F406787

General Info

Members Datasets Scaffolds Average Seq Length
323 233 646 94

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100588841|Ga0070659_1005888411
Length 108
Sequence MLQLSCPWCGPRDETEYHYGGQAHVAYPEDPAALSDPEWAAYLFYRDNPKGPFAERWMHSTGCRRWFNVVRDTRTYEVLAVYTNRDPRPEIGPKTGAAVSADVAGGRK

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
105 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
224 2643221576 Nocardioides sp. Root614 Isolate Unclassified
225 2643221590 Nocardioides sp. Root682 Isolate Unclassified
226 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
227 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
228 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
229 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
230 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
231 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
232 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
233 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.59
Metatranscriptomes 0
Isolates 3.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.74
Rhizosphere 87.31
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100588841 3300005366 Bacteria 955
2 JGI25406J46586_10005838 3300003203 Bacteria 5697
3 Ga0070658_11618678 3300005327 Bacteria 561
4 Ga0070683_100001933 3300005329 Bacteria 16212
5 Ga0070670_100768660 3300005331 Bacteria 869
6 Ga0068869_100062109 3300005334 Bacteria 2741
7 Ga0070682_101686490 3300005337 Bacteria 550
8 Ga0070682_102040040 3300005337 Bacteria 505
9 Ga0068868_100010491 3300005338 Bacteria 6712
10 Ga0068868_102308961 3300005338 Bacteria 513
11 Ga0070660_100128305 3300005339 Bacteria 2028
12 Ga0070660_101257584 3300005339 Bacteria 628
13 Ga0070660_101954668 3300005339 Bacteria 500
14 Ga0070687_100032230 3300005343 Bacteria 2577
15 Ga0070692_10008086 3300005345 Bacteria 4672
16 Ga0070668_100670787 3300005347 Bacteria 912
17 Ga0070675_100001126 3300005354 Bacteria 19307
18 Ga0070675_100753458 3300005354 Bacteria 889
19 Ga0070674_100078309 3300005356 Bacteria 2355
20 Ga0070659_100048803 3300005366 Bacteria 3327
21 Ga0070659_102139008 3300005366 Bacteria 503
22 Ga0070701_10639790 3300005438 Bacteria 709
23 Ga0070711_100074897 3300005439 Bacteria 2395
24 Ga0070705_101773122 3300005440 Bacteria 523
25 Ga0070700_100042448 3300005441 Bacteria 2793
26 Ga0070708_100123894 3300005445 Bacteria 2387
27 Ga0070708_101487118 3300005445 Bacteria 631
28 Ga0070663_100575626 3300005455 Bacteria 944
29 Ga0070678_100886623 3300005456 Bacteria 815
30 Ga0070678_100923987 3300005456 Bacteria 799
31 Ga0070685_10111582 3300005466 Bacteria 1685
32 Ga0070707_100215466 3300005468 Bacteria 1871
33 Ga0070698_100001100 3300005471 Bacteria 29758
34 Ga0070699_101456150 3300005518 Bacteria 628
35 Ga0070684_100010916 3300005535 Bacteria 7218
36 Ga0070684_101573191 3300005535 Bacteria 620
37 Ga0070684_101675562 3300005535 Bacteria 600
38 Ga0070697_101401315 3300005536 Bacteria 624
39 Ga0068853_100248332 3300005539 Bacteria 1632
40 Ga0068853_101186173 3300005539 Bacteria 737
41 Ga0070672_100146128 3300005543 Bacteria 1954
42 Ga0070686_100907592 3300005544 Bacteria 717
43 Ga0070696_100692440 3300005546 Bacteria 830
44 Ga0070664_100000864 3300005564 Bacteria 23434
45 Ga0068854_100386164 3300005578 Bacteria 1155
46 Ga0068854_100526672 3300005578 Bacteria 999
47 Ga0068856_100614188 3300005614 Bacteria 1108
48 Ga0068856_101272834 3300005614 Bacteria 751
49 Ga0068852_100743005 3300005616 Bacteria 993
50 Ga0068852_102205386 3300005616 Bacteria 572
51 Ga0068859_100296800 3300005617 Bacteria 1709
52 Ga0068866_10124672 3300005718 Bacteria 1456
53 Ga0068861_100476087 3300005719 Bacteria 1124
54 Ga0068861_100507612 3300005719 Bacteria 1091
55 Ga0068861_101542698 3300005719 Bacteria 653
56 Ga0068861_102149904 3300005719 Bacteria 559
57 Ga0068851_10253310 3300005834 Bacteria 999
58 Ga0068870_11439423 3300005840 Bacteria 506
59 Ga0068863_101937884 3300005841 Bacteria 599
60 Ga0068858_100099605 3300005842 Bacteria 2710
61 Ga0068858_100504504 3300005842 Bacteria 1169
62 Ga0068858_102305999 3300005842 Bacteria 532
63 Ga0068862_100026942 3300005844 Bacteria 4835
64 Ga0068862_100644496 3300005844 Bacteria 1021
65 Ga0081539_10000607 3300005985 Bacteria 72839
66 Ga0070715_10020551 3300006163 Bacteria 2548
67 Ga0070716_100102876 3300006173 Bacteria 1755
68 Ga0070712_100030682 3300006175 Bacteria 3616
69 Ga0075434_101778893 3300006871 Unclassified 623
70 Ga0097620_100296793 3300006931 Bacteria 1709
71 Ga0105240_10049339 3300009093 Bacteria 5314
72 Ga0111539_10229735 3300009094 Bacteria 2160
73 Ga0105245_13011901 3300009098 Bacteria 522
74 Ga0105243_10294455 3300009148 Bacteria 1468
75 Ga0105243_12222153 3300009148 Bacteria 585
76 Ga0105242_13120239 3300009176 Bacteria 514
77 Ga0105237_10574968 3300009545 Bacteria 1134
78 Ga0105238_10265627 3300009551 Bacteria 1696
79 Ga0105238_11268757 3300009551 Bacteria 762
80 Ga0105238_11441515 3300009551 Bacteria 716
81 Ga0105249_10216852 3300009553 Bacteria 1881
82 Ga0105249_11872319 3300009553 Bacteria 673
83 Ga0105239_10132324 3300010375 Bacteria 2775
84 Ga0105239_10200670 3300010375 Bacteria 2234
85 Ga0163162_10697318 3300013306 Bacteria 1137
86 Ga0157375_10435482 3300013308 Bacteria 1477
87 Ga0157375_10799014 3300013308 Bacteria 1092
88 Ga0157375_10806878 3300013308 Bacteria 1087
89 Ga0157380_10069625 3300014326 Bacteria 2840
90 Ga0157380_12027687 3300014326 Bacteria 637
91 Ga0157377_10426322 3300014745 Bacteria 910
92 Ga0157379_11909109 3300014968 Bacteria 585
93 Ga0213875_10002472 3300021388 Bacteria 11033
94 Ga0207656_10067722 3300025321 Bacteria 1581
95 Ga0207692_10015175 3300025898 Bacteria 3384
96 Ga0207642_10392540 3300025899 Bacteria 828
97 Ga0207688_10036237 3300025901 Bacteria 2735
98 Ga0207685_10191487 3300025905 Bacteria 955
99 Ga0207695_10014905 3300025913 Bacteria 9175
100 Ga0207693_10003664 3300025915 Bacteria 13111
101 Ga0207693_10393905 3300025915 Bacteria 1083
102 Ga0207662_10070256 3300025918 Bacteria 2118
103 Ga0207649_10067219 3300025920 Bacteria 2274
104 Ga0207652_11009522 3300025921 Bacteria 731
105 Ga0207646_10071467 3300025922 Bacteria 3099
106 Ga0207694_10154541 3300025924 Bacteria 1850
107 Ga0207650_10902884 3300025925 Bacteria 750
108 Ga0207659_10014215 3300025926 Bacteria 5124
109 Ga0207659_10791425 3300025926 Bacteria 814
110 Ga0207690_10078618 3300025932 Bacteria 2296
111 Ga0207690_11118308 3300025932 Bacteria 657
112 Ga0207690_11741402 3300025932 Bacteria 520
113 Ga0207706_11711833 3300025933 Bacteria 506
114 Ga0207709_10318627 3300025935 Bacteria 1163
115 Ga0207669_10069890 3300025937 Bacteria 2199
116 Ga0207669_10800229 3300025937 Bacteria 782
117 Ga0207665_10114004 3300025939 Bacteria 1902
118 Ga0207665_10956158 3300025939 Bacteria 681
119 Ga0207691_10204401 3300025940 Bacteria 1718
120 Ga0207689_10052490 3300025942 Bacteria 3359
121 Ga0207661_10006900 3300025944 Bacteria 8051
122 Ga0207661_10491716 3300025944 Bacteria 1121
123 Ga0207679_10002051 3300025945 Bacteria 12508
124 Ga0207712_10128671 3300025961 Bacteria 1926
125 Ga0207712_11542689 3300025961 Bacteria 595
126 Ga0207668_12030457 3300025972 Bacteria 518
127 Ga0207640_10401306 3300025981 Bacteria 1117
128 Ga0207640_10699039 3300025981 Bacteria 869
129 Ga0207677_10008227 3300026023 Bacteria 5813
130 Ga0207677_10125594 3300026023 Bacteria 1938
131 Ga0207703_10038838 3300026035 Bacteria 3802
132 Ga0207703_10831185 3300026035 Bacteria 883
133 Ga0207639_11680874 3300026041 Bacteria 595
134 Ga0207678_10085116 3300026067 Bacteria 2703
135 Ga0207678_10348721 3300026067 Bacteria 1276
136 Ga0207678_10913956 3300026067 Bacteria 776
137 Ga0207678_11238241 3300026067 Bacteria 661
138 Ga0207708_10080138 3300026075 Bacteria 2509
139 Ga0207702_11050991 3300026078 Bacteria 808
140 Ga0207702_11074818 3300026078 Bacteria 798
141 Ga0207676_10283203 3300026095 Bacteria 1506
142 Ga0207674_10098436 3300026116 Bacteria 2908
143 Ga0207675_100188807 3300026118 Bacteria 1976
144 Ga0207683_10401350 3300026121 Bacteria 1261
145 Ga0207698_10047423 3300026142 Bacteria 3254
146 Ga0207698_10304064 3300026142 Bacteria 1486
147 Ga0207428_10059698 3300027907 Bacteria 3023
148 Ga0268265_10011234 3300028380 Bacteria 6054
149 Ga0314311_1046190 3300030733 Bacteria 681
150 Ga0316183_1158276 3300030742 Bacteria 902
151 Ga0307408_100959277 3300031548 Bacteria 786
152 Ga0307408_101104412 3300031548 Bacteria 736
153 Ga0307508_10509282 3300031616 Bacteria 799
154 Ga0307410_10318977 3300031852 Bacteria 1232
155 Ga0307409_102212816 3300031995 Bacteria 579
156 Ga0307415_100344551 3300032126 Bacteria 1252
157 Ga0307507_10296608 3300033179 Bacteria 995
158 Ga0307510_10598044 3300033180 Bacteria 554
159 Ga0373926_0006779 3300035083 Bacteria 3806
160 Ga0373944_0005421 3300035089 Bacteria 3359
161 Ga0373923_0098875 3300035111 Bacteria 1284
162 Ga0373936_0004550 3300035113 Bacteria 5251
163 Ga0373945_0000539 3300035116 Bacteria 10787
164 Ga0373943_0029488 3300035170 Bacteria 2592
165 Ga0373946_0001438 3300035171 Bacteria 8279
166 Ga0373955_0027433 3300035172 Bacteria 2944
167 Ga0373935_0007489 3300035692 Bacteria 6535
168 Ga0373935_0847702 3300035692 Bacteria 676
169 Ga0373927_0069959 3300035695 Bacteria 2271
170 Ga0373933_0267022 3300035724 Bacteria 1104
171 Ga0373947_0009724 3300035725 Bacteria 5518
172 Ga0373937_0100895 3300036401 Bacteria 2679
173 Ga0373925_0100143 3300037068 Bacteria 2226
174 Ga0373925_0779818 3300037068 Bacteria 788
175 Ga0395899_0558220 3300037312 Bacteria 735
176 Ga0395900_0024486 3300037418 Bacteria 6182
177 Ga0395898_0424708 3300037466 Bacteria 1267
178 Ga0395898_0973646 3300037466 Bacteria 785
179 Ga0436364_0223731 3300037853 Bacteria 59268
180 Ga0395901_0384190 3300038443 Bacteria 1445
181 Ga0395901_1343486 3300038443 Bacteria 675
182 Ga0436365_1894572 3300039437 Bacteria 583
183 Ga0451853_0972467 3300041512 Bacteria 554
184 Ga0439432_100551 3300042006 Bacteria 865
185 Ga0439449_0018084 3300042007 Bacteria 2646
186 Ga0439449_0086331 3300042007 Bacteria 1158
187 Ga0439434_0063618 3300042435 Bacteria 1156
188 Ga0466973_0337511 3300044659 Bacteria 979
189 Ga0466961_0083207 3300044693 Bacteria 2024
190 Ga0466963_0109031 3300044694 Bacteria 1899
191 Ga0466970_0040316 3300044765 Bacteria 2480
192 Ga0466957_0275316 3300044842 Bacteria 1125
193 Ga0466960_0069051 3300044901 Bacteria 1755
194 Ga0466959_0328251 3300045049 Bacteria 1045
195 Ga0466958_0204174 3300045836 Bacteria 1258
196 Ga0466967_0739499 3300045976 Bacteria 975
197 Ga0495603_0059614 3300046455 Bacteria 2256
198 Ga0495629_0004003 3300046459 Bacteria 11073
199 Ga0495629_0241472 3300046459 Bacteria 1244
200 Ga0495641_0014785 3300046461 Bacteria 4207
201 Ga0495653_0075724 3300046463 Bacteria 2504
202 Ga0495580_0019511 3300046472 Bacteria 5038
203 Ga0495582_0001144 3300046473 Bacteria 14893
204 Ga0495639_0007842 3300046475 Bacteria 4589
205 Ga0495662_0001682 3300046476 Bacteria 11037
206 Ga0495594_0630009 3300046499 Bacteria 607
207 Ga0495630_0036419 3300046517 Bacteria 3678
208 Ga0495666_0006407 3300046526 Bacteria 5929
209 Ga0495665_0008208 3300046531 Bacteria 5663
210 Ga0495665_0033081 3300046531 Bacteria 2765
211 Ga0495640_0003563 3300046533 Bacteria 12506
212 Ga0495586_0008054 3300046535 Bacteria 5618
213 Ga0495586_0253559 3300046535 Unclassified 1004
214 Ga0495634_0047785 3300046642 Bacteria 2882
215 Ga0495634_0372512 3300046642 Bacteria 852
216 Ga0495635_0008521 3300046663 Bacteria 7161
217 Ga0495588_0004197 3300046674 Bacteria 6352
218 Ga0495588_0477466 3300046674 Bacteria 654
219 Ga0495647_0001844 3300046681 Bacteria 6570
220 Ga0495647_0407572 3300046681 Bacteria 625
221 Ga0495658_0002386 3300046683 Bacteria 9471
222 Ga0495658_0353455 3300046683 Bacteria 934
223 Ga0495613_0019339 3300046689 Bacteria 5077
224 Ga0495624_0014289 3300046690 Bacteria 5391
225 Ga0495624_0540048 3300046690 Unclassified 696
226 Ga0495670_0408643 3300046691 Bacteria 734
227 Ga0495600_0578184 3300046809 Unclassified 684
228 Ga0495581_0000675 3300047315 Bacteria 17878
229 Ga0495674_0001371 3300047319 Bacteria 23750
230 Ga0495674_0936419 3300047319 Bacteria 667
231 Ga0495676_0086712 3300047321 Bacteria 2354
232 Ga0495676_0216795 3300047321 Bacteria 1321
233 Ga0495676_0444129 3300047321 Bacteria 856
234 Ga0495676_0467446 3300047321 Bacteria 831
235 Ga0495680_0008973 3300047322 Bacteria 9036
236 Ga0495680_0903943 3300047322 Bacteria 570
237 Ga0495684_0071824 3300047471 Bacteria 2630
238 Ga0495686_0063098 3300047472 Bacteria 2297
239 Ga0495593_0000249 3300047673 Bacteria 29246
240 Ga0495614_0014801 3300048089 Bacteria 3411
241 Ga0495614_0221573 3300048089 Bacteria 860
242 Ga0496100_0114511 3300048903 Bacteria 1879
243 Ga0496100_0260455 3300048903 Bacteria 1286
244 Ga0496101_0439916 3300048904 Bacteria 1028
245 Ga0496101_0537557 3300048904 Bacteria 924
246 Ga0496102_0300174 3300048905 Bacteria 1514
247 Ga0496104_0188782 3300048907 Bacteria 1972
248 Ga0496104_0767121 3300048907 Bacteria 871
249 Ga0496105_0381057 3300048908 Bacteria 1122
250 Ga0496106_0538756 3300048909 Bacteria 937
251 Ga0496106_0711935 3300048909 Bacteria 800
252 Ga0496107_0649399 3300048910 Bacteria 778
253 Ga0496108_0044215 3300048911 Bacteria 3719
254 Ga0496108_0099335 3300048911 Bacteria 2481
255 Ga0496108_1156596 3300048911 Bacteria 656
256 Ga0496109_0007718 3300048912 Bacteria 9116
257 Ga0496109_0650512 3300048912 Bacteria 991
258 Ga0496109_0802494 3300048912 Bacteria 879
259 Ga0496109_1023016 3300048912 Bacteria 764
260 Ga0496110_0265702 3300048913 Bacteria 1562
261 Ga0496111_0342409 3300048914 Bacteria 1107
262 Ga0496111_0773679 3300048914 Bacteria 696
263 Ga0496112_0687110 3300048915 Bacteria 952
264 Ga0496112_1614633 3300048915 Bacteria 562
265 Ga0496115_0472879 3300048918 Bacteria 1010
266 Ga0501031_0228023 3300049568 Bacteria 1212
267 Ga0501032_0036092 3300049569 Bacteria 3376
268 Ga0501032_0047981 3300049569 Bacteria 2883
269 Ga0501033_0462355 3300049570 Bacteria 880
270 Ga0501034_0337809 3300049571 Bacteria 1437
271 Ga0501036_0042166 3300049572 Bacteria 3864
272 Ga0501036_0402729 3300049572 Bacteria 1141
273 Ga0501036_1290224 3300049572 Bacteria 594
274 Ga0501037_0141464 3300049573 Bacteria 1721
275 Ga0501039_0110529 3300049575 Bacteria 2148
276 Ga0501039_1253146 3300049575 Bacteria 573
277 Ga0501040_0139121 3300049576 Bacteria 1709
278 Ga0501041_0035109 3300049577 Bacteria 3037
279 Ga0501042_0036918 3300049578 Bacteria 3466
280 Ga0501043_0005429 3300049579 Bacteria 10298
281 Ga0501043_0292101 3300049579 Bacteria 1247
282 Ga0501046_0263511 3300049580 Bacteria 1265
283 Ga0501046_0404046 3300049580 Bacteria 986
284 Ga0501047_0001640 3300049581 Bacteria 21832
285 Ga0501048_0065858 3300049582 Bacteria 2561
286 Ga0501048_0081393 3300049582 Bacteria 2284
287 Ga0501068_0046530 3300049584 Bacteria 2616
288 Ga0501069_0025093 3300049585 Bacteria 3255
289 Ga0501071_0059610 3300049587 Bacteria 2761
290 Ga0501071_1283631 3300049587 Bacteria 566
291 Ga0501074_0248291 3300049590 Bacteria 1265
292 Ga0501075_0041531 3300049591 Bacteria 3446
293 Ga0501075_0929658 3300049591 Bacteria 661
294 Ga0501076_0073819 3300049592 Bacteria 2732
295 Ga0501076_0323202 3300049592 Bacteria 1265
296 Ga0501077_0116712 3300049593 Bacteria 1691
297 Ga0501079_0109175 3300049741 Bacteria 2148
298 Ga0501080_0356778 3300049742 Bacteria 1319
299 Ga0501081_0227531 3300049743 Bacteria 1357
300 Ga0501081_0576677 3300049743 Bacteria 841
301 Ga0501083_0245786 3300049744 Bacteria 1165
302 Ga0501035_0024903 3300049822 Bacteria 5487
303 Ga0501035_0087585 3300049822 Bacteria 2744
304 Ga0501044_0113343 3300049823 Bacteria 2719
305 nmdc:mga08y16_163124_c1 3300050511 Bacteria 2315
306 nmdc:mga08y16_9702_c1 3300050511 Bacteria 10108
307 Ga0495619_0012887 3300053085 Bacteria 5265
308 Ga0501084_0319906 3300054114 Bacteria 1310
309 Ga0501082_0366627 3300060353 Bacteria 1256
310 Ga0501082_0471644 3300060353 Bacteria 1097
311 Ga0466962_0080857 3300061719 Bacteria 1554
312 Ga0530510_0061071 3300061734 Bacteria 2728
313 2643730132 2643221541 Bacteria 5498788
314 2643889552 2643221576 Bacteria 5214352
315 2643958608 2643221590 Bacteria 5214697
316 2644045619 2643221606 Bacteria 5588032
317 2644392756 2643221671 Bacteria 5496681
318 2793980209 2791355406 Bacteria 11364898
319 2995464035 2995463766 Bacteria 8577691
320 8047902507 8047893842 Bacteria 11723082
321 8048370304 8048369669 Bacteria 11666822
322 8048389118 8048379754 Bacteria 11877923
323 8054007781 8054002106 Bacteria 7987183
324 Ga0070659_100588841
325 JGI25406J46586_10005838
326 Ga0070658_11618678
327 Ga0070683_100001933
328 Ga0070670_100768660
329 Ga0068869_100062109
330 Ga0070682_101686490
331 Ga0070682_102040040
332 Ga0068868_100010491
333 Ga0068868_102308961
334 Ga0070660_100128305
335 Ga0070660_101257584
336 Ga0070660_101954668
337 Ga0070687_100032230
338 Ga0070692_10008086
339 Ga0070668_100670787
340 Ga0070675_100001126
341 Ga0070675_100753458
342 Ga0070674_100078309
343 Ga0070659_100048803
344 Ga0070659_102139008
345 Ga0070701_10639790
346 Ga0070711_100074897
347 Ga0070705_101773122
348 Ga0070700_100042448
349 Ga0070708_100123894
350 Ga0070708_101487118
351 Ga0070663_100575626
352 Ga0070678_100886623
353 Ga0070678_100923987
354 Ga0070685_10111582
355 Ga0070707_100215466
356 Ga0070698_100001100
357 Ga0070699_101456150
358 Ga0070684_100010916
359 Ga0070684_101573191
360 Ga0070684_101675562
361 Ga0070697_101401315
362 Ga0068853_100248332
363 Ga0068853_101186173
364 Ga0070672_100146128
365 Ga0070686_100907592
366 Ga0070696_100692440
367 Ga0070664_100000864
368 Ga0068854_100386164
369 Ga0068854_100526672
370 Ga0068856_100614188
371 Ga0068856_101272834
372 Ga0068852_100743005
373 Ga0068852_102205386
374 Ga0068859_100296800
375 Ga0068866_10124672
376 Ga0068861_100476087
377 Ga0068861_100507612
378 Ga0068861_101542698
379 Ga0068861_102149904
380 Ga0068851_10253310
381 Ga0068870_11439423
382 Ga0068863_101937884
383 Ga0068858_100099605
384 Ga0068858_100504504
385 Ga0068858_102305999
386 Ga0068862_100026942
387 Ga0068862_100644496
388 Ga0081539_10000607
389 Ga0070715_10020551
390 Ga0070716_100102876
391 Ga0070712_100030682
392 Ga0075434_101778893
393 Ga0097620_100296793
394 Ga0105240_10049339
395 Ga0111539_10229735
396 Ga0105245_13011901
397 Ga0105243_10294455
398 Ga0105243_12222153
399 Ga0105242_13120239
400 Ga0105237_10574968
401 Ga0105238_10265627
402 Ga0105238_11268757
403 Ga0105238_11441515
404 Ga0105249_10216852
405 Ga0105249_11872319
406 Ga0105239_10132324
407 Ga0105239_10200670
408 Ga0163162_10697318
409 Ga0157375_10435482
410 Ga0157375_10799014
411 Ga0157375_10806878
412 Ga0157380_10069625
413 Ga0157380_12027687
414 Ga0157377_10426322
415 Ga0157379_11909109
416 Ga0213875_10002472
417 Ga0207656_10067722
418 Ga0207692_10015175
419 Ga0207642_10392540
420 Ga0207688_10036237
421 Ga0207685_10191487
422 Ga0207695_10014905
423 Ga0207693_10003664
424 Ga0207693_10393905
425 Ga0207662_10070256
426 Ga0207649_10067219
427 Ga0207652_11009522
428 Ga0207646_10071467
429 Ga0207694_10154541
430 Ga0207650_10902884
431 Ga0207659_10014215
432 Ga0207659_10791425
433 Ga0207690_10078618
434 Ga0207690_11118308
435 Ga0207690_11741402
436 Ga0207706_11711833
437 Ga0207709_10318627
438 Ga0207669_10069890
439 Ga0207669_10800229
440 Ga0207665_10114004
441 Ga0207665_10956158
442 Ga0207691_10204401
443 Ga0207689_10052490
444 Ga0207661_10006900
445 Ga0207661_10491716
446 Ga0207679_10002051
447 Ga0207712_10128671
448 Ga0207712_11542689
449 Ga0207668_12030457
450 Ga0207640_10401306
451 Ga0207640_10699039
452 Ga0207677_10008227
453 Ga0207677_10125594
454 Ga0207703_10038838
455 Ga0207703_10831185
456 Ga0207639_11680874
457 Ga0207678_10085116
458 Ga0207678_10348721
459 Ga0207678_10913956
460 Ga0207678_11238241
461 Ga0207708_10080138
462 Ga0207702_11050991
463 Ga0207702_11074818
464 Ga0207676_10283203
465 Ga0207674_10098436
466 Ga0207675_100188807
467 Ga0207683_10401350
468 Ga0207698_10047423
469 Ga0207698_10304064
470 Ga0207428_10059698
471 Ga0268265_10011234
472 Ga0314311_1046190
473 Ga0316183_1158276
474 Ga0307408_100959277
475 Ga0307408_101104412
476 Ga0307508_10509282
477 Ga0307410_10318977
478 Ga0307409_102212816
479 Ga0307415_100344551
480 Ga0307507_10296608
481 Ga0307510_10598044
482 Ga0373926_0006779
483 Ga0373944_0005421
484 Ga0373923_0098875
485 Ga0373936_0004550
486 Ga0373945_0000539
487 Ga0373943_0029488
488 Ga0373946_0001438
489 Ga0373955_0027433
490 Ga0373935_0007489
491 Ga0373935_0847702
492 Ga0373927_0069959
493 Ga0373933_0267022
494 Ga0373947_0009724
495 Ga0373937_0100895
496 Ga0373925_0100143
497 Ga0373925_0779818
498 Ga0395899_0558220
499 Ga0395900_0024486
500 Ga0395898_0424708
501 Ga0395898_0973646
502 Ga0436364_0223731
503 Ga0395901_0384190
504 Ga0395901_1343486
505 Ga0436365_1894572
506 Ga0451853_0972467
507 Ga0439432_100551
508 Ga0439449_0018084
509 Ga0439449_0086331
510 Ga0439434_0063618
511 Ga0466973_0337511
512 Ga0466961_0083207
513 Ga0466963_0109031
514 Ga0466970_0040316
515 Ga0466957_0275316
516 Ga0466960_0069051
517 Ga0466959_0328251
518 Ga0466958_0204174
519 Ga0466967_0739499
520 Ga0495603_0059614
521 Ga0495629_0004003
522 Ga0495629_0241472
523 Ga0495641_0014785
524 Ga0495653_0075724
525 Ga0495580_0019511
526 Ga0495582_0001144
527 Ga0495639_0007842
528 Ga0495662_0001682
529 Ga0495594_0630009
530 Ga0495630_0036419
531 Ga0495666_0006407
532 Ga0495665_0008208
533 Ga0495665_0033081
534 Ga0495640_0003563
535 Ga0495586_0008054
536 Ga0495586_0253559
537 Ga0495634_0047785
538 Ga0495634_0372512
539 Ga0495635_0008521
540 Ga0495588_0004197
541 Ga0495588_0477466
542 Ga0495647_0001844
543 Ga0495647_0407572
544 Ga0495658_0002386
545 Ga0495658_0353455
546 Ga0495613_0019339
547 Ga0495624_0014289
548 Ga0495624_0540048
549 Ga0495670_0408643
550 Ga0495600_0578184
551 Ga0495581_0000675
552 Ga0495674_0001371
553 Ga0495674_0936419
554 Ga0495676_0086712
555 Ga0495676_0216795
556 Ga0495676_0444129
557 Ga0495676_0467446
558 Ga0495680_0008973
559 Ga0495680_0903943
560 Ga0495684_0071824
561 Ga0495686_0063098
562 Ga0495593_0000249
563 Ga0495614_0014801
564 Ga0495614_0221573
565 Ga0496100_0114511
566 Ga0496100_0260455
567 Ga0496101_0439916
568 Ga0496101_0537557
569 Ga0496102_0300174
570 Ga0496104_0188782
571 Ga0496104_0767121
572 Ga0496105_0381057
573 Ga0496106_0538756
574 Ga0496106_0711935
575 Ga0496107_0649399
576 Ga0496108_0044215
577 Ga0496108_0099335
578 Ga0496108_1156596
579 Ga0496109_0007718
580 Ga0496109_0650512
581 Ga0496109_0802494
582 Ga0496109_1023016
583 Ga0496110_0265702
584 Ga0496111_0342409
585 Ga0496111_0773679
586 Ga0496112_0687110
587 Ga0496112_1614633
588 Ga0496115_0472879
589 Ga0501031_0228023
590 Ga0501032_0036092
591 Ga0501032_0047981
592 Ga0501033_0462355
593 Ga0501034_0337809
594 Ga0501036_0042166
595 Ga0501036_0402729
596 Ga0501036_1290224
597 Ga0501037_0141464
598 Ga0501039_0110529
599 Ga0501039_1253146
600 Ga0501040_0139121
601 Ga0501041_0035109
602 Ga0501042_0036918
603 Ga0501043_0005429
604 Ga0501043_0292101
605 Ga0501046_0263511
606 Ga0501046_0404046
607 Ga0501047_0001640
608 Ga0501048_0065858
609 Ga0501048_0081393
610 Ga0501068_0046530
611 Ga0501069_0025093
612 Ga0501071_0059610
613 Ga0501071_1283631
614 Ga0501074_0248291
615 Ga0501075_0041531
616 Ga0501075_0929658
617 Ga0501076_0073819
618 Ga0501076_0323202
619 Ga0501077_0116712
620 Ga0501079_0109175
621 Ga0501080_0356778
622 Ga0501081_0227531
623 Ga0501081_0576677
624 Ga0501083_0245786
625 Ga0501035_0024903
626 Ga0501035_0087585
627 Ga0501044_0113343
628 nmdc:mga08y16_163124_c1
629 nmdc:mga08y16_9702_c1
630 Ga0495619_0012887
631 Ga0501084_0319906
632 Ga0501082_0366627
633 Ga0501082_0471644
634 Ga0466962_0080857
635 Ga0530510_0061071
636 2643730132
637 2643889552
638 2643958608
639 2644045619
640 2644392756
641 2793980209
642 2995464035
643 8047902507
644 8048370304
645 8048389118
646 8054007781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04267

SoxD

Sarcosine oxidase, delta subunit family

3

84

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gah-assembly1.cif.gz_D heterotetrameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution 0.8594 1 87
3ad9-assembly1.cif.gz_D heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 sarcosine-reduced form 0.8579 1 87
2gah-assembly1.cif.gz_D heterotetrameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution 0.8171 1 87
3ad9-assembly1.cif.gz_D heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 sarcosine-reduced form 0.8157 1 87
6l8a-assembly2.cif.gz_D tetrathionate hydrolase from acidithiobacillus ferrooxidans 0.7459 51 82
ID Description Score Start End Superfamily
2gagD00 Alpha Beta;2-Layer Sandwich;Folate-binding fold;Folate-binding superfamily 0.8568 1 87 3.30.2270.10
2gagD00 Alpha Beta;2-Layer Sandwich;Folate-binding fold;Folate-binding superfamily 0.8147 1 87 3.30.2270.10
af_Q9VIU8_998_1217_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7432 51 85 2.130.10.10
af_P91341_267_464_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7352 50 82 2.130.10.10
af_A0A0P0VQD8_25_138_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7336 51 84 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1N7RQW8-F1-model_v4 Putative sarcosine oxidase (Delta subunit) oxidoreductase protein (EC 1.5.3.1) 0.8811 1 82 GO:0008115
GO:0046653
AF-A0A843REC8-F1-model_v4 Sarcosine oxidase subunit delta family protein 0.8755 1 87 GO:0008115
GO:0046653
AF-A0A5M7C0P7-F1-model_v4 Sarcosine oxidase subunit delta 0.8729 1 87 GO:0008115
GO:0046653
AF-A0A4P8IR40-F1-model_v4 Sarcosine oxidase subunit delta 0.8714 1 83 GO:0008115
GO:0046653
AF-A0A839SNC5-F1-model_v4 Heterotetrameric sarcosine oxidase delta subunit 0.8713 1 89 GO:0008115
GO:0046653

Map