048908 Ga0496105_0454048 Ga0496105_0454048_113_415 97
310 3300048911 Ga0496108_0362712 Ga0496108_0362712_275_577 97
311 3300049824 Ga0501045_0275033 Ga0501045_0275033_123_425 97
312 3300050491 nmdc:mga00v17_315162_c1 nmdc:mga00v17_315162_c1_115_414 97
313 3300050508 nmdc:mga09592_270254_c1 nmdc:mga09592_270254_c1_235_537 97
314 3300050509 nmdc:mga0qj67_835060_c1 nmdc:mga0qj67_835060_c1_381_713 97
315 3300050510 nmdc:mga06r32_178703_c1 nmdc:mga06r32_178703_c1_1598_1954 97
316 3300050510 nmdc:mga06r32_456753_c1 nmdc:mga06r32_456753_c1_191_493 97
317 3300050512 nmdc:mga0n895_1472131_c1 nmdc:mga0n895_1472131_c1_167_469 97
318 3300059421 Ga0590071_002978 Ga0590071_002978_1137_1439 97
319 3300059421 Ga0590071_120755 Ga0590071_120755_153_455 97
320 3300059421 Ga0590071_121696 Ga0590071_121696_115_417 97
321 3300059423 Ga0590074_042430 Ga0590074_042430_355_657 97
322 3300059424 Ga0590075_007461 Ga0590075_007461_1697_1999 97
323 3300059426 Ga0590077_005764 Ga0590077_005764_876_1178 97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bbe-assembly1.cif.gz_A crystal structure of protein so0527 from shewanella oneidensis 0.9031 2 86
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.8825 2 90
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.877 2 86
2fb0-assembly1.cif.gz_A-2 crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase 0.8752 2 88
3mcs-assembly1.cif.gz_A crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution 0.8637 2 85
ID Description Score Start End Superfamily
2bbeA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9031 2 86 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8825 2 90 3.30.70.100
3e8oA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8617 1 95 3.30.70.100
3mcsA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8556 2 85 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8503 1 86 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7K3W584-F1-model_v4 ABM domain-containing protein 0.982 1 92
AF-W5T7X7-F1-model_v4 Antibiotic biosynthesis monooxygenase domain-containing protein 0.9765 1 95 GO:0004497
AF-A0A172UUX9-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9711 4 95 GO:0004497
AF-A0A7X6D315-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9688 1 95 GO:0004497
AF-A0A1Q2D2F2-F1-model_v4 ABM domain-containing protein 0.9686 1 89

Feature Viewer

pLDDT pTM Quality
92.24 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map