F406705

General Info

Members Datasets Scaffolds Average Seq Length
322 202 644 153

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2912757875|2912759755
Length 186
Sequence GTARKAPAPKGIPVGSQAPDFALKDNHGRTVRLFDLRGGQGADGGVVGGPDGGVDGAQDSDGDGRNVVLVFYPFAFTGVCTGELHALRDQLPSFVNDDTQLLAVSTDSIHTLRIFAEQEDLEFPLLSDFWPHGETSRAYGIFDEEKGCALRGTFVIDKRGVVRWSVVNGLPDARDLDEYVKALAAL

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
6 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
7 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
11 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
14 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
15 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
23 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
26 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
27 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
39 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
43 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
44 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
45 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
46 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
47 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
48 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
49 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
50 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
51 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
54 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
55 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
56 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
57 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
58 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
59 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
60 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
61 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
62 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
63 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
66 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
67 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
68 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
91 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
92 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
137 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
149 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
180 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
181 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
182 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
185 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
186 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
187 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
188 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
189 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
190 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
191 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
192 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
193 2867369537 Streptomyces sp. Z26 Isolate Unclassified
194 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
195 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
196 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
197 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
198 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
199 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
200 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
201 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
202 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.48
Metatranscriptomes 0.93
Isolates 5.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.73
Nodule 0
Rhizoplane 0.93
Rhizosphere 86.34
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10612976 3300005293 Bacteria 695
2 Ga0070709_10364942 3300005434 Bacteria 1070
3 Ga0070714_101153670 3300005435 Bacteria 756
4 Ga0070711_100670490 3300005439 Bacteria 871
5 Ga0070698_101390278 3300005471 Bacteria 653
6 Ga0070697_100129213 3300005536 Bacteria 2118
7 Ga0070704_100042620 3300005549 Bacteria 3141
8 Ga0068856_100358599 3300005614 Bacteria 1477
9 Ga0068852_101066948 3300005616 Bacteria 827
10 Ga0068862_101722565 3300005844 Bacteria 635
11 Ga0081540_1000679 3300005983 Bacteria 31898
12 Ga0081540_1030404 3300005983 Bacteria 2992
13 Ga0075363_100034379 3300006048 Bacteria 2645
14 Ga0070716_100330816 3300006173 Bacteria 1071
15 Ga0075370_10061449 3300006353 Bacteria 2140
16 Ga0075370_10181975 3300006353 Bacteria 1237
17 Ga0105032_102869 3300009979 Bacteria 1520
18 Ga0105239_10050099 3300010375 Bacteria 4581
19 Ga0157371_10260720 3300013102 Bacteria 1250
20 Ga0157370_10258290 3300013104 Bacteria 1610
21 Ga0157369_10769946 3300013105 Bacteria 990
22 Ga0157369_10982682 3300013105 Bacteria 864
23 Ga0163162_11179832 3300013306 Bacteria 869
24 Ga0157372_10331836 3300013307 Bacteria 1771
25 Ga0157372_10972755 3300013307 Bacteria 984
26 Ga0157376_10605610 3300014969 Bacteria 1091
27 Ga0206354_11612997 3300020081 Bacteria 1219
28 Ga0206353_11777297 3300020082 Bacteria 2033
29 Ga0213875_10068923 3300021388 Bacteria 1652
30 Ga0209758_1005060 3300025297 Bacteria 10460
31 Ga0207426_1002736 3300025302 Bacteria 10695
32 Ga0207426_1027356 3300025302 Bacteria 1900
33 Ga0207664_10000422 3300025929 Bacteria 30261
34 Ga0207664_10315916 3300025929 Bacteria 1377
35 Ga0207640_10285065 3300025981 Bacteria 1299
36 Ga0207702_10038994 3300026078 Bacteria 3980
37 Ga0307517_10001523 3300028786 Bacteria 38580
38 Ga0307515_10030929 3300028794 Bacteria 8959
39 Ga0307511_10052075 3300030521 Bacteria 3268
40 Ga0307511_10241489 3300030521 Bacteria 880
41 Ga0307509_10120765 3300031507 Bacteria 2598
42 Ga0307509_10502739 3300031507 Bacteria 896
43 Ga0307508_10004782 3300031616 Bacteria 13075
44 Ga0307508_10140910 3300031616 Bacteria 2015
45 Ga0307514_10062792 3300031649 Bacteria 2823
46 Ga0307516_10068674 3300031730 Bacteria 3412
47 Ga0307516_10361806 3300031730 Bacteria 1115
48 Ga0307405_10145185 3300031731 Bacteria 1661
49 Ga0307518_10217305 3300031838 Bacteria 1251
50 Ga0307518_10315080 3300031838 Bacteria 939
51 Ga0307409_101775949 3300031995 Bacteria 646
52 Ga0307416_100427125 3300032002 Bacteria 1371
53 Ga0307416_101631256 3300032002 Bacteria 750
54 Ga0307507_10097007 3300033179 Bacteria 2489
55 Ga0307507_10353371 3300033179 Bacteria 862
56 Ga0307510_10149401 3300033180 Bacteria 1960
57 Ga0373954_0634989 3300035118 Bacteria 529
58 Ga0373933_0523719 3300035724 Bacteria 777
59 Ga0436364_0476110 3300037853 Bacteria 5740
60 Ga0395901_1293714 3300038443 Bacteria 691
61 Ga0436363_1015120 3300039450 Bacteria 1371
62 Ga0439438_070183 3300041405 Bacteria 868
63 Ga0439461_0000881 3300041410 Bacteria 4453
64 Ga0451847_0851810 3300041503 Bacteria 1201
65 Ga0451853_1914846 3300041512 Bacteria 1152
66 Ga0439442_071297 3300042002 Bacteria 740
67 Ga0439457_083465 3300042014 Bacteria 735
68 Ga0450894_001249 3300042131 Bacteria 3728
69 Ga0450898_000118 3300042134 Bacteria 7563
70 Ga0450899_003111 3300042135 Bacteria 1786
71 Ga0439446_0000145 3300042156 Bacteria 12387
72 Ga0450908_061585 3300042184 Bacteria 659
73 Ga0439434_0065619 3300042435 Bacteria 1139
74 Ga0466972_0013383 3300044658 Bacteria 4120
75 Ga0466972_0074684 3300044658 Bacteria 1615
76 Ga0466965_0002548 3300044683 Bacteria 7785
77 Ga0466965_0104920 3300044683 Bacteria 1448
78 Ga0466965_0264635 3300044683 Bacteria 925
79 Ga0466965_0588576 3300044683 Bacteria 631
80 Ga0466966_0000262 3300044684 Bacteria 35143
81 Ga0466966_0033948 3300044684 Bacteria 3302
82 Ga0466966_0174270 3300044684 Bacteria 1306
83 Ga0466966_0664525 3300044684 Bacteria 628
84 Ga0466961_0000547 3300044693 Bacteria 23953
85 Ga0466961_0176672 3300044693 Bacteria 1326
86 Ga0466961_0362009 3300044693 Bacteria 882
87 Ga0466963_0000176 3300044694 Bacteria 26457
88 Ga0466963_0185430 3300044694 Bacteria 1453
89 Ga0466963_0486067 3300044694 Bacteria 872
90 Ga0466964_0092723 3300044706 Bacteria 1317
91 Ga0466964_0491828 3300044706 Bacteria 657
92 Ga0466971_0000306 3300044719 Bacteria 18885
93 Ga0466971_0031620 3300044719 Bacteria 2370
94 Ga0466968_0096057 3300044735 Bacteria 1319
95 Ga0466970_0000912 3300044765 Bacteria 14276
96 Ga0466970_0817688 3300044765 Bacteria 546
97 Ga0466957_0000275 3300044842 Bacteria 24997
98 Ga0466957_0109945 3300044842 Bacteria 1747
99 Ga0466957_0204337 3300044842 Bacteria 1299
100 Ga0466960_0233777 3300044901 Bacteria 1015
101 Ga0466960_0606540 3300044901 Bacteria 650
102 Ga0466959_0000453 3300045049 Bacteria 23862
103 Ga0466959_0013180 3300045049 Bacteria 5989
104 Ga0466959_0053226 3300045049 Bacteria 2960
105 Ga0466958_0010897 3300045836 Bacteria 5105
106 Ga0466967_0011426 3300045976 Bacteria 6723
107 Ga0466967_0034328 3300045976 Bacteria 4304
108 Ga0466967_0502639 3300045976 Bacteria 1190
109 Ga0466967_1653785 3300045976 Bacteria 638
110 Ga0466967_1804140 3300045976 Bacteria 609
111 Ga0466967_1847604 3300045976 Bacteria 601
112 Ga0495627_190797 3300046453 Bacteria 566
113 Ga0495592_0099395 3300046454 Bacteria 2075
114 Ga0495603_0004164 3300046455 Bacteria 8620
115 Ga0495603_0007598 3300046455 Bacteria 6522
116 Ga0495603_0023923 3300046455 Bacteria 3694
117 Ga0495629_0024194 3300046459 Bacteria 4324
118 Ga0495629_0029076 3300046459 Bacteria 3922
119 Ga0495629_0096109 3300046459 Bacteria 2066
120 Ga0495638_0069358 3300046460 Bacteria 2161
121 Ga0495638_0151221 3300046460 Bacteria 1346
122 Ga0495638_0425330 3300046460 Bacteria 684
123 Ga0495641_0116750 3300046461 Bacteria 1190
124 Ga0495651_0020190 3300046462 Bacteria 5171
125 Ga0495651_0208340 3300046462 Bacteria 1362
126 Ga0495580_0224123 3300046472 Bacteria 1291
127 Ga0495582_0510324 3300046473 Bacteria 695
128 Ga0495605_0027984 3300046474 Bacteria 2914
129 Ga0495662_0286634 3300046476 Bacteria 810
130 Ga0495664_0048114 3300046477 Bacteria 2531
131 Ga0495584_0105762 3300046491 Bacteria 1423
132 Ga0495585_0091921 3300046492 Bacteria 1633
133 Ga0495594_0019831 3300046499 Bacteria 3576
134 Ga0495594_0041613 3300046499 Bacteria 2515
135 Ga0495596_0034571 3300046500 Bacteria 2006
136 Ga0495607_0056768 3300046501 Bacteria 2246
137 Ga0495583_0031904 3300046506 Bacteria 2547
138 Ga0495583_0089729 3300046506 Bacteria 1325
139 Ga0495583_0183895 3300046506 Bacteria 854
140 Ga0495606_0005299 3300046507 Bacteria 12418
141 Ga0495608_0063578 3300046511 Bacteria 2421
142 Ga0495610_0081363 3300046512 Bacteria 1487
143 Ga0495616_0010640 3300046513 Bacteria 5315
144 Ga0495618_0194338 3300046514 Bacteria 1285
145 Ga0495618_0633272 3300046514 Bacteria 634
146 Ga0495620_0337788 3300046515 Bacteria 571
147 Ga0495630_0237386 3300046517 Bacteria 1393
148 Ga0495631_0011731 3300046518 Bacteria 4299
149 Ga0495631_0085277 3300046518 Bacteria 1361
150 Ga0495637_0021207 3300046520 Bacteria 2981
151 Ga0495648_0061230 3300046524 Bacteria 2236
152 Ga0495666_0060468 3300046526 Bacteria 1810
153 Ga0495652_0083195 3300046529 Bacteria 2635
154 Ga0495640_0033607 3300046533 Bacteria 3642
155 Ga0495640_0225094 3300046533 Bacteria 1181
156 Ga0495586_0035300 3300046535 Bacteria 2686
157 Ga0495609_0022247 3300046538 Bacteria 2921
158 Ga0495645_0770774 3300046543 Bacteria 579
159 Ga0495622_0005269 3300046557 Bacteria 5996
160 Ga0495622_0161835 3300046557 Bacteria 1009
161 Ga0495633_0090125 3300046558 Bacteria 1425
162 Ga0495633_0170905 3300046558 Bacteria 1002
163 Ga0495667_0012568 3300046559 Bacteria 5741
164 Ga0495667_0131055 3300046559 Bacteria 1617
165 Ga0495667_0215243 3300046559 Bacteria 1227
166 Ga0495634_0046687 3300046642 Bacteria 2921
167 Ga0495625_0160654 3300046660 Bacteria 1505
168 Ga0495635_0047032 3300046663 Bacteria 2976
169 Ga0495661_0122375 3300046665 Bacteria 1435
170 Ga0495588_0014005 3300046674 Bacteria 3832
171 Ga0495657_0002332 3300046675 Bacteria 15987
172 Ga0495657_0080338 3300046675 Bacteria 2110
173 Ga0495599_0083563 3300046678 Bacteria 1994
174 Ga0495623_0015514 3300046679 Bacteria 4925
175 Ga0495623_0058000 3300046679 Bacteria 2435
176 Ga0495646_0135940 3300046680 Bacteria 1379
177 Ga0495613_0000689 3300046689 Bacteria 26707
178 Ga0495613_0150776 3300046689 Bacteria 1658
179 Ga0495613_0221475 3300046689 Bacteria 1328
180 Ga0495613_0665079 3300046689 Bacteria 688
181 Ga0495624_0056594 3300046690 Bacteria 2467
182 Ga0495671_0285680 3300046692 Bacteria 794
183 Ga0495649_0151178 3300046694 Bacteria 1219
184 Ga0495649_0396085 3300046694 Bacteria 693
185 Ga0495589_0023292 3300046794 Bacteria 3156
186 Ga0495600_0066827 3300046809 Bacteria 2350
187 Ga0495600_0080221 3300046809 Bacteria 2130
188 Ga0495581_0108784 3300047315 Bacteria 1611
189 Ga0495604_0019851 3300047317 Bacteria 5376
190 Ga0495604_0030719 3300047317 Bacteria 4265
191 Ga0495604_0279587 3300047317 Bacteria 1128
192 Ga0495604_0847417 3300047317 Bacteria 574
193 Ga0495636_0167824 3300047318 Bacteria 991
194 Ga0495674_0229234 3300047319 Bacteria 1533
195 Ga0495672_0080015 3300047320 Bacteria 1824
196 Ga0495676_0023083 3300047321 Bacteria 5403
197 Ga0495676_0025047 3300047321 Bacteria 5154
198 Ga0495676_0153278 3300047321 Bacteria 1637
199 Ga0495680_0001870 3300047322 Bacteria 22144
200 Ga0495680_0012565 3300047322 Bacteria 7444
201 Ga0495687_005687 3300047443 Bacteria 7865
202 Ga0495687_111503 3300047443 Bacteria 1004
203 Ga0495675_0030873 3300047444 Bacteria 3419
204 Ga0495677_0075538 3300047445 Bacteria 1259
205 Ga0495677_0082865 3300047445 Bacteria 1203
206 Ga0495685_016594 3300047447 Bacteria 2516
207 Ga0495673_0081028 3300047469 Bacteria 1345
208 Ga0495681_0079437 3300047470 Bacteria 1467
209 Ga0495684_0073682 3300047471 Bacteria 2594
210 Ga0495593_0036861 3300047673 Bacteria 2649
211 Ga0495602_0046924 3300048088 Bacteria 3897
212 Ga0495602_0306592 3300048088 Bacteria 1160
213 Ga0495614_0007730 3300048089 Bacteria 4777
214 Ga0495626_0018348 3300048091 Bacteria 3515
215 Ga0496104_0597535 3300048907 Bacteria 1014
216 Ga0496106_0195689 3300048909 Bacteria 1608
217 Ga0496108_0000096 3300048911 Bacteria 91615
218 Ga0495678_092572 3300049459 Bacteria 1061
219 Ga0495682_0081223 3300049460 Bacteria 1166
220 Ga0501031_0058652 3300049568 Bacteria 2508
221 Ga0501031_0090526 3300049568 Bacteria 1995
222 Ga0501031_0094733 3300049568 Bacteria 1948
223 Ga0501032_0007555 3300049569 Bacteria 7938
224 Ga0501032_0015456 3300049569 Bacteria 5383
225 Ga0501032_0036927 3300049569 Bacteria 3333
226 Ga0501033_0000315 3300049570 Bacteria 45917
227 Ga0501033_0019979 3300049570 Bacteria 5062
228 Ga0501033_0022971 3300049570 Bacteria 4701
229 Ga0501033_0051042 3300049570 Bacteria 3066
230 Ga0501034_0002686 3300049571 Bacteria 20954
231 Ga0501034_0013420 3300049571 Bacteria 8432
232 Ga0501034_0098143 3300049571 Bacteria 2925
233 Ga0501034_0110547 3300049571 Bacteria 2739
234 Ga0501034_0385808 3300049571 Bacteria 1325
235 Ga0501036_0000081 3300049572 Bacteria 58719
236 Ga0501036_0012967 3300049572 Bacteria 6919
237 Ga0501036_0057669 3300049572 Bacteria 3289
238 Ga0501036_0212438 3300049572 Bacteria 1625
239 Ga0501037_0016097 3300049573 Bacteria 5503
240 Ga0501037_0170421 3300049573 Bacteria 1547
241 Ga0501037_0856831 3300049573 Bacteria 597
242 Ga0501038_0003374 3300049574 Bacteria 14894
243 Ga0501038_0006805 3300049574 Bacteria 10560
244 Ga0501038_0022166 3300049574 Bacteria 5692
245 Ga0501038_0293785 3300049574 Bacteria 1276
246 Ga0501038_0301958 3300049574 Bacteria 1256
247 Ga0501039_0027509 3300049575 Bacteria 4372
248 Ga0501039_0094509 3300049575 Bacteria 2331
249 Ga0501039_0112859 3300049575 Bacteria 2125
250 Ga0501039_0624409 3300049575 Bacteria 844
251 Ga0501039_0915277 3300049575 Bacteria 682
252 Ga0501040_0368136 3300049576 Bacteria 1030
253 Ga0501042_0055951 3300049578 Bacteria 2815
254 Ga0501043_0010166 3300049579 Bacteria 7376
255 Ga0501043_0051417 3300049579 Bacteria 3237
256 Ga0501043_0060231 3300049579 Bacteria 2980
257 Ga0501043_0587987 3300049579 Bacteria 823
258 Ga0501046_0008006 3300049580 Bacteria 9237
259 Ga0501047_0018440 3300049581 Bacteria 6690
260 Ga0501047_0019313 3300049581 Bacteria 6538
261 Ga0501047_0044183 3300049581 Bacteria 4304
262 Ga0501047_0219981 3300049581 Bacteria 1755
263 Ga0501047_0273742 3300049581 Bacteria 1534
264 Ga0501048_0004349 3300049582 Bacteria 10780
265 Ga0501048_0853936 3300049582 Bacteria 654
266 Ga0501068_0469029 3300049584 Bacteria 815
267 Ga0501069_0473802 3300049585 Bacteria 745
268 Ga0501070_0056402 3300049586 Bacteria 3256
269 Ga0501070_0290224 3300049586 Bacteria 1333
270 Ga0501070_0564579 3300049586 Bacteria 910
271 Ga0501070_0845529 3300049586 Bacteria 716
272 Ga0501072_0494206 3300049588 Bacteria 968
273 Ga0501074_0000299 3300049590 Bacteria 28549
274 Ga0501080_0804368 3300049742 Bacteria 824
275 Ga0501282_000597 3300049778 Bacteria 4220
276 Ga0501035_0001623 3300049822 Bacteria 22760
277 Ga0501035_0010897 3300049822 Bacteria 8418
278 Ga0501035_0180701 3300049822 Bacteria 1817
279 Ga0501035_0212744 3300049822 Bacteria 1653
280 Ga0501044_0002369 3300049823 Bacteria 21458
281 Ga0501044_0003629 3300049823 Bacteria 17366
282 Ga0501044_0037386 3300049823 Bacteria 5074
283 Ga0501044_0050034 3300049823 Bacteria 4313
284 Ga0501044_0055231 3300049823 Bacteria 4079
285 Ga0501044_0496486 3300049823 Bacteria 1122
286 Ga0501045_0213018 3300049824 Bacteria 1439
287 Ga0501045_0467015 3300049824 Unclassified 938
288 Ga0501045_0753171 3300049824 Bacteria 718
289 nmdc:mga06z11_510852_c1 3300050494 Bacteria 728
290 nmdc:mga07m45_480147_c1 3300050496 Bacteria 720
291 Ga0495601_0275974 3300053077 Bacteria 1096
292 Ga0495595_0006994 3300053084 Bacteria 4608
293 Ga0495619_0034137 3300053085 Bacteria 3307
294 Ga0495619_0513395 3300053085 Bacteria 824
295 Ga0500650_0336683 3300053098 Bacteria 662
296 Ga0500560_041323 3300053107 Bacteria 1447
297 Ga0500573_0005772 3300053140 Bacteria 6640
298 Ga0500573_0153191 3300053140 Bacteria 1260
299 Ga0587072_074374 3300059643 Bacteria 723
300 Ga0466962_0001438 3300061719 Bacteria 11099
301 Ga0466962_0192995 3300061719 Bacteria 994
302 Ga0466962_0476847 3300061719 Bacteria 630
303 Ga0530510_0136821 3300061734 Bacteria 1804
304 Ga0530510_0504304 3300061734 Bacteria 917
305 2912759755 2912757875 Bacteria 7940295
306 2644436091 2643221678 Bacteria 9540101
307 2738889857 2738541308 Bacteria 7020677
308 2776369368 2775506925 Bacteria 7237746
309 2808840917 2808606359 Bacteria 9866990
310 2857712786 2857710386 Bacteria 3186771
311 2863068376 2863067949 Bacteria 8541735
312 2866555981 2866552031 Bacteria 5824618
313 2867370878 2867369537 Bacteria 6501581
314 2873156765 2873151551 Bacteria 8625867
315 2904769458 2904765812 Bacteria 5369154
316 2904773024 2904770941 Bacteria 5580202
317 2908814159 2908811453 Bacteria 5478616
318 2919422620 2919420072 Bacteria 5390363
319 2919435127 2919432681 Bacteria 5390474
320 2935393989 2935390628 Bacteria 7043367
321 8025531148 8025530807 Bacteria 8495698
322 8056210850 8056207758 Bacteria 8639239
323 Ga0065715_10612976
324 Ga0070709_10364942
325 Ga0070714_101153670
326 Ga0070711_100670490
327 Ga0070698_101390278
328 Ga0070697_100129213
329 Ga0070704_100042620
330 Ga0068856_100358599
331 Ga0068852_101066948
332 Ga0068862_101722565
333 Ga0081540_1000679
334 Ga0081540_1030404
335 Ga0075363_100034379
336 Ga0070716_100330816
337 Ga0075370_10061449
338 Ga0075370_10181975
339 Ga0105032_102869
340 Ga0105239_10050099
341 Ga0157371_10260720
342 Ga0157370_10258290
343 Ga0157369_10769946
344 Ga0157369_10982682
345 Ga0163162_11179832
346 Ga0157372_10331836
347 Ga0157372_10972755
348 Ga0157376_10605610
349 Ga0206354_11612997
350 Ga0206353_11777297
351 Ga0213875_10068923
352 Ga0209758_1005060
353 Ga0207426_1002736
354 Ga0207426_1027356
355 Ga0207664_10000422
356 Ga0207664_10315916
357 Ga0207640_10285065
358 Ga0207702_10038994
359 Ga0307517_10001523
360 Ga0307515_10030929
361 Ga0307511_10052075
362 Ga0307511_10241489
363 Ga0307509_10120765
364 Ga0307509_10502739
365 Ga0307508_10004782
366 Ga0307508_10140910
367 Ga0307514_10062792
368 Ga0307516_10068674
369 Ga0307516_10361806
370 Ga0307405_10145185
371 Ga0307518_10217305
372 Ga0307518_10315080
373 Ga0307409_101775949
374 Ga0307416_100427125
375 Ga0307416_101631256
376 Ga0307507_10097007
377 Ga0307507_10353371
378 Ga0307510_10149401
379 Ga0373954_0634989
380 Ga0373933_0523719
381 Ga0436364_0476110
382 Ga0395901_1293714
383 Ga0436363_1015120
384 Ga0439438_070183
385 Ga0439461_0000881
386 Ga0451847_0851810
387 Ga0451853_1914846
388 Ga0439442_071297
389 Ga0439457_083465
390 Ga0450894_001249
391 Ga0450898_000118
392 Ga0450899_003111
393 Ga0439446_0000145
394 Ga0450908_061585
395 Ga0439434_0065619
396 Ga0466972_0013383
397 Ga0466972_0074684
398 Ga0466965_0002548
399 Ga0466965_0104920
400 Ga0466965_0264635
401 Ga0466965_0588576
402 Ga0466966_0000262
403 Ga0466966_0033948
404 Ga0466966_0174270
405 Ga0466966_0664525
406 Ga0466961_0000547
407 Ga0466961_0176672
408 Ga0466961_0362009
409 Ga0466963_0000176
410 Ga0466963_0185430
411 Ga0466963_0486067
412 Ga0466964_0092723
413 Ga0466964_0491828
414 Ga0466971_0000306
415 Ga0466971_0031620
416 Ga0466968_0096057
417 Ga0466970_0000912
418 Ga0466970_0817688
419 Ga0466957_0000275
420 Ga0466957_0109945
421 Ga0466957_0204337
422 Ga0466960_0233777
423 Ga0466960_0606540
424 Ga0466959_0000453
425 Ga0466959_0013180
426 Ga0466959_0053226
427 Ga0466958_0010897
428 Ga0466967_0011426
429 Ga0466967_0034328
430 Ga0466967_0502639
431 Ga0466967_1653785
432 Ga0466967_1804140
433 Ga0466967_1847604
434 Ga0495627_190797
435 Ga0495592_0099395
436 Ga0495603_0004164
437 Ga0495603_0007598
438 Ga0495603_0023923
439 Ga0495629_0024194
440 Ga0495629_0029076
441 Ga0495629_0096109
442 Ga0495638_0069358
443 Ga0495638_0151221
444 Ga0495638_0425330
445 Ga0495641_0116750
446 Ga0495651_0020190
447 Ga0495651_0208340
448 Ga0495580_0224123
449 Ga0495582_0510324
450 Ga0495605_0027984
451 Ga0495662_0286634
452 Ga0495664_0048114
453 Ga0495584_0105762
454 Ga0495585_0091921
455 Ga0495594_0019831
456 Ga0495594_0041613
457 Ga0495596_0034571
458 Ga0495607_0056768
459 Ga0495583_0031904
460 Ga0495583_0089729
461 Ga0495583_0183895
462 Ga0495606_0005299
463 Ga0495608_0063578
464 Ga0495610_0081363
465 Ga0495616_0010640
466 Ga0495618_0194338
467 Ga0495618_0633272
468 Ga0495620_0337788
469 Ga0495630_0237386
470 Ga0495631_0011731
471 Ga0495631_0085277
472 Ga0495637_0021207
473 Ga0495648_0061230
474 Ga0495666_0060468
475 Ga0495652_0083195
476 Ga0495640_0033607
477 Ga0495640_0225094
478 Ga0495586_0035300
479 Ga0495609_0022247
480 Ga0495645_0770774
481 Ga0495622_0005269
482 Ga0495622_0161835
483 Ga0495633_0090125
484 Ga0495633_0170905
485 Ga0495667_0012568
486 Ga0495667_0131055
487 Ga0495667_0215243
488 Ga0495634_0046687
489 Ga0495625_0160654
490 Ga0495635_0047032
491 Ga0495661_0122375
492 Ga0495588_0014005
493 Ga0495657_0002332
494 Ga0495657_0080338
495 Ga0495599_0083563
496 Ga0495623_0015514
497 Ga0495623_0058000
498 Ga0495646_0135940
499 Ga0495613_0000689
500 Ga0495613_0150776
501 Ga0495613_0221475
502 Ga0495613_0665079
503 Ga0495624_0056594
504 Ga0495671_0285680
505 Ga0495649_0151178
506 Ga0495649_0396085
507 Ga0495589_0023292
508 Ga0495600_0066827
509 Ga0495600_0080221
510 Ga0495581_0108784
511 Ga0495604_0019851
512 Ga0495604_0030719
513 Ga0495604_0279587
514 Ga0495604_0847417
515 Ga0495636_0167824
516 Ga0495674_0229234
517 Ga0495672_0080015
518 Ga0495676_0023083
519 Ga0495676_0025047
520 Ga0495676_0153278
521 Ga0495680_0001870
522 Ga0495680_0012565
523 Ga0495687_005687
524 Ga0495687_111503
525 Ga0495675_0030873
526 Ga0495677_0075538
527 Ga0495677_0082865
528 Ga0495685_016594
529 Ga0495673_0081028
530 Ga0495681_0079437
531 Ga0495684_0073682
532 Ga0495593_0036861
533 Ga0495602_0046924
534 Ga0495602_0306592
535 Ga0495614_0007730
536 Ga0495626_0018348
537 Ga0496104_0597535
538 Ga0496106_0195689
539 Ga0496108_0000096
540 Ga0495678_092572
541 Ga0495682_0081223
542 Ga0501031_0058652
543 Ga0501031_0090526
544 Ga0501031_0094733
545 Ga0501032_0007555
546 Ga0501032_0015456
547 Ga0501032_0036927
548 Ga0501033_0000315
549 Ga0501033_0019979
550 Ga0501033_0022971
551 Ga0501033_0051042
552 Ga0501034_0002686
553 Ga0501034_0013420
554 Ga0501034_0098143
555 Ga0501034_0110547
556 Ga0501034_0385808
557 Ga0501036_0000081
558 Ga0501036_0012967
559 Ga0501036_0057669
560 Ga0501036_0212438
561 Ga0501037_0016097
562 Ga0501037_0170421
563 Ga0501037_0856831
564 Ga0501038_0003374
565 Ga0501038_0006805
566 Ga0501038_0022166
567 Ga0501038_0293785
568 Ga0501038_0301958
569 Ga0501039_0027509
570 Ga0501039_0094509
571 Ga0501039_0112859
572 Ga0501039_0624409
573 Ga0501039_0915277
574 Ga0501040_0368136
575 Ga0501042_0055951
576 Ga0501043_0010166
577 Ga0501043_0051417
578 Ga0501043_0060231
579 Ga0501043_0587987
580 Ga0501046_0008006
581 Ga0501047_0018440
582 Ga0501047_0019313
583 Ga0501047_0044183
584 Ga0501047_0219981
585 Ga0501047_0273742
586 Ga0501048_0004349
587 Ga0501048_0853936
588 Ga0501068_0469029
589 Ga0501069_0473802
590 Ga0501070_0056402
591 Ga0501070_0290224
592 Ga0501070_0564579
593 Ga0501070_0845529
594 Ga0501072_0494206
595 Ga0501074_0000299
596 Ga0501080_0804368
597 Ga0501282_000597
598 Ga0501035_0001623
599 Ga0501035_0010897
600 Ga0501035_0180701
601 Ga0501035_0212744
602 Ga0501044_0002369
603 Ga0501044_0003629
604 Ga0501044_0037386
605 Ga0501044_0050034
606 Ga0501044_0055231
607 Ga0501044_0496486
608 Ga0501045_0213018
609 Ga0501045_0467015
610 Ga0501045_0753171
611 nmdc:mga06z11_510852_c1
612 nmdc:mga07m45_480147_c1
613 Ga0495601_0275974
614 Ga0495595_0006994
615 Ga0495619_0034137
616 Ga0495619_0513395
617 Ga0500650_0336683
618 Ga0500560_041323
619 Ga0500573_0005772
620 Ga0500573_0153191
621 Ga0587072_074374
622 Ga0466962_0001438
623 Ga0466962_0192995
624 Ga0466962_0476847
625 Ga0530510_0136821
626 Ga0530510_0504304
627 2912759755
628 2644436091
629 2738889857
630 2776369368
631 2808840917
632 2857712786
633 2863068376
634 2866555981
635 2867370878
636 2873156765
637 2904769458
638 2904773024
639 2908814159
640 2919422620
641 2919435127
642 2935393989
643 8025531148
644 8056210850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

51

165

0.96

PF08534

Redoxin

Redoxin

56

183

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xvw-assembly1.cif.gz_B crystal structure of ahpe from mycobacterium tuberculosis, a 1-cys peroxiredoxin 0.9573 3 151
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.9561 1 151
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9552 2 151
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.9535 2 151
7kiz-assembly1.cif.gz_A reduced human peroxiredoxin 2 0.9512 5 150
ID Description Score Start End Superfamily
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9561 1 151 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9439 1 151 3.40.30.10
af_P9WQB7_4_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9361 4 151 3.40.30.10
af_A0A0R4J2P7_61_260_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9341 4 150 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9162 4 152 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2E5U0D2-F1-model_v4 Alkyl hydroperoxide reductase 0.9889 48 151 GO:0016209
GO:0016491
AF-A0A7W1SEG7-F1-model_v4 Peroxiredoxin 0.9858 2 152 GO:0016209
GO:0016491
AF-A0A1V6JUP2-F1-model_v4 Putative peroxiredoxin (EC 1.11.1.15) 0.9826 2 151 GO:0004601
AF-A0A7K4BLJ4-F1-model_v4 deleted 0.9822 2 150
AF-A0A2N0M8H3-F1-model_v4 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein 0.9819 52 151 GO:0016209
GO:0016491

Map