F406856

General Info

Members Datasets Scaffolds Average Seq Length
323 199 646 226

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10103913|Ga0081455_101039133
Length 211
Sequence MSAAAATLVLLGLGLALLWAPEDADQGISQKIFYVHVPVALTAYACFGWAAWKALRLLWKGDEHYDLESYTAVHMGTIFGVLTLVTGSIWAKVSWGVWWSWSERQLVLFYSAYFMLRYSLDPGPRRQRSSAVYALFGVVLIPISFLAIRLAEDLIHPVVFTREGPQMSGEMFATFCACLAGMLALAGALYSVELAGKRIDERLRELRELLA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
103 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
104 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
105 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
112 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
126 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
127 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
130 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
131 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
132 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
133 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
134 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
135 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 15.79
Rhizosphere 80.8
Stem 0
Stem Tuber 0
Unclassified 17.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10103913 3300005937 Bacteria 2274
2 Ga0070658_10048221 3300005327 Bacteria 3448
3 Ga0070692_10101840 3300005345 Archaea 1575
4 Ga0070668_100188944 3300005347 Bacteria 1686
5 Ga0070675_100116291 3300005354 Bacteria 2268
6 Ga0070671_100378009 3300005355 Bacteria 1210
7 Ga0070673_100197006 3300005364 Bacteria 1733
8 Ga0070703_10016236 3300005406 Bacteria 2136
9 Ga0070709_10074319 3300005434 Unclassified 2202
10 Ga0070709_10130279 3300005434 Bacteria 1716
11 Ga0070709_10148928 3300005434 Bacteria 1615
12 Ga0070714_100008551 3300005435 Bacteria 8003
13 Ga0070713_100324449 3300005436 Bacteria 1423
14 Ga0070710_10055112 3300005437 Bacteria 2245
15 Ga0070711_100091221 3300005439 Bacteria 2196
16 Ga0070711_100219370 3300005439 Bacteria 1477
17 Ga0070705_100001980 3300005440 Bacteria 10456
18 Ga0070705_100012741 3300005440 Bacteria 4283
19 Ga0070700_100150149 3300005441 Bacteria 1593
20 Ga0070708_100035090 3300005445 Bacteria 4368
21 Ga0070708_100688473 3300005445 Bacteria 963
22 Ga0070678_100088413 3300005456 Bacteria 2369
23 Ga0070678_100255941 3300005456 Unclassified 1470
24 Ga0068867_100100085 3300005459 Unclassified 2213
25 Ga0070706_100097365 3300005467 Bacteria 2733
26 Ga0070706_100119836 3300005467 Bacteria 2452
27 Ga0070706_100151514 3300005467 Unclassified 2165
28 Ga0070706_100214706 3300005467 Bacteria 1796
29 Ga0070707_100012179 3300005468 Bacteria 8029
30 Ga0070698_100016183 3300005471 Bacteria 7875
31 Ga0070699_100426652 3300005518 Bacteria 1201
32 Ga0070699_100545735 3300005518 Unclassified 1055
33 Ga0070697_100072914 3300005536 Bacteria 2818
34 Ga0070697_100253653 3300005536 Bacteria 1505
35 Ga0070686_100105998 3300005544 Unclassified 1907
36 Ga0070695_100026332 3300005545 Bacteria 3597
37 Ga0070695_100089686 3300005545 Unclassified 2050
38 Ga0070696_100004176 3300005546 Bacteria 9624
39 Ga0068855_100132501 3300005563 Bacteria 2845
40 Ga0068855_100166258 3300005563 Bacteria 2500
41 Ga0068855_100263219 3300005563 Bacteria 1920
42 Ga0070702_100045705 3300005615 Bacteria 2479
43 Ga0068860_100325043 3300005843 Unclassified 1510
44 Ga0068862_100176229 3300005844 Bacteria 1917
45 Ga0081455_10029746 3300005937 Bacteria 4975
46 Ga0081538_10067072 3300005981 Bacteria 2006
47 Ga0070717_10005558 3300006028 Bacteria 9196
48 Ga0070717_10131843 3300006028 Bacteria 2150
49 Ga0075365_10198377 3300006038 Unclassified 1406
50 Ga0075432_10009643 3300006058 Bacteria 3288
51 Ga0070715_10001780 3300006163 Bacteria 6414
52 Ga0070715_10213456 3300006163 Archaea 988
53 Ga0070716_100082247 3300006173 Bacteria 1925
54 Ga0070712_100008312 3300006175 Bacteria 6523
55 Ga0070712_100054760 3300006175 Unclassified 2790
56 Ga0075362_10043555 3300006177 Bacteria 1987
57 Ga0075427_10008464 3300006194 Unclassified 1525
58 Ga0075366_10239527 3300006195 Unclassified 1106
59 Ga0097621_100664689 3300006237 Archaea 957
60 Ga0075428_100012212 3300006844 Bacteria 9550
61 Ga0075428_101035131 3300006844 Unclassified 868
62 Ga0075430_100031690 3300006846 Bacteria 4486
63 Ga0075431_100002910 3300006847 Bacteria 16568
64 Ga0075431_100131127 3300006847 Bacteria 2585
65 Ga0075431_100183401 3300006847 Bacteria 2147
66 Ga0075434_100001294 3300006871 Bacteria 20866
67 Ga0075434_100051360 3300006871 Bacteria 4098
68 Ga0075434_100122337 3300006871 Unclassified 2618
69 Ga0075434_100758567 3300006871 Bacteria 987
70 Ga0075429_100417268 3300006880 Unclassified 1175
71 Ga0075436_100008390 3300006914 Bacteria 7065
72 Ga0075436_100025839 3300006914 Unclassified 4042
73 Ga0075435_100014482 3300007076 Bacteria 5895
74 Ga0075435_100028080 3300007076 Bacteria 4410
75 Ga0075435_100106102 3300007076 Bacteria 2332
76 Ga0075435_100158871 3300007076 Bacteria 1903
77 Ga0105240_10040117 3300009093 Bacteria 5992
78 Ga0111539_10035714 3300009094 Bacteria 6017
79 Ga0111539_10194872 3300009094 Unclassified 2363
80 Ga0114129_10030813 3300009147 Bacteria 7585
81 Ga0114129_10152844 3300009147 Bacteria 3158
82 Ga0114129_10947945 3300009147 Bacteria 1087
83 Ga0105243_10030286 3300009148 Bacteria 4165
84 Ga0105242_10075291 3300009176 Bacteria 2810
85 Ga0105242_10112288 3300009176 Bacteria 2325
86 Ga0105249_10202955 3300009553 Bacteria 1941
87 Ga0157338_1005140 3300012515 Unclassified 1164
88 Ga0157373_10188608 3300013100 Bacteria 1453
89 Ga0157371_10138506 3300013102 Bacteria 1733
90 Ga0157370_10171397 3300013104 Bacteria 2017
91 Ga0157370_10323325 3300013104 Unclassified 1423
92 Ga0157369_10335072 3300013105 Unclassified 1572
93 Ga0157378_10304291 3300013297 Archaea 1544
94 Ga0163162_10402426 3300013306 Bacteria 1502
95 Ga0157372_10206232 3300013307 Unclassified 2278
96 Ga0157377_10046952 3300014745 Bacteria 2417
97 Ga0206356_10116221 3300020070 Bacteria 6173
98 Ga0206353_11034127 3300020082 Bacteria 1342
99 Ga0207653_10023309 3300025885 Bacteria 1971
100 Ga0207692_10052686 3300025898 Bacteria 2069
101 Ga0207692_10058795 3300025898 Bacteria 1982
102 Ga0207688_10041292 3300025901 Bacteria 2566
103 Ga0207685_10074187 3300025905 Archaea 1388
104 Ga0207685_10085505 3300025905 Bacteria 1316
105 Ga0207699_10614536 3300025906 Bacteria 792
106 Ga0207645_10352582 3300025907 Bacteria 985
107 Ga0207705_10058795 3300025909 Bacteria 2773
108 Ga0207705_10168621 3300025909 Unclassified 1648
109 Ga0207684_10029508 3300025910 Bacteria 4670
110 Ga0207684_10184642 3300025910 Archaea 1798
111 Ga0207654_10068213 3300025911 Bacteria 2103
112 Ga0207695_10223494 3300025913 Bacteria 1790
113 Ga0207693_10006721 3300025915 Bacteria 9497
114 Ga0207693_10014706 3300025915 Bacteria 6287
115 Ga0207693_10140441 3300025915 Bacteria 1899
116 Ga0207663_10022967 3300025916 Bacteria 3572
117 Ga0207663_10136782 3300025916 Bacteria 1701
118 Ga0207663_10326734 3300025916 Bacteria 1154
119 Ga0207660_10352402 3300025917 Bacteria 1180
120 Ga0207657_10015573 3300025919 Bacteria 7360
121 Ga0207649_10074594 3300025920 Bacteria 2177
122 Ga0207652_10578437 3300025921 Bacteria 1008
123 Ga0207646_10005974 3300025922 Bacteria 12694
124 Ga0207646_10093778 3300025922 Bacteria 2688
125 Ga0207659_10100139 3300025926 Bacteria 2183
126 Ga0207664_10009220 3300025929 Bacteria 6913
127 Ga0207664_10142617 3300025929 Unclassified 2028
128 Ga0207664_10492255 3300025929 Bacteria 1097
129 Ga0207664_10544898 3300025929 Bacteria 1041
130 Ga0207706_10269625 3300025933 Bacteria 1485
131 Ga0207686_10010201 3300025934 Bacteria 5108
132 Ga0207686_10047193 3300025934 Bacteria 2661
133 Ga0207709_10032745 3300025935 Bacteria 3046
134 Ga0207669_10032911 3300025937 Bacteria 2919
135 Ga0207665_10032199 3300025939 Bacteria 3471
136 Ga0207665_10053326 3300025939 Bacteria 2726
137 Ga0207667_10057105 3300025949 Bacteria 4099
138 Ga0207667_10111378 3300025949 Bacteria 2823
139 Ga0207667_10258625 3300025949 Unclassified 1780
140 Ga0207651_10175427 3300025960 Unclassified 1695
141 Ga0207640_10215595 3300025981 Unclassified 1466
142 Ga0207702_10169479 3300026078 Bacteria 2001
143 Ga0207648_10284819 3300026089 Unclassified 1478
144 Ga0207675_100023461 3300026118 Bacteria 5739
145 Ga0207683_10028031 3300026121 Bacteria 4868
146 Ga0207683_10292717 3300026121 Unclassified 1489
147 Ga0207428_10012767 3300027907 Bacteria 7368
148 Ga0265338_10015003 3300028800 Bacteria 8558
149 Ga0265338_10077189 3300028800 Bacteria 2817
150 Ga0265338_10325250 3300028800 Bacteria 1112
151 Ga0307410_10521293 3300031852 Unclassified 981
152 Ga0307409_100129753 3300031995 Bacteria 2152
153 Ga0307415_100182638 3300032126 Bacteria 1647
154 Ga0373950_0001761 3300034818 Bacteria 2876
155 Ga0373938_0001728 3300034957 Bacteria 3486
156 Ga0373929_0008027 3300035085 Bacteria 1941
157 Ga0373949_0009760 3300035090 Bacteria 2101
158 Ga0373951_0003790 3300035091 Bacteria 3642
159 Ga0373952_0002137 3300035092 Bacteria 3553
160 Ga0373932_0001410 3300035112 Bacteria 6733
161 Ga0373960_0004276 3300035121 Bacteria 3261
162 Ga0373946_0281791 3300035171 Bacteria 818
163 Ga0373942_0003179 3300035207 Bacteria 3885
164 Ga0373961_0004922 3300035241 Bacteria 3209
165 Ga0373962_0118368 3300035242 Bacteria 842
166 Ga0373931_0010609 3300035691 Bacteria 4430
167 Ga0373925_0345605 3300037068 Bacteria 1207
168 Ga0395899_0002568 3300037312 Bacteria 14676
169 Ga0395899_0037072 3300037312 Bacteria 3655
170 Ga0395900_0001219 3300037418 Bacteria 31689
171 Ga0395900_0030040 3300037418 Bacteria 5577
172 Ga0395900_0112231 3300037418 Bacteria 2799
173 Ga0395900_0670944 3300037418 Bacteria 972
174 Ga0395898_0003534 3300037466 Bacteria 17426
175 Ga0395898_0009260 3300037466 Bacteria 10357
176 Ga0395898_0059199 3300037466 Bacteria 3727
177 Ga0395905_0000640 3300037471 Bacteria 46768
178 Ga0395905_0037174 3300037471 Bacteria 4572
179 Ga0395905_0172765 3300037471 Bacteria 2030
180 Ga0436364_0824177 3300037853 Unclassified 2430
181 Ga0395901_0000978 3300038443 Bacteria 30977
182 Ga0395901_0002272 3300038443 Bacteria 19614
183 Ga0395901_0024724 3300038443 Bacteria 6166
184 Ga0395901_0067303 3300038443 Bacteria 3730
185 Ga0395901_0553386 3300038443 Bacteria 1166
186 Ga0436365_0036582 3300039437 Bacteria 1619
187 Ga0436363_1066458 3300039450 Bacteria 1390
188 Ga0436362_0473111 3300039453 Unclassified 979
189 Ga0436362_1039118 3300039453 Bacteria 4432
190 Ga0451787_171501 3300041441 Unclassified 1083
191 Ga0451787_533955 3300041441 Unclassified 789
192 Ga0451789_1066325 3300041443 Unclassified 1028
193 Ga0451791_0143871 3300041451 Unclassified 1231
194 Ga0451793_1258571 3300041452 Bacteria 1469
195 Ga0451795_0146396 3300041456 Bacteria 2390
196 Ga0451800_0447184 3300041459 Bacteria 1062
197 Ga0451804_1084114 3300041463 Bacteria 2057
198 Ga0451835_0992972 3300041492 Unclassified 1408
199 Ga0451839_1382066 3300041496 Unclassified 972
200 Ga0451839_1383881 3300041496 Bacteria 2671
201 Ga0451849_0297173 3300041505 Bacteria 1708
202 Ga0439437_002361 3300042000 Bacteria 2017
203 Ga0439448_0068220 3300042005 Bacteria 1182
204 Ga0450893_0029155 3300042532 Unclassified 978
205 Ga0466965_0208011 3300044683 Unclassified 1040
206 Ga0466966_0050333 3300044684 Bacteria 2651
207 Ga0466961_0153235 3300044693 Bacteria 1438
208 Ga0466964_0000465 3300044706 Bacteria 12455
209 Ga0466971_0041098 3300044719 Unclassified 2077
210 Ga0466960_0013178 3300044901 Bacteria 3506
211 Ga0466960_0035015 3300044901 Bacteria 2343
212 Ga0466960_0262731 3300044901 Bacteria 962
213 Ga0451576_0117128 3300045051 Bacteria 2773
214 Ga0451576_0762038 3300045051 Bacteria 1017
215 Ga0466967_0012913 3300045976 Bacteria 6422
216 Ga0466967_0086535 3300045976 Unclassified 2840
217 Ga0466967_0137862 3300045976 Bacteria 2270
218 Ga0466967_0348482 3300045976 Bacteria 1433
219 Ga0466967_0385279 3300045976 Bacteria 1362
220 Ga0466967_0398570 3300045976 Bacteria 1338
221 Ga0466967_0649298 3300045976 Bacteria 1043
222 Ga0495629_0103795 3300046459 Bacteria 1983
223 Ga0495582_0056172 3300046473 Bacteria 2170
224 Ga0495664_0292151 3300046477 Bacteria 984
225 Ga0495596_0128443 3300046500 Archaea 984
226 Ga0495630_0060227 3300046517 Bacteria 2849
227 Ga0495586_0000939 3300046535 Bacteria 16532
228 Ga0495634_0259383 3300046642 Bacteria 1061
229 Ga0495657_0060193 3300046675 Bacteria 2517
230 Ga0495599_0107511 3300046678 Bacteria 1738
231 Ga0495658_0025916 3300046683 Bacteria 3138
232 Ga0495613_0037784 3300046689 Bacteria 3580
233 Ga0495613_0285027 3300046689 Bacteria 1146
234 Ga0495600_0489604 3300046809 Bacteria 757
235 Ga0495604_0154197 3300047317 Unclassified 1629
236 Ga0495674_0268165 3300047319 Bacteria 1401
237 Ga0495674_0526402 3300047319 Bacteria 943
238 Ga0495676_0044322 3300047321 Bacteria 3632
239 Ga0495680_0018905 3300047322 Bacteria 5834
240 Ga0495680_0144189 3300047322 Bacteria 1741
241 Ga0495680_0155234 3300047322 Bacteria 1666
242 Ga0495602_0073509 3300048088 Bacteria 2910
243 Ga0496100_0013565 3300048903 Bacteria 4705
244 Ga0496100_0014931 3300048903 Bacteria 4524
245 Ga0496101_0006880 3300048904 Bacteria 7340
246 Ga0496101_0041129 3300048904 Bacteria 3294
247 Ga0496102_0025477 3300048905 Bacteria 5266
248 Ga0496102_0075166 3300048905 Bacteria 3105
249 Ga0496102_0158599 3300048905 Bacteria 2128
250 Ga0496102_0240373 3300048905 Bacteria 1707
251 Ga0496103_0020079 3300048906 Bacteria 4012
252 Ga0496103_0062361 3300048906 Bacteria 2320
253 Ga0496104_0010631 3300048907 Bacteria 8224
254 Ga0496105_0005606 3300048908 Bacteria 9546
255 Ga0496105_0124095 3300048908 Bacteria 2129
256 Ga0496105_0181671 3300048908 Unclassified 1722
257 Ga0496105_0191119 3300048908 Bacteria 1674
258 Ga0496106_0014150 3300048909 Bacteria 5894
259 Ga0496106_0016169 3300048909 Bacteria 5518
260 Ga0496106_0022796 3300048909 Bacteria 4651
261 Ga0496106_0179469 3300048909 Unclassified 1680
262 Ga0496107_0000242 3300048910 Bacteria 28631
263 Ga0496107_0021016 3300048910 Bacteria 4612
264 Ga0496107_0134000 3300048910 Bacteria 1830
265 Ga0496108_0003137 3300048911 Bacteria 13288
266 Ga0496108_0022146 3300048911 Bacteria 5225
267 Ga0496108_0182249 3300048911 Bacteria 1819
268 Ga0496109_0078509 3300048912 Bacteria 3040
269 Ga0496109_0091829 3300048912 Bacteria 2808
270 Ga0496109_0103106 3300048912 Bacteria 2647
271 Ga0496109_0446415 3300048912 Unclassified 1222
272 Ga0496110_0156234 3300048913 Bacteria 2066
273 Ga0496110_0222444 3300048913 Bacteria 1717
274 Ga0496110_0321096 3300048913 Unclassified 1410
275 Ga0496110_0703590 3300048913 Bacteria 912
276 Ga0496111_0258811 3300048914 Bacteria 1291
277 Ga0496112_0000635 3300048915 Bacteria 24368
278 Ga0496112_0013900 3300048915 Bacteria 7448
279 Ga0496112_0123547 3300048915 Bacteria 2559
280 Ga0496112_0590097 3300048915 Bacteria 1043
281 Ga0496112_0780949 3300048915 Bacteria 880
282 Ga0496113_0175989 3300048916 Unclassified 1695
283 Ga0496114_0015427 3300048917 Bacteria 6145
284 Ga0496114_0096688 3300048917 Unclassified 2515
285 Ga0496115_0056232 3300048918 Unclassified 3162
286 Ga0501046_0111259 3300049580 Bacteria 2092
287 Ga0501047_0037685 3300049581 Bacteria 4676
288 Ga0501067_0011608 3300049583 Bacteria 4879
289 Ga0501068_0188639 3300049584 Unclassified 1305
290 Ga0501069_0121731 3300049585 Bacteria 1490
291 Ga0501076_0403383 3300049592 Unclassified 1124
292 Ga0501079_0107635 3300049741 Bacteria 2164
293 Ga0501080_0132627 3300049742 Bacteria 2306
294 nmdc:mga00v17_155991_c1 3300050491 Unclassified 1468
295 nmdc:mga05p37_100500_c1 3300050507 Bacteria 3563
296 nmdc:mga05p37_25384_c1 3300050507 Bacteria 7206
297 nmdc:mga09592_140197_c1 3300050508 Unclassified 2084
298 nmdc:mga09592_558327_c1 3300050508 Bacteria 983
299 nmdc:mga06r32_205713_c1 3300050510 Bacteria 1957
300 nmdc:mga06r32_97004_c1 3300050510 Bacteria 2888
301 nmdc:mga08y16_19493_c1 3300050511 Bacteria 7151
302 nmdc:mga08y16_335124_c1 3300050511 Unclassified 1556
303 nmdc:mga0n895_122904_c1 3300050512 Unclassified 2618
304 nmdc:mga0n895_20500_c1 3300050512 Bacteria 6167
305 nmdc:mga0n895_611190_c1 3300050512 Bacteria 1092
306 nmdc:mga0n895_96855_c1 3300050512 Bacteria 2956
307 nmdc:mga0rr50_33890_c1 3300050513 Bacteria 3652
308 nmdc:mga0rr50_514903_c1 3300050513 Archaea 1018
309 nmdc:mga0rr50_69555_c1 3300050513 Bacteria 2680
310 nmdc:mga0rr50_9830_c1 3300050513 Bacteria 6042
311 nmdc:mga08x19_15140_c1 3300050514 Bacteria 4689
312 nmdc:mga08x19_5986_c1 3300050514 Bacteria 7191
313 nmdc:mga08x19_63372_c1 3300050514 Bacteria 2399
314 nmdc:mga0a205_159481_c1 3300050515 Bacteria 2153
315 nmdc:mga0a205_544672_c1 3300050515 Bacteria 1016
316 nmdc:mga0a205_84895_c1 3300050515 Bacteria 3058
317 Ga0495601_0214431 3300053077 Bacteria 1257
318 Ga0495601_0572482 3300053077 Unclassified 726
319 Ga0495612_0018904 3300053078 Bacteria 2759
320 Ga0495612_0133623 3300053078 Unclassified 1073
321 Ga0501084_0124590 3300054114 Unclassified 2168
322 Ga0530510_0014093 3300061734 Bacteria 5637
323 Ga0530510_0039407 3300061734 Bacteria 3411
324 Ga0081455_10103913
325 Ga0070658_10048221
326 Ga0070692_10101840
327 Ga0070668_100188944
328 Ga0070675_100116291
329 Ga0070671_100378009
330 Ga0070673_100197006
331 Ga0070703_10016236
332 Ga0070709_10074319
333 Ga0070709_10130279
334 Ga0070709_10148928
335 Ga0070714_100008551
336 Ga0070713_100324449
337 Ga0070710_10055112
338 Ga0070711_100091221
339 Ga0070711_100219370
340 Ga0070705_100001980
341 Ga0070705_100012741
342 Ga0070700_100150149
343 Ga0070708_100035090
344 Ga0070708_100688473
345 Ga0070678_100088413
346 Ga0070678_100255941
347 Ga0068867_100100085
348 Ga0070706_100097365
349 Ga0070706_100119836
350 Ga0070706_100151514
351 Ga0070706_100214706
352 Ga0070707_100012179
353 Ga0070698_100016183
354 Ga0070699_100426652
355 Ga0070699_100545735
356 Ga0070697_100072914
357 Ga0070697_100253653
358 Ga0070686_100105998
359 Ga0070695_100026332
360 Ga0070695_100089686
361 Ga0070696_100004176
362 Ga0068855_100132501
363 Ga0068855_100166258
364 Ga0068855_100263219
365 Ga0070702_100045705
366 Ga0068860_100325043
367 Ga0068862_100176229
368 Ga0081455_10029746
369 Ga0081538_10067072
370 Ga0070717_10005558
371 Ga0070717_10131843
372 Ga0075365_10198377
373 Ga0075432_10009643
374 Ga0070715_10001780
375 Ga0070715_10213456
376 Ga0070716_100082247
377 Ga0070712_100008312
378 Ga0070712_100054760
379 Ga0075362_10043555
380 Ga0075427_10008464
381 Ga0075366_10239527
382 Ga0097621_100664689
383 Ga0075428_100012212
384 Ga0075428_101035131
385 Ga0075430_100031690
386 Ga0075431_100002910
387 Ga0075431_100131127
388 Ga0075431_100183401
389 Ga0075434_100001294
390 Ga0075434_100051360
391 Ga0075434_100122337
392 Ga0075434_100758567
393 Ga0075429_100417268
394 Ga0075436_100008390
395 Ga0075436_100025839
396 Ga0075435_100014482
397 Ga0075435_100028080
398 Ga0075435_100106102
399 Ga0075435_100158871
400 Ga0105240_10040117
401 Ga0111539_10035714
402 Ga0111539_10194872
403 Ga0114129_10030813
404 Ga0114129_10152844
405 Ga0114129_10947945
406 Ga0105243_10030286
407 Ga0105242_10075291
408 Ga0105242_10112288
409 Ga0105249_10202955
410 Ga0157338_1005140
411 Ga0157373_10188608
412 Ga0157371_10138506
413 Ga0157370_10171397
414 Ga0157370_10323325
415 Ga0157369_10335072
416 Ga0157378_10304291
417 Ga0163162_10402426
418 Ga0157372_10206232
419 Ga0157377_10046952
420 Ga0206356_10116221
421 Ga0206353_11034127
422 Ga0207653_10023309
423 Ga0207692_10052686
424 Ga0207692_10058795
425 Ga0207688_10041292
426 Ga0207685_10074187
427 Ga0207685_10085505
428 Ga0207699_10614536
429 Ga0207645_10352582
430 Ga0207705_10058795
431 Ga0207705_10168621
432 Ga0207684_10029508
433 Ga0207684_10184642
434 Ga0207654_10068213
435 Ga0207695_10223494
436 Ga0207693_10006721
437 Ga0207693_10014706
438 Ga0207693_10140441
439 Ga0207663_10022967
440 Ga0207663_10136782
441 Ga0207663_10326734
442 Ga0207660_10352402
443 Ga0207657_10015573
444 Ga0207649_10074594
445 Ga0207652_10578437
446 Ga0207646_10005974
447 Ga0207646_10093778
448 Ga0207659_10100139
449 Ga0207664_10009220
450 Ga0207664_10142617
451 Ga0207664_10492255
452 Ga0207664_10544898
453 Ga0207706_10269625
454 Ga0207686_10010201
455 Ga0207686_10047193
456 Ga0207709_10032745
457 Ga0207669_10032911
458 Ga0207665_10032199
459 Ga0207665_10053326
460 Ga0207667_10057105
461 Ga0207667_10111378
462 Ga0207667_10258625
463 Ga0207651_10175427
464 Ga0207640_10215595
465 Ga0207702_10169479
466 Ga0207648_10284819
467 Ga0207675_100023461
468 Ga0207683_10028031
469 Ga0207683_10292717
470 Ga0207428_10012767
471 Ga0265338_10015003
472 Ga0265338_10077189
473 Ga0265338_10325250
474 Ga0307410_10521293
475 Ga0307409_100129753
476 Ga0307415_100182638
477 Ga0373950_0001761
478 Ga0373938_0001728
479 Ga0373929_0008027
480 Ga0373949_0009760
481 Ga0373951_0003790
482 Ga0373952_0002137
483 Ga0373932_0001410
484 Ga0373960_0004276
485 Ga0373946_0281791
486 Ga0373942_0003179
487 Ga0373961_0004922
488 Ga0373962_0118368
489 Ga0373931_0010609
490 Ga0373925_0345605
491 Ga0395899_0002568
492 Ga0395899_0037072
493 Ga0395900_0001219
494 Ga0395900_0030040
495 Ga0395900_0112231
496 Ga0395900_0670944
497 Ga0395898_0003534
498 Ga0395898_0009260
499 Ga0395898_0059199
500 Ga0395905_0000640
501 Ga0395905_0037174
502 Ga0395905_0172765
503 Ga0436364_0824177
504 Ga0395901_0000978
505 Ga0395901_0002272
506 Ga0395901_0024724
507 Ga0395901_0067303
508 Ga0395901_0553386
509 Ga0436365_0036582
510 Ga0436363_1066458
511 Ga0436362_0473111
512 Ga0436362_1039118
513 Ga0451787_171501
514 Ga0451787_533955
515 Ga0451789_1066325
516 Ga0451791_0143871
517 Ga0451793_1258571
518 Ga0451795_0146396
519 Ga0451800_0447184
520 Ga0451804_1084114
521 Ga0451835_0992972
522 Ga0451839_1382066
523 Ga0451839_1383881
524 Ga0451849_0297173
525 Ga0439437_002361
526 Ga0439448_0068220
527 Ga0450893_0029155
528 Ga0466965_0208011
529 Ga0466966_0050333
530 Ga0466961_0153235
531 Ga0466964_0000465
532 Ga0466971_0041098
533 Ga0466960_0013178
534 Ga0466960_0035015
535 Ga0466960_0262731
536 Ga0451576_0117128
537 Ga0451576_0762038
538 Ga0466967_0012913
539 Ga0466967_0086535
540 Ga0466967_0137862
541 Ga0466967_0348482
542 Ga0466967_0385279
543 Ga0466967_0398570
544 Ga0466967_0649298
545 Ga0495629_0103795
546 Ga0495582_0056172
547 Ga0495664_0292151
548 Ga0495596_0128443
549 Ga0495630_0060227
550 Ga0495586_0000939
551 Ga0495634_0259383
552 Ga0495657_0060193
553 Ga0495599_0107511
554 Ga0495658_0025916
555 Ga0495613_0037784
556 Ga0495613_0285027
557 Ga0495600_0489604
558 Ga0495604_0154197
559 Ga0495674_0268165
560 Ga0495674_0526402
561 Ga0495676_0044322
562 Ga0495680_0018905
563 Ga0495680_0144189
564 Ga0495680_0155234
565 Ga0495602_0073509
566 Ga0496100_0013565
567 Ga0496100_0014931
568 Ga0496101_0006880
569 Ga0496101_0041129
570 Ga0496102_0025477
571 Ga0496102_0075166
572 Ga0496102_0158599
573 Ga0496102_0240373
574 Ga0496103_0020079
575 Ga0496103_0062361
576 Ga0496104_0010631
577 Ga0496105_0005606
578 Ga0496105_0124095
579 Ga0496105_0181671
580 Ga0496105_0191119
581 Ga0496106_0014150
582 Ga0496106_0016169
583 Ga0496106_0022796
584 Ga0496106_0179469
585 Ga0496107_0000242
586 Ga0496107_0021016
587 Ga0496107_0134000
588 Ga0496108_0003137
589 Ga0496108_0022146
590 Ga0496108_0182249
591 Ga0496109_0078509
592 Ga0496109_0091829
593 Ga0496109_0103106
594 Ga0496109_0446415
595 Ga0496110_0156234
596 Ga0496110_0222444
597 Ga0496110_0321096
598 Ga0496110_0703590
599 Ga0496111_0258811
600 Ga0496112_0000635
601 Ga0496112_0013900
602 Ga0496112_0123547
603 Ga0496112_0590097
604 Ga0496112_0780949
605 Ga0496113_0175989
606 Ga0496114_0015427
607 Ga0496114_0096688
608 Ga0496115_0056232
609 Ga0501046_0111259
610 Ga0501047_0037685
611 Ga0501067_0011608
612 Ga0501068_0188639
613 Ga0501069_0121731
614 Ga0501076_0403383
615 Ga0501079_0107635
616 Ga0501080_0132627
617 nmdc:mga00v17_155991_c1
618 nmdc:mga05p37_100500_c1
619 nmdc:mga05p37_25384_c1
620 nmdc:mga09592_140197_c1
621 nmdc:mga09592_558327_c1
622 nmdc:mga06r32_205713_c1
623 nmdc:mga06r32_97004_c1
624 nmdc:mga08y16_19493_c1
625 nmdc:mga08y16_335124_c1
626 nmdc:mga0n895_122904_c1
627 nmdc:mga0n895_20500_c1
628 nmdc:mga0n895_611190_c1
629 nmdc:mga0n895_96855_c1
630 nmdc:mga0rr50_33890_c1
631 nmdc:mga0rr50_514903_c1
632 nmdc:mga0rr50_69555_c1
633 nmdc:mga0rr50_9830_c1
634 nmdc:mga08x19_15140_c1
635 nmdc:mga08x19_5986_c1
636 nmdc:mga08x19_63372_c1
637 nmdc:mga0a205_159481_c1
638 nmdc:mga0a205_544672_c1
639 nmdc:mga0a205_84895_c1
640 Ga0495601_0214431
641 Ga0495601_0572482
642 Ga0495612_0018904
643 Ga0495612_0133623
644 Ga0501084_0124590
645 Ga0530510_0014093
646 Ga0530510_0039407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

1

156

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.8507 2 215
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.8084 2 215
6xz3-assembly1.cif.gz_A-2 crystal structure of tlnrd1 4-helix bundle 0.6112 45 155
2lff-assembly1.cif.gz_A solution structure of diiron protein in presence of 8 eq zn2+, northeast structural genomics consortium target or21 0.6094 48 160
6xz3-assembly1.cif.gz_A-2 crystal structure of tlnrd1 4-helix bundle 0.5612 45 155
ID Description Score Start End Superfamily
af_A0A0R4IDZ8_482_655_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.5497 6 155 1.20.1420.10
af_Q9H1K6_144_260_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5359 42 150 1.20.120.230
af_A0A1D6NFR3_201_388_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5334 23 213 1.20.120.1770
af_I1KRR7_20_220_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5131 17 209 1.20.120.1770
af_Q18826_258_405_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.5073 45 153 1.20.1410.10
ID Description Score Start End GO Terms
AF-A0A7W0SW06-F1-model_v4 Heme exporter protein C 0.9108 3 142 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A7W0U9W7-F1-model_v4 Heme exporter protein C 0.8919 2 221 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A838I9E4-F1-model_v4 Heme exporter protein C 0.8915 1 221 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A0R2XU57-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein CcmC) 0.8912 3 155 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A1V5YM22-F1-model_v4 Heme exporter protein C 0.89 2 221 GO:0005886
GO:0015232
GO:0017004
GO:0020037

Map