F406859

General Info

Members Datasets Scaffolds Average Seq Length
323 201 323 191

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10291411|Ga0075365_102914112
Length 190
Sequence VILSDKSIAEELESGGIVIDPLADNAMQPSSVDLRVDRYFRVFRNDTTPFIDPKQPQEDLTELVEVDEDGERAFILHPGEFVLGSTLERVALADHLVARLEGKSSLGRLGLLIHSTAGFVDAGWDGHLTLELSNVANLPIAIYPGMKIGQISFLKMTTAAEFPYGSGEAGSKYKGQQGPTPSRYYLNFRK

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
197 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.53
Nodule 0
Rhizoplane 6.5
Rhizosphere 80.5
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10037324 3300003373 Bacteria 1248
2 JGI25407J50210_10053654 3300003373 Bacteria 1019
3 Ga0070683_100369772 3300005329 Bacteria 1366
4 Ga0070670_100025637 3300005331 Bacteria 5072
5 Ga0068868_100194511 3300005338 Bacteria 1688
6 Ga0070675_100023311 3300005354 Bacteria 4948
7 Ga0070714_100119474 3300005435 Bacteria 2343
8 Ga0070713_100613853 3300005436 Bacteria 1034
9 Ga0070711_100486120 3300005439 Bacteria 1016
10 Ga0070705_100020139 3300005440 Bacteria 3524
11 Ga0070708_100008658 3300005445 Bacteria 8176
12 Ga0070708_100009597 3300005445 Bacteria 7801
13 Ga0070708_100014317 3300005445 Bacteria 6522
14 Ga0070681_10030645 3300005458 Bacteria 5398
15 Ga0070681_10059708 3300005458 Bacteria 3793
16 Ga0070681_10122541 3300005458 Bacteria 2533
17 Ga0070706_100687631 3300005467 Bacteria 949
18 Ga0070706_100693195 3300005467 Bacteria 945
19 Ga0070698_100039788 3300005471 Bacteria 4836
20 Ga0070699_100912119 3300005518 Bacteria 805
21 Ga0070679_100278724 3300005530 Bacteria 1625
22 Ga0070679_100334376 3300005530 Bacteria 1463
23 Ga0070679_101017453 3300005530 Bacteria 773
24 Ga0070697_100009211 3300005536 Bacteria 7714
25 Ga0068853_100559489 3300005539 Bacteria 1084
26 Ga0070686_100045537 3300005544 Bacteria 2764
27 Ga0070696_100022734 3300005546 Bacteria 4262
28 Ga0070696_100071603 3300005546 Bacteria 2440
29 Ga0070665_100432766 3300005548 Bacteria 1325
30 Ga0070704_100207441 3300005549 Bacteria 1586
31 Ga0070704_100723177 3300005549 Bacteria 885
32 Ga0070704_100813439 3300005549 Bacteria 836
33 Ga0068859_100086379 3300005617 Bacteria 3184
34 Ga0068860_100763974 3300005843 Bacteria 979
35 Ga0068862_101265394 3300005844 Bacteria 738
36 Ga0081455_10008138 3300005937 Bacteria 10939
37 Ga0081455_10008727 3300005937 Bacteria 10499
38 Ga0081538_10000060 3300005981 Bacteria 101190
39 Ga0081538_10000175 3300005981 Bacteria 69198
40 Ga0081538_10007118 3300005981 Bacteria 9718
41 Ga0081538_10007380 3300005981 Bacteria 9520
42 Ga0081538_10014186 3300005981 Bacteria 6259
43 Ga0081538_10151282 3300005981 Bacteria 1050
44 Ga0081539_10066930 3300005985 Bacteria 1945
45 Ga0075365_10000105 3300006038 Bacteria 24752
46 Ga0075365_10007663 3300006038 Bacteria 6069
47 Ga0075365_10285994 3300006038 Bacteria 1160
48 Ga0075365_10291411 3300006038 Bacteria 1148
49 Ga0075368_10065144 3300006042 Bacteria 1464
50 Ga0075363_100003758 3300006048 Bacteria 6537
51 Ga0075364_10030142 3300006051 Bacteria 3481
52 Ga0075364_10034359 3300006051 Bacteria 3270
53 Ga0075364_10079840 3300006051 Bacteria 2162
54 Ga0075364_10094740 3300006051 Bacteria 1984
55 Ga0075364_10115024 3300006051 Bacteria 1798
56 Ga0075364_10562487 3300006051 Bacteria 779
57 Ga0075362_10123927 3300006177 Bacteria 1225
58 Ga0075367_10062117 3300006178 Bacteria 2230
59 Ga0075367_10110916 3300006178 Bacteria 1684
60 Ga0075370_10349820 3300006353 Bacteria 883
61 Ga0075428_100000001 3300006844 Bacteria 772630
62 Ga0075428_100102449 3300006844 Bacteria 3121
63 Ga0075430_100061038 3300006846 Bacteria 3169
64 Ga0075430_100102504 3300006846 Bacteria 2389
65 Ga0075430_100185808 3300006846 Bacteria 1728
66 Ga0075431_100082200 3300006847 Bacteria 3325
67 Ga0075433_10185483 3300006852 Bacteria 1851
68 Ga0075434_100021445 3300006871 Bacteria 6278
69 Ga0075434_100254521 3300006871 Bacteria 1775
70 Ga0075429_100502309 3300006880 Bacteria 1063
71 Ga0097620_100086380 3300006931 Bacteria 3184
72 Ga0075435_100283670 3300007076 Bacteria 1414
73 Ga0111539_10005245 3300009094 Bacteria 16790
74 Ga0111539_10066276 3300009094 Bacteria 4265
75 Ga0111539_10266744 3300009094 Bacteria 1993
76 Ga0105245_10276485 3300009098 Bacteria 1640
77 Ga0114129_10099315 3300009147 Bacteria 4029
78 Ga0114129_10144274 3300009147 Bacteria 3262
79 Ga0114129_10324587 3300009147 Bacteria 2046
80 Ga0114129_10664096 3300009147 Bacteria 1344
81 Ga0114129_11357803 3300009147 Bacteria 879
82 Ga0105243_10144111 3300009148 Bacteria 2036
83 Ga0105248_10107769 3300009177 Bacteria 3142
84 Ga0105248_10536919 3300009177 Bacteria 1319
85 Ga0105249_10216920 3300009553 Bacteria 1881
86 Ga0157374_10078527 3300013296 Bacteria 3126
87 Ga0157374_10476593 3300013296 Bacteria 1251
88 Ga0157378_11117985 3300013297 Bacteria 825
89 Ga0163162_10989576 3300013306 Bacteria 951
90 Ga0157372_10422584 3300013307 Bacteria 1553
91 Ga0157372_10467505 3300013307 Bacteria 1470
92 Ga0157372_10534983 3300013307 Bacteria 1366
93 Ga0157375_10383810 3300013308 Bacteria 1571
94 Ga0163163_10908245 3300014325 Bacteria 944
95 Ga0157380_10386573 3300014326 Bacteria 1323
96 Ga0157377_10043635 3300014745 Bacteria 2496
97 Ga0163161_10786437 3300017792 Bacteria 799
98 Ga0206353_10146691 3300020082 Bacteria 9259
99 Ga0213873_10007986 3300021358 Bacteria 2143
100 Ga0213876_10059591 3300021384 Bacteria 2015
101 Ga0213876_10310167 3300021384 Bacteria 839
102 Ga0207688_10010574 3300025901 Bacteria 5017
103 Ga0207684_10066572 3300025910 Bacteria 3060
104 Ga0207707_10003601 3300025912 Bacteria 13738
105 Ga0207707_10146130 3300025912 Bacteria 2067
106 Ga0207707_10326520 3300025912 Bacteria 1324
107 Ga0207707_10334906 3300025912 Bacteria 1305
108 Ga0207707_10416644 3300025912 Bacteria 1152
109 Ga0207707_10428225 3300025912 Bacteria 1134
110 Ga0207660_10025795 3300025917 Bacteria 3994
111 Ga0207662_10151772 3300025918 Bacteria 1474
112 Ga0207657_10001668 3300025919 Bacteria 23957
113 Ga0207652_10251237 3300025921 Bacteria 1595
114 Ga0207652_10359697 3300025921 Bacteria 1314
115 Ga0207681_10171535 3300025923 Bacteria 1645
116 Ga0207659_10437385 3300025926 Bacteria 1100
117 Ga0207700_10741645 3300025928 Bacteria 877
118 Ga0207670_10922689 3300025936 Bacteria 732
119 Ga0207669_10410369 3300025937 Bacteria 1063
120 Ga0207691_11125352 3300025940 Bacteria 653
121 Ga0207689_10040246 3300025942 Bacteria 3869
122 Ga0207689_10591450 3300025942 Bacteria 933
123 Ga0207661_10261950 3300025944 Bacteria 1540
124 Ga0207661_11329093 3300025944 Bacteria 660
125 Ga0207679_10772088 3300025945 Bacteria 875
126 Ga0207708_10166854 3300026075 Bacteria 1741
127 Ga0207648_10372979 3300026089 Bacteria 1289
128 Ga0207674_10044839 3300026116 Bacteria 4554
129 Ga0207675_100232872 3300026118 Bacteria 1777
130 Ga0207428_10126593 3300027907 Bacteria 1956
131 Ga0207428_10216338 3300027907 Bacteria 1438
132 Ga0268265_10987431 3300028380 Bacteria 831
133 Ga0265338_10001843 3300028800 Bacteria 33286
134 Ga0265325_10007296 3300031241 Bacteria 6638
135 Ga0265339_10061467 3300031249 Bacteria 2021
136 Ga0265331_10098130 3300031250 Bacteria 1350
137 Ga0265327_10001291 3300031251 Bacteria 32872
138 Ga0265327_10030488 3300031251 Bacteria 3048
139 Ga0265327_10099406 3300031251 Bacteria 1406
140 Ga0265316_10293690 3300031344 Bacteria 1185
141 Ga0307408_100304677 3300031548 Bacteria 1336
142 Ga0265313_10000928 3300031595 Bacteria 29181
143 Ga0316578_10045442 3300031728 Bacteria 2557
144 Ga0307405_10021588 3300031731 Bacteria 3622
145 Ga0307413_10016513 3300031824 Bacteria 3816
146 Ga0307410_10395583 3300031852 Bacteria 1115
147 Ga0307410_10456361 3300031852 Bacteria 1043
148 Ga0307406_10552652 3300031901 Bacteria 942
149 Ga0307409_100005794 3300031995 Bacteria 7166
150 Ga0307416_100079554 3300032002 Bacteria 2763
151 Ga0307416_100111065 3300032002 Bacteria 2416
152 Ga0307416_102026658 3300032002 Bacteria 678
153 Ga0307411_11086566 3300032005 Bacteria 720
154 Ga0373943_0448155 3300035170 Bacteria 750
155 Ga0316574_0063005 3300035398 Bacteria 2331
156 Ga0373935_0172832 3300035692 Bacteria 1479
157 Ga0373935_0979634 3300035692 Bacteria 628
158 Ga0373933_0093607 3300035724 Bacteria 1857
159 Ga0373947_0242612 3300035725 Bacteria 1189
160 Ga0373937_0145163 3300036401 Bacteria 2221
161 Ga0373937_0836575 3300036401 Bacteria 869
162 Ga0316584_0022649 3300036712 Bacteria 4584
163 Ga0395899_0019310 3300037312 Bacteria 5179
164 Ga0395900_0074454 3300037418 Bacteria 3491
165 Ga0395898_0002611 3300037466 Bacteria 21002
166 Ga0395898_0009614 3300037466 Bacteria 10151
167 Ga0395905_0031865 3300037471 Bacteria 4960
168 Ga0436364_0372543 3300037853 Bacteria 903
169 Ga0395901_0092915 3300038443 Bacteria 3158
170 Ga0395901_0188943 3300038443 Bacteria 2160
171 Ga0395901_0326129 3300038443 Bacteria 1588
172 Ga0400483_021155 3300039062 Bacteria 1721
173 Ga0400483_274246 3300039062 Bacteria 1379
174 Ga0436365_0916183 3300039437 Bacteria 1985
175 Ga0436365_1179735 3300039437 Bacteria 13674
176 Ga0436365_1789850 3300039437 Bacteria 4116
177 Ga0436362_1028025 3300039453 Bacteria 7382
178 Ga0466961_0128575 3300044693 Bacteria 1588
179 Ga0466964_0059562 3300044706 Bacteria 1586
180 Ga0466958_0596288 3300045836 Bacteria 718
181 Ga0495641_0123050 3300046461 Bacteria 1157
182 Ga0495641_0284191 3300046461 Bacteria 745
183 Ga0495651_0028996 3300046462 Bacteria 4316
184 Ga0495651_0386308 3300046462 Bacteria 917
185 Ga0495653_0006125 3300046463 Bacteria 9861
186 Ga0495653_0133215 3300046463 Bacteria 1756
187 Ga0495653_0136074 3300046463 Bacteria 1733
188 Ga0495608_0031898 3300046511 Bacteria 3561
189 Ga0495618_0024062 3300046514 Bacteria 3770
190 Ga0495628_0006383 3300046516 Bacteria 10303
191 Ga0495628_0287870 3300046516 Bacteria 1218
192 Ga0495630_0049342 3300046517 Bacteria 3151
193 Ga0495630_0095787 3300046517 Bacteria 2244
194 Ga0495630_0220334 3300046517 Bacteria 1448
195 Ga0495630_0300572 3300046517 Bacteria 1226
196 Ga0495630_0570961 3300046517 Bacteria 867
197 Ga0495630_0602865 3300046517 Bacteria 842
198 Ga0495666_0205365 3300046526 Bacteria 905
199 Ga0495652_0175208 3300046529 Bacteria 1652
200 Ga0495652_0310447 3300046529 Bacteria 1143
201 Ga0495652_0359462 3300046529 Unclassified 1041
202 Ga0495640_0027162 3300046533 Bacteria 4131
203 Ga0495640_0174131 3300046533 Bacteria 1374
204 Ga0495667_0034489 3300046559 Bacteria 3384
205 Ga0495656_0399414 3300046615 Bacteria 719
206 Ga0495657_0019122 3300046675 Bacteria 4946
207 Ga0495657_0219591 3300046675 Bacteria 1153
208 Ga0495657_0358377 3300046675 Bacteria 862
209 Ga0495599_0120650 3300046678 Bacteria 1630
210 Ga0495658_0192612 3300046683 Bacteria 1268
211 Ga0495658_0294203 3300046683 Bacteria 1026
212 Ga0495613_0020602 3300046689 Bacteria 4916
213 Ga0495624_0245261 3300046690 Bacteria 1084
214 Ga0495600_0369225 3300046809 Bacteria 896
215 Ga0495604_0096593 3300047317 Bacteria 2180
216 Ga0495674_0214316 3300047319 Bacteria 1594
217 Ga0495674_0576949 3300047319 Bacteria 893
218 Ga0495674_0921891 3300047319 Bacteria 673
219 Ga0495680_0111249 3300047322 Bacteria 2029
220 Ga0495675_0079929 3300047444 Bacteria 2059
221 Ga0495684_0211681 3300047471 Bacteria 1425
222 Ga0495684_0505587 3300047471 Bacteria 830
223 Ga0495686_0004470 3300047472 Bacteria 11507
224 Ga0495593_0080187 3300047673 Bacteria 1689
225 Ga0495602_0288308 3300048088 Bacteria 1206
226 Ga0496100_0237027 3300048903 Bacteria 1345
227 Ga0496101_0120744 3300048904 Bacteria 1981
228 Ga0496101_0255602 3300048904 Bacteria 1366
229 Ga0496102_0140304 3300048905 Bacteria 2266
230 Ga0496104_0206287 3300048907 Bacteria 1877
231 Ga0496104_0314018 3300048907 Bacteria 1480
232 Ga0496104_1176803 3300048907 Bacteria 670
233 Ga0496105_0016766 3300048908 Bacteria 5856
234 Ga0496107_0801228 3300048910 Bacteria 690
235 Ga0496108_0639227 3300048911 Bacteria 925
236 Ga0496108_0706260 3300048911 Bacteria 874
237 Ga0496109_0147058 3300048912 Bacteria 2205
238 Ga0496109_0230286 3300048912 Bacteria 1743
239 Ga0496112_0276046 3300048915 Bacteria 1628
240 Ga0496112_1099532 3300048915 Bacteria 713
241 Ga0496113_0103011 3300048916 Bacteria 2214
242 Ga0496113_0325693 3300048916 Bacteria 1232
243 Ga0496114_0041324 3300048917 Bacteria 3821
244 Ga0496114_0229782 3300048917 Bacteria 1630
245 Ga0496115_0313258 3300048918 Bacteria 1285
246 Ga0496115_0369363 3300048918 Bacteria 1168
247 Ga0501299_081501 3300049522 Bacteria 720
248 Ga0501036_0018561 3300049572 Bacteria 5830
249 Ga0501036_0023042 3300049572 Bacteria 5241
250 Ga0501037_0059483 3300049573 Bacteria 2787
251 Ga0501038_0041695 3300049574 Bacteria 4002
252 Ga0501038_0461325 3300049574 Bacteria 976
253 Ga0501039_0416822 3300049575 Bacteria 1055
254 Ga0501040_0263968 3300049576 Bacteria 1229
255 Ga0501040_0322853 3300049576 Bacteria 1104
256 Ga0501042_0045787 3300049578 Bacteria 3118
257 Ga0501042_0387076 3300049578 Bacteria 1013
258 Ga0501042_0449714 3300049578 Bacteria 934
259 Ga0501043_0509494 3300049579 Bacteria 898
260 Ga0501046_0013835 3300049580 Bacteria 6817
261 Ga0501046_0397540 3300049580 Bacteria 996
262 Ga0501047_0373108 3300049581 Bacteria 1262
263 Ga0501048_0084185 3300049582 Bacteria 2242
264 Ga0501067_0000620 3300049583 Bacteria 19121
265 Ga0501068_0009331 3300049584 Bacteria 5484
266 Ga0501068_0053235 3300049584 Bacteria 2449
267 Ga0501069_0000484 3300049585 Bacteria 18217
268 Ga0501070_0196829 3300049586 Bacteria 1655
269 Ga0501072_0013527 3300049588 Bacteria 6245
270 Ga0501072_0113116 3300049588 Bacteria 2161
271 Ga0501073_0010983 3300049589 Bacteria 6624
272 Ga0501075_0062672 3300049591 Bacteria 2802
273 Ga0501076_0066195 3300049592 Bacteria 2883
274 Ga0501076_0086719 3300049592 Bacteria 2516
275 Ga0501076_0342602 3300049592 Bacteria 1227
276 Ga0501077_0069083 3300049593 Bacteria 2239
277 Ga0501077_0129658 3300049593 Bacteria 1599
278 Ga0501077_0295801 3300049593 Bacteria 1031
279 Ga0501249_113426 3300049679 Bacteria 657
280 Ga0501079_0028138 3300049741 Bacteria 4312
281 Ga0501079_0054948 3300049741 Bacteria 3072
282 Ga0501080_0019783 3300049742 Bacteria 6234
283 Ga0501080_0097361 3300049742 Bacteria 2732
284 Ga0501081_0037275 3300049743 Bacteria 3317
285 Ga0501083_0092951 3300049744 Bacteria 1991
286 Ga0501045_0204206 3300049824 Bacteria 1472
287 nmdc:mga03683_237139_c1 3300050489 Bacteria 845
288 nmdc:mga03n38_3905_c1 3300050490 Bacteria 4856
289 nmdc:mga03n38_407946_c1 3300050490 Bacteria 749
290 nmdc:mga00v17_164874_c1 3300050491 Bacteria 1428
291 nmdc:mga00v17_22906_c1 3300050491 Bacteria 3610
292 nmdc:mga00v17_4921_c1 3300050491 Bacteria 7002
293 nmdc:mga00v17_49790_c1 3300050491 Bacteria 2543
294 nmdc:mga00v17_99473_c1 3300050491 Bacteria 1834
295 nmdc:mga0yw44_118148_c1 3300050492 Bacteria 1706
296 nmdc:mga0yw44_175586_c1 3300050492 Bacteria 1408
297 nmdc:mga0yw44_231_c1 3300050492 Bacteria 19110
298 nmdc:mga0yw44_248319_c1 3300050492 Bacteria 1184
299 nmdc:mga0yw44_304094_c1 3300050492 Bacteria 1069
300 nmdc:mga0yw44_94093_c1 3300050492 Bacteria 1899
301 nmdc:mga06z11_200526_c1 3300050494 Bacteria 1159
302 nmdc:mga05p37_854613_c1 3300050507 Bacteria 988
303 nmdc:mga05p37_93105_c1 3300050507 Bacteria 3713
304 nmdc:mga09592_652799_c1 3300050508 Bacteria 898
305 nmdc:mga0qj67_566228_c1 3300050509 Bacteria 911
306 nmdc:mga0qj67_62305_c1 3300050509 Bacteria 2964
307 nmdc:mga06r32_130779_c1 3300050510 Bacteria 905
308 nmdc:mga06r32_40822_c1 3300050510 Bacteria 4407
309 nmdc:mga0n895_32474_c2 3300050512 Bacteria 2692
310 nmdc:mga0a205_244787_c1 3300050515 Bacteria 1674
311 Ga0495601_0145403 3300053077 Bacteria 1547
312 Ga0495595_0089768 3300053084 Bacteria 1473
313 Ga0495619_0033254 3300053085 Bacteria 3349
314 Ga0495619_0110488 3300053085 Bacteria 1878
315 Ga0500566_0000323 3300053094 Bacteria 25925
316 Ga0500614_068919 3300053123 Bacteria 967
317 Ga0500616_0001077 3300053153 Bacteria 28519
318 Ga0501084_0000009 3300054114 Bacteria 194961
319 Ga0501084_0045530 3300054114 Bacteria 3673
320 Ga0501084_0090255 3300054114 Bacteria 2572
321 Ga0501084_1174665 3300054114 Bacteria 644
322 Ga0501082_0105310 3300060353 Bacteria 2440
323 Ga0530510_0028169 3300061734 Bacteria 4028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100119474 Ga0070714_1001194743 177
2 3300005937 Ga0081455_10008138 Ga0081455_1000813810 187
3 3300006844 Ga0075428_100000001 Ga0075428_100000001570 187
4 3300031852 Ga0307410_10395583 Ga0307410_103955832 187
5 3300039062 Ga0400483_021155 Ga0400483_021155_875_1444 187
6 3300039062 Ga0400483_274246 Ga0400483_274246_337_906 187
7 3300005544 Ga0070686_100045537 Ga0070686_1000455373 188
8 3300005844 Ga0068862_101265394 Ga0068862_1012653942 188
9 3300006038 Ga0075365_10285994 Ga0075365_102859942 188
10 3300006038 Ga0075365_10291411 Ga0075365_102914112 188
11 3300006042 Ga0075368_10065144 Ga0075368_100651443 188
12 3300006051 Ga0075364_10079840 Ga0075364_100798402 188
13 3300006051 Ga0075364_10094740 Ga0075364_100947402 188
14 3300006051 Ga0075364_10562487 Ga0075364_105624871 188
15 3300006178 Ga0075367_10062117 Ga0075367_100621172 188
16 3300006178 Ga0075367_10110916 Ga0075367_101109163 188
17 3300006353 Ga0075370_10349820 Ga0075370_103498201 188
18 3300006846 Ga0075430_100061038 Ga0075430_1000610383 188
19 3300009094 Ga0111539_10266744 Ga0111539_102667443 188
20 3300009147 Ga0114129_10324587 Ga0114129_103245873 188
21 3300009177 Ga0105248_10107769 Ga0105248_101077692 188
22 3300013297 Ga0157378_11117985 Ga0157378_111179852 188
23 3300013306 Ga0163162_10989576 Ga0163162_109895762 188
24 3300013307 Ga0157372_10534983 Ga0157372_105349832 188
25 3300017792 Ga0163161_10786437 Ga0163161_107864372 188
26 3300020082 Ga0206353_10146691 Ga0206353_101466914 188
27 3300025912 Ga0207707_10416644 Ga0207707_104166441 188
28 3300025912 Ga0207707_10428225 Ga0207707_104282252 188
29 3300025917 Ga0207660_10025795 Ga0207660_100257954 188
30 3300025918 Ga0207662_10151772 Ga0207662_101517722 188
31 3300025919 Ga0207657_10001668 Ga0207657_1000166823 188
32 3300025937 Ga0207669_10410369 Ga0207669_104103691 188
33 3300025940 Ga0207691_11125352 Ga0207691_111253521 188
34 3300026075 Ga0207708_10166854 Ga0207708_101668542 188
35 3300026116 Ga0207674_10044839 Ga0207674_100448396 188
36 3300026118 Ga0207675_100232872 Ga0207675_1002328722 188
37 3300027907 Ga0207428_10216338 Ga0207428_102163383 188
38 3300028380 Ga0268265_10987431 Ga0268265_109874312 188
39 3300031251 Ga0265327_10001291 Ga0265327_1000129123 188
40 3300046461 Ga0495641_0123050 Ga0495641_0123050_122_688 188
41 3300046517 Ga0495630_0095787 Ga0495630_0095787_1357_1923 188
42 3300047472 Ga0495686_0004470 Ga0495686_0004470_2574_3140 188
43 3300048918 Ga0496115_0369363 Ga0496115_0369363_174_740 188
44 3300049522 Ga0501299_081501 Ga0501299_081501_29_595 188
45 3300049572 Ga0501036_0018561 Ga0501036_0018561_21_587 188
46 3300049572 Ga0501036_0023042 Ga0501036_0023042_1020_1586 188
47 3300049573 Ga0501037_0059483 Ga0501037_0059483_1795_2361 188
48 3300049574 Ga0501038_0041695 Ga0501038_0041695_1905_2471 188
49 3300049578 Ga0501042_0045787 Ga0501042_0045787_2159_2725 188
50 3300049580 Ga0501046_0013835 Ga0501046_0013835_1404_1970 188
51 3300049581 Ga0501047_0373108 Ga0501047_0373108_597_1163 188
52 3300049582 Ga0501048_0084185 Ga0501048_0084185_255_821 188
53 3300049583 Ga0501067_0000620 Ga0501067_0000620_3138_3704 188
54 3300049584 Ga0501068_0053235 Ga0501068_0053235_612_1178 188
55 3300049585 Ga0501069_0000484 Ga0501069_0000484_4392_4958 188
56 3300049586 Ga0501070_0196829 Ga0501070_0196829_186_752 188
57 3300049591 Ga0501075_0062672 Ga0501075_0062672_77_643 188
58 3300049592 Ga0501076_0066195 Ga0501076_0066195_169_735 188
59 3300049593 Ga0501077_0295801 Ga0501077_0295801_413_979 188
60 3300050490 nmdc:mga03n38_3905_c1 nmdc:mga03n38_3905_c1_3031_3603 188
61 3300050491 nmdc:mga00v17_164874_c1 nmdc:mga00v17_164874_c1_434_1006 188
62 3300050491 nmdc:mga00v17_22906_c1 nmdc:mga00v17_22906_c1_517_1089 188
63 3300050491 nmdc:mga00v17_99473_c1 nmdc:mga00v17_99473_c1_699_1265 188
64 3300050492 nmdc:mga0yw44_118148_c1 nmdc:mga0yw44_118148_c1_674_1246 188
65 3300050492 nmdc:mga0yw44_175586_c1 nmdc:mga0yw44_175586_c1_761_1333 188
66 3300050492 nmdc:mga0yw44_248319_c1 nmdc:mga0yw44_248319_c1_565_1137 188
67 3300050492 nmdc:mga0yw44_304094_c1 nmdc:mga0yw44_304094_c1_34_606 188
68 3300050492 nmdc:mga0yw44_94093_c1 nmdc:mga0yw44_94093_c1_1223_1789 188
69 3300050494 nmdc:mga06z11_200526_c1 nmdc:mga06z11_200526_c1_306_878 188
70 3300050509 nmdc:mga0qj67_566228_c1 nmdc:mga0qj67_566228_c1_33_599 188
71 3300050509 nmdc:mga0qj67_62305_c1 nmdc:mga0qj67_62305_c1_810_1376 188
72 3300053094 Ga0500566_0000323 Ga0500566_0000323_21661_22227 188
73 3300054114 Ga0501084_0045530 Ga0501084_0045530_827_1393 188
74 3300061734 Ga0530510_0028169 Ga0530510_0028169_2849_3415 188
75 3300005354 Ga0070675_100023311 Ga0070675_1000233114 189
76 3300005439 Ga0070711_100486120 Ga0070711_1004861202 189
77 3300005445 Ga0070708_100008658 Ga0070708_1000086584 189
78 3300005549 Ga0070704_100207441 Ga0070704_1002074413 189
79 3300005617 Ga0068859_100086379 Ga0068859_1000863791 189
80 3300005937 Ga0081455_10008727 Ga0081455_1000872710 189
81 3300005981 Ga0081538_10000060 Ga0081538_1000006020 189
82 3300005981 Ga0081538_10000175 Ga0081538_1000017557 189
83 3300006931 Ga0097620_100086380 Ga0097620_1000863801 189
84 3300009094 Ga0111539_10066276 Ga0111539_100662762 189
85 3300009147 Ga0114129_10144274 Ga0114129_101442744 189
86 3300009553 Ga0105249_10216920 Ga0105249_102169202 189
87 3300013307 Ga0157372_10467505 Ga0157372_104675052 189
88 3300013308 Ga0157375_10383810 Ga0157375_103838103 189
89 3300014325 Ga0163163_10908245 Ga0163163_109082451 189
90 3300014745 Ga0157377_10043635 Ga0157377_100436351 189
91 3300025901 Ga0207688_10010574 Ga0207688_100105744 189
92 3300025912 Ga0207707_10334906 Ga0207707_103349062 189
93 3300027907 Ga0207428_10126593 Ga0207428_101265932 189
94 3300028800 Ga0265338_10001843 Ga0265338_1000184326 189
95 3300031241 Ga0265325_10007296 Ga0265325_100072963 189
96 3300031249 Ga0265339_10061467 Ga0265339_100614672 189
97 3300031250 Ga0265331_10098130 Ga0265331_100981302 189
98 3300031344 Ga0265316_10293690 Ga0265316_102936902 189
99 3300031548 Ga0307408_100304677 Ga0307408_1003046773 189
100 3300031595 Ga0265313_10000928 Ga0265313_100009282 189
101 3300031728 Ga0316578_10045442 Ga0316578_100454422 189
102 3300031731 Ga0307405_10021588 Ga0307405_100215882 189
103 3300031824 Ga0307413_10016513 Ga0307413_100165132 189
104 3300031852 Ga0307410_10456361 Ga0307410_104563612 189
105 3300031901 Ga0307406_10552652 Ga0307406_105526522 189
106 3300031995 Ga0307409_100005794 Ga0307409_1000057947 189
107 3300032002 Ga0307416_102026658 Ga0307416_1020266581 189
108 3300032005 Ga0307411_11086566 Ga0307411_110865662 189
109 3300035170 Ga0373943_0448155 Ga0373943_0448155_19_588 189
110 3300035692 Ga0373935_0979634 Ga0373935_0979634_38_607 189
111 3300035724 Ga0373933_0093607 Ga0373933_0093607_101_670 189
112 3300036401 Ga0373937_0145163 Ga0373937_0145163_677_1246 189
113 3300037418 Ga0395900_0074454 Ga0395900_0074454_2625_3194 189
114 3300037466 Ga0395898_0009614 Ga0395898_0009614_7028_7597 189
115 3300037853 Ga0436364_0372543 Ga0436364_0372543_76_645 189
116 3300039437 Ga0436365_1179735 Ga0436365_1179735_7561_8136 189
117 3300046461 Ga0495641_0284191 Ga0495641_0284191_76_645 189
118 3300046462 Ga0495651_0028996 Ga0495651_0028996_2267_2836 189
119 3300046463 Ga0495653_0133215 Ga0495653_0133215_670_1239 189
120 3300046511 Ga0495608_0031898 Ga0495608_0031898_522_1091 189
121 3300046517 Ga0495630_0049342 Ga0495630_0049342_738_1307 189
122 3300046529 Ga0495652_0175208 Ga0495652_0175208_900_1469 189
123 3300046529 Ga0495652_0359462 Ga0495652_0359462_70_639 189
124 3300046559 Ga0495667_0034489 Ga0495667_0034489_1260_1829 189
125 3300046675 Ga0495657_0019122 Ga0495657_0019122_2272_2841 189
126 3300046690 Ga0495624_0245261 Ga0495624_0245261_130_699 189
127 3300046809 Ga0495600_0369225 Ga0495600_0369225_229_798 189
128 3300047317 Ga0495604_0096593 Ga0495604_0096593_564_1133 189
129 3300047319 Ga0495674_0921891 Ga0495674_0921891_66_635 189
130 3300047322 Ga0495680_0111249 Ga0495680_0111249_359_928 189
131 3300047444 Ga0495675_0079929 Ga0495675_0079929_895_1464 189
132 3300047471 Ga0495684_0211681 Ga0495684_0211681_240_809 189
133 3300047471 Ga0495684_0505587 Ga0495684_0505587_80_649 189
134 3300047673 Ga0495593_0080187 Ga0495593_0080187_756_1325 189
135 3300048088 Ga0495602_0288308 Ga0495602_0288308_405_974 189
136 3300048905 Ga0496102_0140304 Ga0496102_0140304_922_1491 189
137 3300048915 Ga0496112_1099532 Ga0496112_1099532_59_628 189
138 3300048917 Ga0496114_0041324 Ga0496114_0041324_2412_2981 189
139 3300048918 Ga0496115_0313258 Ga0496115_0313258_308_877 189
140 3300049679 Ga0501249_113426 Ga0501249_113426_17_586 189
141 3300050510 nmdc:mga06r32_130779_c1 nmdc:mga06r32_130779_c1_219_788 189
142 3300053084 Ga0495595_0089768 Ga0495595_0089768_181_750 189
143 3300053085 Ga0495619_0033254 Ga0495619_0033254_873_1442 189
144 3300053153 Ga0500616_0001077 Ga0500616_0001077_903_1475 189
145 3300005329 Ga0070683_100369772 Ga0070683_1003697722 190
146 3300005331 Ga0070670_100025637 Ga0070670_1000256375 190
147 3300005338 Ga0068868_100194511 Ga0068868_1001945112 190
148 3300005436 Ga0070713_100613853 Ga0070713_1006138531 190
149 3300005440 Ga0070705_100020139 Ga0070705_1000201394 190
150 3300005445 Ga0070708_100009597 Ga0070708_1000095974 190
151 3300005445 Ga0070708_100014317 Ga0070708_1000143172 190
152 3300005458 Ga0070681_10030645 Ga0070681_100306458 190
153 3300005458 Ga0070681_10059708 Ga0070681_100597082 190
154 3300005458 Ga0070681_10122541 Ga0070681_101225414 190
155 3300005467 Ga0070706_100687631 Ga0070706_1006876312 190
156 3300005467 Ga0070706_100693195 Ga0070706_1006931951 190
157 3300005471 Ga0070698_100039788 Ga0070698_1000397884 190
158 3300005518 Ga0070699_100912119 Ga0070699_1009121192 190
159 3300005530 Ga0070679_100278724 Ga0070679_1002787242 190
160 3300005530 Ga0070679_100334376 Ga0070679_1003343762 190
161 3300005530 Ga0070679_101017453 Ga0070679_1010174531 190
162 3300005536 Ga0070697_100009211 Ga0070697_1000092115 190
163 3300005539 Ga0068853_100559489 Ga0068853_1005594892 190
164 3300005546 Ga0070696_100022734 Ga0070696_1000227343 190
165 3300005546 Ga0070696_100071603 Ga0070696_1000716032 190
166 3300005548 Ga0070665_100432766 Ga0070665_1004327662 190
167 3300005549 Ga0070704_100723177 Ga0070704_1007231772 190
168 3300005549 Ga0070704_100813439 Ga0070704_1008134391 190
169 3300005843 Ga0068860_100763974 Ga0068860_1007639742 190
170 3300005981 Ga0081538_10007118 Ga0081538_1000711810 190
171 3300005981 Ga0081538_10014186 Ga0081538_100141864 190
172 3300005981 Ga0081538_10151282 Ga0081538_101512822 190
173 3300005985 Ga0081539_10066930 Ga0081539_100669303 190
174 3300006038 Ga0075365_10000105 Ga0075365_1000010524 190
175 3300006038 Ga0075365_10007663 Ga0075365_100076639 190
176 3300006048 Ga0075363_100003758 Ga0075363_1000037582 190
177 3300006051 Ga0075364_10030142 Ga0075364_100301423 190
178 3300006051 Ga0075364_10115024 Ga0075364_101150243 190
179 3300006177 Ga0075362_10123927 Ga0075362_101239272 190
180 3300006844 Ga0075428_100102449 Ga0075428_1001024493 190
181 3300006846 Ga0075430_100102504 Ga0075430_1001025042 190
182 3300006846 Ga0075430_100185808 Ga0075430_1001858082 190
183 3300006847 Ga0075431_100082200 Ga0075431_1000822003 190
184 3300006852 Ga0075433_10185483 Ga0075433_101854832 190
185 3300006871 Ga0075434_100021445 Ga0075434_1000214454 190
186 3300006871 Ga0075434_100254521 Ga0075434_1002545213 190
187 3300006880 Ga0075429_100502309 Ga0075429_1005023092 190
188 3300007076 Ga0075435_100283670 Ga0075435_1002836702 190
189 3300009094 Ga0111539_10005245 Ga0111539_1000524513 190
190 3300009147 Ga0114129_10099315 Ga0114129_100993156 190
191 3300009147 Ga0114129_10664096 Ga0114129_106640962 190
192 3300009147 Ga0114129_11357803 Ga0114129_113578032 190
193 3300009177 Ga0105248_10536919 Ga0105248_105369192 190
194 3300013296 Ga0157374_10078527 Ga0157374_100785273 190
195 3300013296 Ga0157374_10476593 Ga0157374_104765932 190
196 3300013307 Ga0157372_10422584 Ga0157372_104225842 190
197 3300021358 Ga0213873_10007986 Ga0213873_100079864 190
198 3300021384 Ga0213876_10059591 Ga0213876_100595912 190
199 3300021384 Ga0213876_10310167 Ga0213876_103101671 190
200 3300025910 Ga0207684_10066572 Ga0207684_100665722 190
201 3300025912 Ga0207707_10003601 Ga0207707_100036018 190
202 3300025912 Ga0207707_10146130 Ga0207707_101461304 190
203 3300025912 Ga0207707_10326520 Ga0207707_103265201 190
204 3300025921 Ga0207652_10251237 Ga0207652_102512371 190
205 3300025921 Ga0207652_10359697 Ga0207652_103596972 190
206 3300025923 Ga0207681_10171535 Ga0207681_101715352 190
207 3300025926 Ga0207659_10437385 Ga0207659_104373853 190
208 3300025928 Ga0207700_10741645 Ga0207700_107416451 190
209 3300025942 Ga0207689_10040246 Ga0207689_100402463 190
210 3300025942 Ga0207689_10591450 Ga0207689_105914501 190
211 3300025944 Ga0207661_10261950 Ga0207661_102619502 190
212 3300025944 Ga0207661_11329093 Ga0207661_113290931 190
213 3300025945 Ga0207679_10772088 Ga0207679_107720882 190
214 3300026089 Ga0207648_10372979 Ga0207648_103729791 190
215 3300031251 Ga0265327_10099406 Ga0265327_100994062 190
216 3300032002 Ga0307416_100079554 Ga0307416_1000795543 190
217 3300032002 Ga0307416_100111065 Ga0307416_1001110652 190
218 3300035398 Ga0316574_0063005 Ga0316574_0063005_597_1187 190
219 3300035692 Ga0373935_0172832 Ga0373935_0172832_846_1418 190
220 3300035725 Ga0373947_0242612 Ga0373947_0242612_98_670 190
221 3300037312 Ga0395899_0019310 Ga0395899_0019310_3617_4189 190
222 3300037466 Ga0395898_0002611 Ga0395898_0002611_8262_8834 190
223 3300037471 Ga0395905_0031865 Ga0395905_0031865_1252_1824 190
224 3300038443 Ga0395901_0092915 Ga0395901_0092915_103_675 190
225 3300038443 Ga0395901_0188943 Ga0395901_0188943_571_1143 190
226 3300039437 Ga0436365_0916183 Ga0436365_0916183_1360_1935 190
227 3300039437 Ga0436365_1789850 Ga0436365_1789850_3375_3950 190
228 3300039453 Ga0436362_1028025 Ga0436362_1028025_1739_2314 190
229 3300044693 Ga0466961_0128575 Ga0466961_0128575_715_1296 190
230 3300044706 Ga0466964_0059562 Ga0466964_0059562_773_1351 190
231 3300045836 Ga0466958_0596288 Ga0466958_0596288_92_673 190
232 3300046463 Ga0495653_0136074 Ga0495653_0136074_771_1355 190
233 3300046517 Ga0495630_0570961 Ga0495630_0570961_131_706 190
234 3300046517 Ga0495630_0602865 Ga0495630_0602865_157_729 190
235 3300046526 Ga0495666_0205365 Ga0495666_0205365_289_861 190
236 3300046529 Ga0495652_0310447 Ga0495652_0310447_224_796 190
237 3300046533 Ga0495640_0174131 Ga0495640_0174131_156_731 190
238 3300046615 Ga0495656_0399414 Ga0495656_0399414_55_627 190
239 3300046675 Ga0495657_0219591 Ga0495657_0219591_279_863 190
240 3300047319 Ga0495674_0576949 Ga0495674_0576949_142_717 190
241 3300048904 Ga0496101_0120744 Ga0496101_0120744_251_835 190
242 3300048904 Ga0496101_0255602 Ga0496101_0255602_247_819 190
243 3300048907 Ga0496104_0206287 Ga0496104_0206287_424_996 190
244 3300048907 Ga0496104_0314018 Ga0496104_0314018_134_706 190
245 3300048907 Ga0496104_1176803 Ga0496104_1176803_13_585 190
246 3300048908 Ga0496105_0016766 Ga0496105_0016766_2848_3432 190
247 3300048910 Ga0496107_0801228 Ga0496107_0801228_93_665 190
248 3300048911 Ga0496108_0639227 Ga0496108_0639227_92_664 190
249 3300048912 Ga0496109_0147058 Ga0496109_0147058_879_1451 190
250 3300048916 Ga0496113_0103011 Ga0496113_0103011_1182_1754 190
251 3300048917 Ga0496114_0229782 Ga0496114_0229782_49_621 190
252 3300049574 Ga0501038_0461325 Ga0501038_0461325_133_717 190
253 3300049575 Ga0501039_0416822 Ga0501039_0416822_299_883 190
254 3300049576 Ga0501040_0263968 Ga0501040_0263968_409_993 190
255 3300049576 Ga0501040_0322853 Ga0501040_0322853_292_873 190
256 3300049578 Ga0501042_0387076 Ga0501042_0387076_304_885 190
257 3300049578 Ga0501042_0449714 Ga0501042_0449714_53_637 190
258 3300049579 Ga0501043_0509494 Ga0501043_0509494_175_756 190
259 3300049580 Ga0501046_0397540 Ga0501046_0397540_80_664 190
260 3300049584 Ga0501068_0009331 Ga0501068_0009331_4570_5151 190
261 3300049588 Ga0501072_0013527 Ga0501072_0013527_1297_1878 190
262 3300049588 Ga0501072_0113116 Ga0501072_0113116_841_1425 190
263 3300049589 Ga0501073_0010983 Ga0501073_0010983_4019_4600 190
264 3300049592 Ga0501076_0086719 Ga0501076_0086719_627_1208 190
265 3300049592 Ga0501076_0342602 Ga0501076_0342602_50_637 190
266 3300049593 Ga0501077_0069083 Ga0501077_0069083_131_712 190
267 3300049593 Ga0501077_0129658 Ga0501077_0129658_746_1330 190
268 3300049741 Ga0501079_0028138 Ga0501079_0028138_1423_2004 190
269 3300049741 Ga0501079_0054948 Ga0501079_0054948_845_1429 190
270 3300049742 Ga0501080_0019783 Ga0501080_0019783_1408_1989 190
271 3300049742 Ga0501080_0097361 Ga0501080_0097361_1885_2469 190
272 3300049743 Ga0501081_0037275 Ga0501081_0037275_1505_2092 190
273 3300049744 Ga0501083_0092951 Ga0501083_0092951_1195_1776 190
274 3300049824 Ga0501045_0204206 Ga0501045_0204206_679_1260 190
275 3300050490 nmdc:mga03n38_407946_c1 nmdc:mga03n38_407946_c1_24_596 190
276 3300050491 nmdc:mga00v17_4921_c1 nmdc:mga00v17_4921_c1_4986_5558 190
277 3300050492 nmdc:mga0yw44_231_c1 nmdc:mga0yw44_231_c1_15330_15902 190
278 3300050507 nmdc:mga05p37_854613_c1 nmdc:mga05p37_854613_c1_279_851 190
279 3300050507 nmdc:mga05p37_93105_c1 nmdc:mga05p37_93105_c1_1197_1769 190
280 3300050508 nmdc:mga09592_652799_c1 nmdc:mga09592_652799_c1_161_733 190
281 3300050510 nmdc:mga06r32_40822_c1 nmdc:mga06r32_40822_c1_3194_3766 190
282 3300050512 nmdc:mga0n895_32474_c2 nmdc:mga0n895_32474_c2_400_972 190
283 3300050515 nmdc:mga0a205_244787_c1 nmdc:mga0a205_244787_c1_599_1171 190
284 3300054114 Ga0501084_0090255 Ga0501084_0090255_1462_2043 190
285 3300054114 Ga0501084_1174665 Ga0501084_1174665_13_597 190
286 3300060353 Ga0501082_0105310 Ga0501082_0105310_694_1275 190
287 3300009148 Ga0105243_10144111 Ga0105243_101441112 191
288 3300048903 Ga0496100_0237027 Ga0496100_0237027_432_1016 191
289 3300048911 Ga0496108_0706260 Ga0496108_0706260_187_771 191
290 3300006051 Ga0075364_10034359 Ga0075364_100343594 193
291 3300014326 Ga0157380_10386573 Ga0157380_103865731 193
292 3300050489 nmdc:mga03683_237139_c1 nmdc:mga03683_237139_c1_36_620 193
293 3300050491 nmdc:mga00v17_49790_c1 nmdc:mga00v17_49790_c1_239_823 193
294 3300031251 Ga0265327_10030488 Ga0265327_100304883 194
295 3300036401 Ga0373937_0836575 Ga0373937_0836575_166_750 194
296 3300046462 Ga0495651_0386308 Ga0495651_0386308_233_817 194
297 3300046463 Ga0495653_0006125 Ga0495653_0006125_6240_6824 194
298 3300046514 Ga0495618_0024062 Ga0495618_0024062_323_907 194
299 3300046516 Ga0495628_0006383 Ga0495628_0006383_6484_7068 194
300 3300046516 Ga0495628_0287870 Ga0495628_0287870_231_815 194
301 3300046517 Ga0495630_0220334 Ga0495630_0220334_290_874 194
302 3300046517 Ga0495630_0300572 Ga0495630_0300572_573_1157 194
303 3300046533 Ga0495640_0027162 Ga0495640_0027162_3511_4095 194
304 3300046675 Ga0495657_0358377 Ga0495657_0358377_33_617 194
305 3300046678 Ga0495599_0120650 Ga0495599_0120650_857_1441 194
306 3300046683 Ga0495658_0192612 Ga0495658_0192612_89_673 194
307 3300046683 Ga0495658_0294203 Ga0495658_0294203_158_796 194
308 3300046689 Ga0495613_0020602 Ga0495613_0020602_1001_1585 194
309 3300047319 Ga0495674_0214316 Ga0495674_0214316_575_1159 194
310 3300048912 Ga0496109_0230286 Ga0496109_0230286_478_1101 194
311 3300048915 Ga0496112_0276046 Ga0496112_0276046_738_1361 194
312 3300048916 Ga0496113_0325693 Ga0496113_0325693_159_782 194
313 3300053077 Ga0495601_0145403 Ga0495601_0145403_447_1031 194
314 3300053085 Ga0495619_0110488 Ga0495619_0110488_592_1176 194
315 3300053123 Ga0500614_068919 Ga0500614_068919_20_658 194
316 3300025936 Ga0207670_10922689 Ga0207670_109226891 196
317 3300036712 Ga0316584_0022649 Ga0316584_0022649_839_1453 196
318 3300038443 Ga0395901_0326129 Ga0395901_0326129_189_791 198
319 3300054114 Ga0501084_0000009 Ga0501084_0000009_186536_187162 198
320 3300005981 Ga0081538_10007380 Ga0081538_100073803 200
321 3300003373 JGI25407J50210_10037324 JGI25407J50210_100373242 202
322 3300003373 JGI25407J50210_10053654 JGI25407J50210_100536542 202
323 3300009098 Ga0105245_10276485 Ga0105245_102764853 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22769

DCD

dCTP deaminase-like

2

156

0.97

PF00692

dUTPase

dUTPase

70

178

0.91

PF06559

DCD_N

2'-deoxycytidine 5'-triphosphate deaminase (DCD) N-terminal domain

1

157

0.85

PF22569

DCD_C

2'-deoxycytidine 5'-triphosphate deaminase (DCD), C-terminal domain

46

183

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qlp-assembly2.cif.gz_E bifunctional dctp deaminase:dutpase from mycobacterium tuberculosis, apo form 0.9743 13 171
2qlp-assembly2.cif.gz_E bifunctional dctp deaminase:dutpase from mycobacterium tuberculosis, apo form 0.9683 13 171
2qxx-assembly1.cif.gz_A bifunctional dctp deaminase: dutpase from mycobacterium tuberculosis in complex with dttp 0.9658 13 201
2j4q-assembly1.cif.gz_A crystal structure of a e138a escherichia coli dctp deaminase mutant enzyme in complex with dttp 0.9608 13 174
2qxx-assembly1.cif.gz_A bifunctional dctp deaminase: dutpase from mycobacterium tuberculosis in complex with dttp 0.9608 13 201
ID Description Score Start End Superfamily
2qlpA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9728 13 166 2.70.40.10
2qlpA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9667 13 166 2.70.40.10
4a6aA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9558 13 201 2.70.40.10
2v9xJ01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9533 13 163 2.70.40.10
4xjcF00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9533 13 195 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A538FBU6-F1-model_v4 dCTP deaminase (EC 3.5.4.13) 0.9952 13 114 GO:0006229
GO:0008829
GO:0015949
AF-A0A536AAP7-F1-model_v4 dCTP deaminase (EC 3.5.4.13) 0.9938 13 117 GO:0006229
GO:0008829
GO:0015949
AF-A0A7K0L9R1-F1-model_v4 deleted 0.9909 13 117
AF-A0A7K0VV81-F1-model_v4 dCTP deaminase (EC 3.5.4.13) 0.9898 13 173 GO:0006229
GO:0008829
GO:0015949
AF-A0A538BXM4-F1-model_v4 dCTP deaminase (EC 3.5.4.13) 0.9884 32 200 GO:0006229
GO:0008829
GO:0015949

Feature Viewer

pLDDT pTM Quality
89.73 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map