F406689

General Info

Members Datasets Scaffolds Average Seq Length
322 260 644 360

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2511231119|2511697972
Length 388
Sequence VYSEFVGSDSLLKKCYLKGGGGMLKRIVQAFFIIVGGVVGIFLIPELFVLSNIQDIPLITNAYTSAAIGAIIFFLISIWTTEYVINWVKWIEDSLLRAPVPDLLFGSLGLVFGLIIAYLIVNVIPLDNIPYRIFSTIIPVFLAFFLGYLGFQVGFKKKDELISLFSISARMQKKKGSADEEQEEQDKRLKILDTSVIIDGRIADICQTGFLEGVIVIPQFVLEELQHIADSSDVLKRNRGRRGLDILNRIQKELDITVEIYEGDFEDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQKVAVLNINDLANAVKPVVLPGEEMNVQVIKDGKEHNQGVAYLDDGTMIVVEEGRNYIGKHIDVLVTSVLQTAAGRMIFAKPKLLEKAL

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
8 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
9 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
10 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
11 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
13 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
15 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
17 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
18 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
19 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
25 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
26 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
27 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
28 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
29 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
30 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
31 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
32 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
33 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
34 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
35 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
36 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
37 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
38 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
39 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
40 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
41 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
42 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
43 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
44 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
45 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
46 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
47 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
48 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
49 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
50 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
51 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
52 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
53 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
54 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
55 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
56 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
57 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
58 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
59 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
60 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
74 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
75 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
77 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
78 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
79 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
80 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
81 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
82 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
83 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
84 2554235283 Bacillus safensis VK Isolate Rhizosphere
85 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
86 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
87 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
88 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
89 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
90 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
91 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
92 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
93 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
94 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
95 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
96 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
97 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
98 2643221729 Bacillus sp. Root11 Isolate Unclassified
99 2643221730 Bacillus sp. Root131 Isolate Unclassified
100 2643221731 Bacillus sp. Root147 Isolate Unclassified
101 2643221732 Bacillus sp. Root239 Isolate Unclassified
102 2643221735 Bacillus sp. Root920 Isolate Unclassified
103 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
104 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
105 2671180694 Paenibacillus sp. A3 Isolate Unclassified
106 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
107 2684622632 Bacillus cereus 905 Isolate Unclassified
108 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
109 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
110 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
111 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
112 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
113 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
114 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
115 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
116 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
117 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
118 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
119 2738541295 Bacillus sp. OK085 Isolate Unclassified
120 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
121 2738541358 Bacillus sp. OV752 Isolate Unclassified
122 2738543006 Bacillus sp. OK077 Isolate Unclassified
123 2738543010 Bacillus sp. YR335 Isolate Unclassified
124 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
125 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
126 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
127 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
128 2802429420 Priestia filamentosa HL2HP6 Isolate Unclassified
129 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
130 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
131 2811994870 Bacillus sp. JB4 Isolate Unclassified
132 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
133 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
134 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
135 2818991441 Niallia circulans 3243 Isolate Rhizosphere
136 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
137 2818991459 Paenibacillus sp. 597 Isolate Unclassified
138 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
139 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
140 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
141 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
142 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
143 2842682962 Bacillus sp. R-72492 Isolate Unclassified
144 2842882022 Bacillus sp. R-71893 Isolate Unclassified
145 2849139964 Bacillus sp. R-71875 Isolate Unclassified
146 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
147 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
148 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
149 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
150 2857581216 Bacillus sp. R-71922 Isolate Unclassified
151 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
152 2860837431 Bacillus sp. WR11 Isolate Unclassified
153 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
154 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
155 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
156 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
157 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
158 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
159 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
160 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
161 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
162 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
163 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
164 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
165 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
166 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
167 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
168 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
169 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
170 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
171 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
172 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
173 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
174 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
175 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
176 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
177 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
178 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
179 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
180 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
181 2919720352 Priestia megaterium 4340 Isolate Unclassified
182 2919726948 Bacillus pumilus 4489 Isolate Unclassified
183 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
184 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
185 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
186 2929004312 Priestia megaterium 1104 Isolate Unclassified
187 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
188 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
189 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
190 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
191 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
192 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
193 2938917290 Bacillus sp. CR71 Isolate Unclassified
194 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
195 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
196 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
197 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
198 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
199 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
200 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
201 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
202 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
203 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
204 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
205 2965761152 Bacillus sp. COPE52 Isolate Unclassified
206 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
207 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
208 2969141011 Bacillus velezensis MH25 Isolate Unclassified
209 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
210 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
211 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
212 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
213 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
214 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
215 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
216 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
217 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
218 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
219 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
220 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
221 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
222 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
223 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
224 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
225 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
226 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
227 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
228 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
229 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
230 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
231 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
232 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
233 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
234 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
235 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
236 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
237 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
238 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
239 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
240 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
241 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
242 8022653035 Bacillus sp. Rc4 Isolate Unclassified
243 8022792930 Bacillus sp. Xin Isolate Rhizosphere
244 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
245 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
246 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
247 8023438354 Bacillus sp. BH2 Isolate Unclassified
248 8023444577 Bacillus sp. BH32 Isolate Unclassified
249 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
250 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
251 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
252 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
253 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
254 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
255 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
256 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
257 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
258 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
259 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
260 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 33.85
Metatranscriptomes 8.7
Isolates 57.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.39
Nodule 0.62
Rhizoplane 1.86
Rhizosphere 51.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1003590 3300002987 Bacteria 5422
2 JGI25151J46595_10001136 3300003187 Bacteria 19348
3 JGI25151J46595_10005125 3300003187 Bacteria 6799
4 JGI25151J46595_10022575 3300003187 Bacteria 2609
5 JGI25151J46595_10061220 3300003187 Bacteria 1199
6 Ga0006562J51391_1000677 3300003578 Bacteria 45519
7 Ga0006562J51391_1010897 3300003578 Bacteria 2208
8 Ga0006562J51391_1013051 3300003578 Bacteria 1344
9 Ga0006562J51391_1014331 3300003578 Bacteria 1822
10 Ga0055535_1002867 3300003761 Bacteria 5411
11 Ga0058692_1011499 3300003856 Bacteria 2137
12 Ga0065704_10172749 3300005289 Bacteria 1282
13 Ga0105251_10013724 3300009011 Bacteria 4515
14 Ga0105251_10019992 3300009011 Bacteria 3524
15 Ga0105244_10010829 3300009036 Bacteria 5506
16 Ga0105244_10103843 3300009036 Bacteria 1388
17 Ga0105250_10000941 3300009092 Bacteria 17119
18 Ga0105250_10011530 3300009092 Bacteria 3665
19 Ga0105250_10020929 3300009092 Bacteria 2641
20 Ga0105246_10000975 3300011119 Bacteria 16403
21 Ga0105246_10017967 3300011119 Bacteria 4503
22 Ga0209784_101851 3300025224 Bacteria 2457
23 Ga0209566_100588 3300025225 Bacteria 23106
24 Ga0209147_100210 3300025229 Bacteria 62804
25 Ga0209147_102218 3300025229 Bacteria 5197
26 Ga0209437_100331 3300025233 Bacteria 58796
27 Ga0209258_101019 3300025242 Bacteria 12680
28 Ga0209130_1002183 3300025284 Bacteria 10312
29 Ga0209130_1003618 3300025284 Bacteria 6419
30 Ga0209130_1003743 3300025284 Bacteria 6216
31 Ga0209130_1014351 3300025284 Bacteria 1993
32 Ga0209675_1011066 3300025291 Bacteria 3018
33 Ga0209025_1000639 3300025294 Bacteria 61845
34 Ga0209025_1002839 3300025294 Bacteria 17380
35 Ga0209025_1003050 3300025294 Bacteria 16506
36 Ga0209025_1003499 3300025294 Bacteria 14770
37 Ga0209025_1004078 3300025294 Bacteria 13033
38 Ga0209025_1005357 3300025294 Bacteria 10510
39 Ga0209025_1009747 3300025294 Bacteria 6632
40 Ga0209025_1012895 3300025294 Bacteria 5313
41 Ga0209025_1025999 3300025294 Bacteria 2955
42 Ga0209025_1028077 3300025294 Bacteria 2769
43 Ga0207696_1000889 3300025711 Bacteria 18596
44 Ga0207696_1012406 3300025711 Bacteria 3013
45 Ga0207655_1002102 3300025728 Bacteria 16693
46 Ga0207713_1006809 3300025735 Bacteria 6894
47 Ga0207713_1012053 3300025735 Bacteria 4652
48 Ga0207681_10037899 3300025923 Bacteria 3190
49 Ga0209371_1002491 3300027312 Bacteria 10225
50 Ga0209974_10031033 3300027876 Bacteria 1769
51 Ga0237817_10220 3300030083 Bacteria 14618
52 Ga0237817_10407 3300030083 Bacteria 7120
53 Ga0268256_1002217 3300030500 Bacteria 10226
54 Ga0307408_100220113 3300031548 Bacteria 1548
55 Ga0307405_10251444 3300031731 Bacteria 1315
56 Ga0307409_100237337 3300031995 Bacteria 1657
57 Ga0307416_100034970 3300032002 Bacteria 3831
58 Ga0237819_00656 3300038705 Bacteria 11222
59 Ga0439439_0003035 3300041406 Bacteria 3655
60 Ga0439449_0000208 3300042007 Bacteria 20706
61 Ga0439462_0000024 3300042015 Bacteria 23158
62 Ga0466969_0002123 3300044656 Bacteria 10577
63 Ga0466968_0008646 3300044735 Bacteria 3902
64 Ga0466959_0017919 3300045049 Bacteria 5195
65 Ga0466967_0000664 3300045976 Bacteria 17351
66 Ga0495605_0059266 3300046474 Bacteria 1839
67 Ga0495620_0060838 3300046515 Bacteria 1573
68 Ga0495661_0114935 3300046665 Bacteria 1495
69 Ga0495649_0017739 3300046694 Bacteria 4015
70 Ga0495660_0009598 3300046810 Bacteria 5642
71 Ga0495676_0119751 3300047321 Bacteria 1917
72 Ga0495626_0063012 3300048091 Bacteria 1683
73 Ga0496110_0006311 3300048913 Bacteria 9362
74 Ga0496110_0028847 3300048913 Bacteria 4770
75 Ga0496110_0039387 3300048913 Bacteria 4114
76 Ga0496111_0064645 3300048914 Bacteria 2654
77 Ga0496113_0058430 3300048916 Bacteria 2902
78 Ga0496116_0002747 3300048919 Bacteria 18082
79 Ga0496116_0005716 3300048919 Bacteria 11441
80 Ga0496116_0016812 3300048919 Bacteria 5708
81 Ga0496116_0040049 3300048919 Bacteria 3231
82 Ga0496116_0056053 3300048919 Bacteria 2585
83 Ga0496116_0068124 3300048919 Bacteria 2269
84 Ga0496117_0014604 3300048920 Bacteria 6755
85 Ga0496117_0036071 3300048920 Bacteria 3704
86 Ga0496118_0036829 3300048921 Bacteria 3948
87 Ga0496119_0000469 3300048922 Bacteria 54992
88 Ga0496119_0083666 3300048922 Bacteria 1831
89 Ga0496120_0003045 3300048923 Bacteria 15808
90 Ga0496120_0008977 3300048923 Bacteria 7151
91 Ga0496121_0023803 3300048924 Bacteria 5880
92 Ga0496121_0054574 3300048924 Bacteria 3337
93 Ga0496122_0015557 3300048925 Bacteria 7263
94 Ga0496122_0024433 3300048925 Bacteria 5287
95 Ga0496122_0090695 3300048925 Bacteria 2084
96 Ga0496122_0093373 3300048925 Bacteria 2041
97 Ga0496123_0010827 3300048926 Bacteria 7999
98 Ga0496123_0013838 3300048926 Bacteria 6732
99 Ga0496124_0000697 3300048927 Bacteria 55040
100 Ga0496124_0001169 3300048927 Bacteria 41092
101 Ga0496124_0023792 3300048927 Bacteria 5583
102 Ga0496124_0044647 3300048927 Bacteria 3801
103 Ga0496125_0004005 3300048928 Bacteria 17323
104 Ga0496125_0004147 3300048928 Bacteria 16901
105 Ga0496125_0035075 3300048928 Bacteria 4409
106 Ga0496125_0053536 3300048928 Bacteria 3307
107 Ga0496126_0005326 3300048929 Bacteria 14745
108 Ga0496126_0011703 3300048929 Bacteria 9045
109 Ga0496126_0041177 3300048929 Bacteria 4277
110 Ga0501341_00531 3300049131 Bacteria 1640
111 Ga0501343_000127 3300049132 Bacteria 3539
112 Ga0501344_00244 3300049133 Bacteria 2071
113 Ga0501305_000492 3300049161 Bacteria 3258
114 Ga0501305_003231 3300049161 Bacteria 1832
115 Ga0501305_003986 3300049161 Bacteria 1707
116 Ga0501312_000015 3300049528 Bacteria 9271
117 Ga0501312_001602 3300049528 Bacteria 2264
118 Ga0501312_002607 3300049528 Bacteria 1962
119 Ga0501312_007476 3300049528 Bacteria 1392
120 Ga0501316_006408 3300049532 Bacteria 1252
121 Ga0501317_000150 3300049533 Bacteria 3930
122 Ga0501317_001164 3300049533 Bacteria 2186
123 Ga0501321_001323 3300049537 Bacteria 1945
124 Ga0501331_01128 3300049547 Bacteria 1251
125 Ga0501332_01123 3300049548 Bacteria 1349
126 Ga0501332_01599 3300049548 Bacteria 1202
127 Ga0501333_000455 3300049549 Bacteria 1872
128 Ga0501333_001470 3300049549 Bacteria 1279
129 Ga0501334_00168 3300049550 Bacteria 2500
130 Ga0501334_00909 3300049550 Bacteria 1528
131 Ga0501335_001519 3300049551 Bacteria 1788
132 Ga0501335_003218 3300049551 Bacteria 1374
133 Ga0501217_002513 3300049661 Bacteria 3619
134 Ga0501217_005651 3300049661 Bacteria 2623
135 Ga0501217_005865 3300049661 Bacteria 2584
136 Ga0501233_005026 3300049668 Bacteria 2447
137 Ga0587067_003990 3300059640 Bacteria 1886
138 2511697972 2511231119 Bacteria 4019861
139 2511180904 2510917027 Bacteria 5287437
140 2512635710 2512564013 Bacteria 6286191
141 2512736556 2512564039 Bacteria 8739048
142 2524189968 2524023129 Bacteria 6762600
143 2540605197 2540341094 Bacteria 4061186
144 2545559789 2545555800 Bacteria 4222588
145 2553395080 2551306519 Bacteria 5465154
146 2555470851 2554235283 Bacteria 3683090
147 2556065823 2554235469 Bacteria 3590176
148 2571530840 2571042143 Bacteria 6986194
149 2573039787 2571042588 Bacteria 5045676
150 2578338915 2576861424 Bacteria 5270569
151 2578930746 2576861599 Bacteria 4217202
152 2580932103 2579778775 Bacteria 5360914
153 2587744103 2585428059 Bacteria 8696589
154 2595320903 2593339198 Bacteria 7267884
155 2601641721 2600255286 Bacteria 5390125
156 2621273327 2619619294 Bacteria 5575484
157 2631982493 2630968484 Bacteria 3876276
158 2643738812 2643221543 Bacteria 6628015
159 2644424523 2643221676 Bacteria 8119172
160 2644705760 2643221729 Bacteria 6621700
161 2644713281 2643221730 Bacteria 6523787
162 2644721371 2643221731 Bacteria 5623886
163 2644723356 2643221732 Bacteria 5756404
164 2644741831 2643221735 Bacteria 3676263
165 2651530357 2648501850 Bacteria 3975476
166 2672333558 2671180330 Bacteria 5521719
167 2673821692 2671180694 Bacteria 7506943
168 2674421088 2671180844 Bacteria 4164150
169 2685148237 2684622632 Bacteria 5380049
170 2686995295 2684623153 Bacteria 3878815
171 2687496544 2687453109 Bacteria 3860091
172 2695629892 2695420354 Bacteria 3922431
173 2698319662 2695420987 Bacteria 6152737
174 2705991979 2703719227 Bacteria 5631989
175 2712198839 2711768088 Bacteria 3195027
176 2717918209 2716884898 Bacteria 3928789
177 2721503406 2718218445 Bacteria 5113413
178 2723606224 2721755693 Bacteria 6126117
179 2728529859 2728368933 Bacteria 7044283
180 2730136847 2728369359 Bacteria 5621728
181 2738817073 2738541295 Bacteria 5730091
182 2738838965 2738541299 Bacteria 4020721
183 2739160135 2738541358 Bacteria 5932299
184 2739212609 2738543006 Bacteria 5904091
185 2739234665 2738543010 Bacteria 5583595
186 2745170143 2744054657 Bacteria 5016802
187 2753813110 2751185905 Bacteria 6142767
188 2793182104 2791355222 Bacteria 5898266
189 2802440694 2802428803 Bacteria 5806948
190 2805348301 2802429420 Bacteria 845479
191 2808871148 2808606364 Bacteria 4465927
192 2809057216 2808606399 Bacteria 4021018
193 2812314433 2811994870 Bacteria 3776934
194 2816866410 2816332186 Bacteria 5331395
195 2817478161 2816332295 Bacteria 4352468
196 2817616425 2816332336 Bacteria 5207640
197 2819571000 2818991441 Bacteria 5062707
198 2819585007 2818991443 Bacteria 6598732
199 2819676070 2818991459 Bacteria 8736032
200 2819711968 2818991465 Bacteria 5388835
201 2819726098 2818991468 Bacteria 3723169
202 2821118291 2821111986 Bacteria 6894338
203 2823526386 2823526263 Bacteria 3765752
204 2831907815 2831905167 Bacteria 3319172
205 2842688243 2842682962 Bacteria 5589973
206 2842887755 2842882022 Bacteria 6158489
207 2849144937 2849139964 Bacteria 5613304
208 2852676586 2852673933 Bacteria 3347676
209 2857460073 2857453340 Bacteria 8090534
210 2857464306 2857460504 Bacteria 5194327
211 2857472320 2857465823 Bacteria 6772595
212 2857586514 2857581216 Bacteria 5522813
213 2857597814 2857591370 Bacteria 6569758
214 2860837549 2860837431 Bacteria 4202080
215 2864738901 2864733723 Bacteria 6770668
216 2865001992 2864997549 Bacteria 5139696
217 2877768769 2877768649 Bacteria 3957164
218 2880169711 2880169592 Bacteria 3900066
219 2881639840 2881636855 Bacteria 5205297
220 2881646604 2881644220 Bacteria 5302661
221 2885529945 2885526491 Bacteria 7164189
222 2889048039 2889042446 Bacteria 7618936
223 2889276777 2889276214 Bacteria 5979355
224 2889298975 2889295896 Bacteria 4704906
225 2897109738 2897109615 Bacteria 4009619
226 2898908914 2898907183 Bacteria 4067722
227 2904168124 2904162308 Bacteria 7086713
228 2904496979 2904490793 Bacteria 7046938
229 2904530135 2904524088 Bacteria 5887454
230 2904564560 2904560550 Bacteria 4029838
231 2904600750 2904595352 Bacteria 6124848
232 2904755703 2904755435 Bacteria 7986759
233 2908669349 2908665501 Bacteria 3678115
234 2915598671 2915597211 Bacteria 6475886
235 2915609966 2915606848 Bacteria 6032732
236 2916972048 2916971899 Bacteria 4250608
237 2919097107 2919093281 Bacteria 3660974
238 2919149604 2919143609 Bacteria 6219228
239 2919166218 2919160200 Bacteria 6929020
240 2919419323 2919414237 Bacteria 5429133
241 2919432382 2919425241 Bacteria 8055701
242 2919523223 2919517244 Bacteria 5858162
243 2919726444 2919720352 Bacteria 5986006
244 2919730736 2919726948 Bacteria 3696050
245 2925332808 2925326138 Bacteria 9652120
246 2928099883 2928093941 Bacteria 5965005
247 2928513079 2928510474 Bacteria 4815308
248 2929009934 2929004312 Bacteria 5678476
249 2929183818 2929183550 Bacteria 6377511
250 2929211912 2929206907 Bacteria 5918291
251 2929233232 2929233124 Bacteria 5948380
252 2931385145 2931384279 Bacteria 7299545
253 2936363662 2936361878 Bacteria 5632809
254 2938653421 2938649242 Bacteria 7118381
255 2938917402 2938917290 Bacteria 5914775
256 2939685093 2939679117 Bacteria 6921672
257 2939707572 2939702853 Bacteria 5139229
258 2945996231 2945991243 Bacteria 7008369
259 2946058921 2946053406 Bacteria 6978655
260 2947426700 2947426588 Bacteria 5357194
261 2954776110 2954773129 Bacteria 3741715
262 2956900768 2956897341 Bacteria 5447711
263 2960324315 2960319331 Bacteria 5502575
264 2960378862 2960375949 Bacteria 5361395
265 2962290761 2962290636 Bacteria 4072939
266 2964375255 2964375228 Bacteria 4909004
267 2965761296 2965761152 Bacteria 5806513
268 2968562398 2968558590 Bacteria 6956864
269 2969136968 2969136845 Bacteria 3923176
270 2969141136 2969141011 Bacteria 4118468
271 2969766283 2969765954 Bacteria 4216713
272 2969774951 2969770375 Bacteria 4271280
273 2971406722 2971403814 Bacteria 7370929
274 2971410898 2971410472 Bacteria 8311090
275 2971513759 2971511577 Bacteria 5404012
276 2971893498 2971893375 Bacteria 3929648
277 2977254725 2977254563 Bacteria 4828420
278 2979083710 2979083700 Bacteria 5894929
279 2980128544 2980125574 Bacteria 5567337
280 2980179412 2980176882 Bacteria 5397533
281 2980186786 2980182181 Bacteria 9454109
282 2980492712 2980492589 Bacteria 4072961
283 2981289490 2981284811 Bacteria 4641497
284 2981294490 2981289755 Bacteria 4641509
285 2981985146 2981980479 Bacteria 4641628
286 2981990077 2981985349 Bacteria 4641497
287 2988229905 2988225383 Bacteria 7221625
288 2990275727 2990275345 Bacteria 4887158
289 2996636908 2996632988 Bacteria 6921523
290 2996707515 2996706504 Bacteria 5757485
291 3001271838 3001267043 Bacteria 4823521
292 3001275925 3001272096 Bacteria 4729684
293 3001898826 3001892409 Bacteria 6328293
294 3006831025 3006826541 Bacteria 4678913
295 3006858488 3006858327 Bacteria 4317835
296 3006883599 3006879489 Bacteria 4064221
297 3006973783 3006969106 Bacteria 4739423
298 3006978386 3006973921 Bacteria 4423788
299 3006980059 3006978542 Bacteria 5328100
300 3006988381 3006984091 Bacteria 4207523
301 648172219 648028048 Bacteria 5394884
302 8022621185 8022621104 Bacteria 5241040
303 8022631670 8022630665 Bacteria 3886130
304 8022655847 8022653035 Bacteria 4035078
305 8022799025 8022792930 Bacteria 5693794
306 8022893403 8022893055 Bacteria 5300455
307 8022917947 8022914991 Bacteria 5584517
308 8022950801 8022948649 Bacteria 5366783
309 8023439781 8023438354 Bacteria 5779374
310 8023447360 8023444577 Bacteria 5661597
311 8046991350 8046991243 Bacteria 8497463
312 8051956481 8051952484 Bacteria 3926774
313 8052174957 8052174270 Bacteria 3881265
314 8054282834 8054280661 Bacteria 4232245
315 8054471344 8054465665 Bacteria 7323556
316 8054802025 8054795415 Bacteria 9785225
317 8055634049 8055632911 Bacteria 5283357
318 8056535639 8056533031 Bacteria 8964429
319 8057473415 8057473075 Bacteria 5892720
320 8057582767 8057582654 Bacteria 5218944
321 8057632252 8057632132 Bacteria 4726859
322 8057735173 8057733483 Bacteria 6578323
323 JGI25159J45721_1003590
324 JGI25151J46595_10001136
325 JGI25151J46595_10005125
326 JGI25151J46595_10022575
327 JGI25151J46595_10061220
328 Ga0006562J51391_1000677
329 Ga0006562J51391_1010897
330 Ga0006562J51391_1013051
331 Ga0006562J51391_1014331
332 Ga0055535_1002867
333 Ga0058692_1011499
334 Ga0065704_10172749
335 Ga0105251_10013724
336 Ga0105251_10019992
337 Ga0105244_10010829
338 Ga0105244_10103843
339 Ga0105250_10000941
340 Ga0105250_10011530
341 Ga0105250_10020929
342 Ga0105246_10000975
343 Ga0105246_10017967
344 Ga0209784_101851
345 Ga0209566_100588
346 Ga0209147_100210
347 Ga0209147_102218
348 Ga0209437_100331
349 Ga0209258_101019
350 Ga0209130_1002183
351 Ga0209130_1003618
352 Ga0209130_1003743
353 Ga0209130_1014351
354 Ga0209675_1011066
355 Ga0209025_1000639
356 Ga0209025_1002839
357 Ga0209025_1003050
358 Ga0209025_1003499
359 Ga0209025_1004078
360 Ga0209025_1005357
361 Ga0209025_1009747
362 Ga0209025_1012895
363 Ga0209025_1025999
364 Ga0209025_1028077
365 Ga0207696_1000889
366 Ga0207696_1012406
367 Ga0207655_1002102
368 Ga0207713_1006809
369 Ga0207713_1012053
370 Ga0207681_10037899
371 Ga0209371_1002491
372 Ga0209974_10031033
373 Ga0237817_10220
374 Ga0237817_10407
375 Ga0268256_1002217
376 Ga0307408_100220113
377 Ga0307405_10251444
378 Ga0307409_100237337
379 Ga0307416_100034970
380 Ga0237819_00656
381 Ga0439439_0003035
382 Ga0439449_0000208
383 Ga0439462_0000024
384 Ga0466969_0002123
385 Ga0466968_0008646
386 Ga0466959_0017919
387 Ga0466967_0000664
388 Ga0495605_0059266
389 Ga0495620_0060838
390 Ga0495661_0114935
391 Ga0495649_0017739
392 Ga0495660_0009598
393 Ga0495676_0119751
394 Ga0495626_0063012
395 Ga0496110_0006311
396 Ga0496110_0028847
397 Ga0496110_0039387
398 Ga0496111_0064645
399 Ga0496113_0058430
400 Ga0496116_0002747
401 Ga0496116_0005716
402 Ga0496116_0016812
403 Ga0496116_0040049
404 Ga0496116_0056053
405 Ga0496116_0068124
406 Ga0496117_0014604
407 Ga0496117_0036071
408 Ga0496118_0036829
409 Ga0496119_0000469
410 Ga0496119_0083666
411 Ga0496120_0003045
412 Ga0496120_0008977
413 Ga0496121_0023803
414 Ga0496121_0054574
415 Ga0496122_0015557
416 Ga0496122_0024433
417 Ga0496122_0090695
418 Ga0496122_0093373
419 Ga0496123_0010827
420 Ga0496123_0013838
421 Ga0496124_0000697
422 Ga0496124_0001169
423 Ga0496124_0023792
424 Ga0496124_0044647
425 Ga0496125_0004005
426 Ga0496125_0004147
427 Ga0496125_0035075
428 Ga0496125_0053536
429 Ga0496126_0005326
430 Ga0496126_0011703
431 Ga0496126_0041177
432 Ga0501341_00531
433 Ga0501343_000127
434 Ga0501344_00244
435 Ga0501305_000492
436 Ga0501305_003231
437 Ga0501305_003986
438 Ga0501312_000015
439 Ga0501312_001602
440 Ga0501312_002607
441 Ga0501312_007476
442 Ga0501316_006408
443 Ga0501317_000150
444 Ga0501317_001164
445 Ga0501321_001323
446 Ga0501331_01128
447 Ga0501332_01123
448 Ga0501332_01599
449 Ga0501333_000455
450 Ga0501333_001470
451 Ga0501334_00168
452 Ga0501334_00909
453 Ga0501335_001519
454 Ga0501335_003218
455 Ga0501217_002513
456 Ga0501217_005651
457 Ga0501217_005865
458 Ga0501233_005026
459 Ga0587067_003990
460 2511697972
461 2511180904
462 2512635710
463 2512736556
464 2524189968
465 2540605197
466 2545559789
467 2553395080
468 2555470851
469 2556065823
470 2571530840
471 2573039787
472 2578338915
473 2578930746
474 2580932103
475 2587744103
476 2595320903
477 2601641721
478 2621273327
479 2631982493
480 2643738812
481 2644424523
482 2644705760
483 2644713281
484 2644721371
485 2644723356
486 2644741831
487 2651530357
488 2672333558
489 2673821692
490 2674421088
491 2685148237
492 2686995295
493 2687496544
494 2695629892
495 2698319662
496 2705991979
497 2712198839
498 2717918209
499 2721503406
500 2723606224
501 2728529859
502 2730136847
503 2738817073
504 2738838965
505 2739160135
506 2739212609
507 2739234665
508 2745170143
509 2753813110
510 2793182104
511 2802440694
512 2805348301
513 2808871148
514 2809057216
515 2812314433
516 2816866410
517 2817478161
518 2817616425
519 2819571000
520 2819585007
521 2819676070
522 2819711968
523 2819726098
524 2821118291
525 2823526386
526 2831907815
527 2842688243
528 2842887755
529 2849144937
530 2852676586
531 2857460073
532 2857464306
533 2857472320
534 2857586514
535 2857597814
536 2860837549
537 2864738901
538 2865001992
539 2877768769
540 2880169711
541 2881639840
542 2881646604
543 2885529945
544 2889048039
545 2889276777
546 2889298975
547 2897109738
548 2898908914
549 2904168124
550 2904496979
551 2904530135
552 2904564560
553 2904600750
554 2904755703
555 2908669349
556 2915598671
557 2915609966
558 2916972048
559 2919097107
560 2919149604
561 2919166218
562 2919419323
563 2919432382
564 2919523223
565 2919726444
566 2919730736
567 2925332808
568 2928099883
569 2928513079
570 2929009934
571 2929183818
572 2929211912
573 2929233232
574 2931385145
575 2936363662
576 2938653421
577 2938917402
578 2939685093
579 2939707572
580 2945996231
581 2946058921
582 2947426700
583 2954776110
584 2956900768
585 2960324315
586 2960378862
587 2962290761
588 2964375255
589 2965761296
590 2968562398
591 2969136968
592 2969141136
593 2969766283
594 2969774951
595 2971406722
596 2971410898
597 2971513759
598 2971893498
599 2977254725
600 2979083710
601 2980128544
602 2980179412
603 2980186786
604 2980492712
605 2981289490
606 2981294490
607 2981985146
608 2981990077
609 2988229905
610 2990275727
611 2996636908
612 2996707515
613 3001271838
614 3001275925
615 3001898826
616 3006831025
617 3006858488
618 3006883599
619 3006973783
620 3006978386
621 3006980059
622 3006988381
623 648172219
624 8022621185
625 8022631670
626 8022655847
627 8022799025
628 8022893403
629 8022917947
630 8022950801
631 8023439781
632 8023447360
633 8046991350
634 8051956481
635 8052174957
636 8054282834
637 8054471344
638 8054802025
639 8055634049
640 8056535639
641 8057473415
642 8057582767
643 8057632252
644 8057735173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

190

299

0.94

Map