F406669

General Info

Members Datasets Scaffolds Average Seq Length
322 201 644 263

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_168009_c1|nmdc:mga08x19_168009_c1_471_1412
Length 313
Sequence MAKVSIFMRDTLPRSGAARPQVGAGVLDYTGCFLVTIDSTGGRDRRTPTTMSTAAASPNVARIPGGDFLMGAADAEEDERPIHRVFVSEFFIGRFPVTNDDYARFVRATGHPAPAVRELPLVAGGGRELLFRDMAAPYEWHGDQPPAGHGGHPVVLVTCDDAAAYCRWLSDELGRIVRLPTEAEWERAARAGVDGLRYPWGNEIDPSRCNFLTDGALKRQRGTRPTGTYPPNAYGLYDVCGNVWEWVADWYSPDYYGLGEMRDPRGPESGAMRIVRGGSWVNDDVTMLRCAYRHKVPPDTYAYSVGFRIVCAR

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
180 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 3.42
Rhizosphere 95.34
Stem 0
Stem Tuber 0
Unclassified 4.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_168009_c1 3300050514 Bacteria 1493
2 Ga0065715_10099907 3300005293 Bacteria 3349
3 Ga0065715_10132716 3300005293 Bacteria 1985
4 Ga0065707_10001222 3300005295 Bacteria 9734
5 Ga0070670_100020899 3300005331 Bacteria 5630
6 Ga0070680_100261123 3300005336 Bacteria 1465
7 Ga0068868_100012388 3300005338 Bacteria 6232
8 Ga0070660_100249081 3300005339 Bacteria 1448
9 Ga0070689_100055437 3300005340 Bacteria 3072
10 Ga0070689_100647352 3300005340 Bacteria 919
11 Ga0070661_100010982 3300005344 Bacteria 6312
12 Ga0070668_100398840 3300005347 Bacteria 1174
13 Ga0070669_100110938 3300005353 Bacteria 2081
14 Ga0070671_100041373 3300005355 Bacteria 3830
15 Ga0070674_100216967 3300005356 Unclassified 1486
16 Ga0070674_100339782 3300005356 Bacteria 1209
17 Ga0070673_100153572 3300005364 Bacteria 1952
18 Ga0070673_100514901 3300005364 Bacteria 1084
19 Ga0070688_100123876 3300005365 Bacteria 1735
20 Ga0070688_100154819 3300005365 Bacteria 1570
21 Ga0070659_100057597 3300005366 Bacteria 3065
22 Ga0070667_100008245 3300005367 Bacteria 8636
23 Ga0070711_100028763 3300005439 Bacteria 3660
24 Ga0070705_100029909 3300005440 Bacteria 3002
25 Ga0070705_100192621 3300005440 Bacteria 1391
26 Ga0070681_10181521 3300005458 Bacteria 2026
27 Ga0068867_100050010 3300005459 Bacteria 3079
28 Ga0070707_100028528 3300005468 Bacteria 5313
29 Ga0070699_100307867 3300005518 Bacteria 1422
30 Ga0070679_100454195 3300005530 Bacteria 1226
31 Ga0070684_100529867 3300005535 Bacteria 1092
32 Ga0070697_100043271 3300005536 Bacteria 3645
33 Ga0070697_100229724 3300005536 Bacteria 1582
34 Ga0068853_100235602 3300005539 Bacteria 1676
35 Ga0068853_100703136 3300005539 Bacteria 964
36 Ga0070672_100064167 3300005543 Bacteria 2901
37 Ga0070672_100246738 3300005543 Unclassified 1503
38 Ga0070686_100001456 3300005544 Bacteria 13358
39 Ga0070695_100023654 3300005545 Bacteria 3780
40 Ga0070696_100226381 3300005546 Bacteria 1405
41 Ga0070665_100046853 3300005548 Bacteria 4340
42 Ga0070704_100073670 3300005549 Bacteria 2488
43 Ga0068855_100279548 3300005563 Bacteria 1854
44 Ga0068856_100021485 3300005614 Bacteria 6273
45 Ga0068859_100476803 3300005617 Bacteria 1343
46 Ga0068861_100021177 3300005719 Bacteria 4672
47 Ga0068863_100001594 3300005841 Bacteria 22409
48 Ga0068858_100047926 3300005842 Bacteria 3960
49 Ga0068860_100013508 3300005843 Bacteria 8006
50 Ga0068860_100591369 3300005843 Bacteria 1114
51 Ga0068862_100058521 3300005844 Bacteria 3305
52 Ga0068862_100163108 3300005844 Bacteria 1991
53 Ga0081455_10030568 3300005937 Bacteria 4890
54 Ga0081455_10105298 3300005937 Bacteria 2254
55 Ga0075366_10010373 3300006195 Bacteria 5230
56 Ga0097621_100000820 3300006237 Bacteria 21967
57 Ga0097621_100005002 3300006237 Bacteria 9295
58 Ga0097621_100485985 3300006237 Bacteria 1117
59 Ga0068871_100000748 3300006358 Bacteria 22005
60 Ga0068871_100016047 3300006358 Bacteria 5628
61 Ga0068871_100124803 3300006358 Bacteria 2178
62 Ga0068871_100256178 3300006358 Bacteria 1525
63 Ga0068871_100256831 3300006358 Bacteria 1523
64 Ga0075428_100000005 3300006844 Bacteria 326130
65 Ga0075428_100216788 3300006844 Bacteria 2067
66 Ga0075431_100097374 3300006847 Bacteria 3038
67 Ga0075434_100000100 3300006871 Bacteria 48123
68 Ga0075434_100024212 3300006871 Bacteria 5933
69 Ga0075434_100208640 3300006871 Bacteria 1974
70 Ga0075434_100645813 3300006871 Bacteria 1076
71 Ga0068865_100073581 3300006881 Bacteria 2430
72 Ga0068865_100286404 3300006881 Bacteria 1313
73 Ga0075436_100000583 3300006914 Bacteria 23900
74 Ga0075436_100122227 3300006914 Bacteria 1822
75 Ga0097620_100476824 3300006931 Bacteria 1343
76 Ga0075435_100000192 3300007076 Bacteria 36826
77 Ga0075435_100029366 3300007076 Bacteria 4314
78 Ga0075435_100150002 3300007076 Bacteria 1959
79 Ga0075435_100295428 3300007076 Bacteria 1385
80 Ga0105240_10064661 3300009093 Bacteria 4545
81 Ga0111539_10000008 3300009094 Bacteria 382609
82 Ga0111539_10003965 3300009094 Bacteria 19451
83 Ga0111539_10012733 3300009094 Bacteria 10533
84 Ga0111539_10015361 3300009094 Bacteria 9533
85 Ga0111539_10016316 3300009094 Bacteria 9207
86 Ga0111539_10365541 3300009094 Bacteria 1679
87 Ga0111539_10562840 3300009094 Bacteria 1328
88 Ga0111539_10654177 3300009094 Bacteria 1224
89 Ga0105245_10119698 3300009098 Bacteria 2458
90 Ga0114129_10013888 3300009147 Bacteria 11476
91 Ga0114129_10087158 3300009147 Bacteria 4330
92 Ga0105243_10280410 3300009148 Bacteria 1501
93 Ga0105242_10014046 3300009176 Bacteria 6197
94 Ga0105242_10055861 3300009176 Bacteria 3230
95 Ga0105242_10067335 3300009176 Bacteria 2960
96 Ga0105242_10325158 3300009176 Bacteria 1412
97 Ga0105248_10020727 3300009177 Bacteria 7283
98 Ga0105248_10149341 3300009177 Bacteria 2637
99 Ga0105249_10159121 3300009553 Bacteria 2181
100 Ga0105239_10454065 3300010375 Bacteria 1454
101 Ga0105246_10302610 3300011119 Bacteria 1292
102 Ga0157374_10046922 3300013296 Bacteria 4003
103 Ga0157378_10001160 3300013297 Bacteria 23959
104 Ga0157378_10161480 3300013297 Bacteria 2096
105 Ga0163162_10082770 3300013306 Bacteria 3282
106 Ga0163162_10104036 3300013306 Bacteria 2933
107 Ga0157372_10242589 3300013307 Bacteria 2091
108 Ga0157375_10309946 3300013308 Bacteria 1743
109 Ga0157380_10192058 3300014326 Bacteria 1804
110 Ga0157379_10003996 3300014968 Bacteria 12574
111 Ga0157376_10003823 3300014969 Bacteria 10412
112 Ga0157376_10074399 3300014969 Bacteria 2896
113 Ga0157376_10238855 3300014969 Bacteria 1692
114 Ga0207707_10099744 3300025912 Bacteria 2538
115 Ga0207695_10082960 3300025913 Bacteria 3239
116 Ga0207663_10152488 3300025916 Bacteria 1622
117 Ga0207662_10157854 3300025918 Bacteria 1447
118 Ga0207649_10117169 3300025920 Bacteria 1790
119 Ga0207646_10025847 3300025922 Bacteria 5367
120 Ga0207681_10030553 3300025923 Bacteria 3513
121 Ga0207681_10364919 3300025923 Bacteria 1159
122 Ga0207650_10056183 3300025925 Bacteria 2924
123 Ga0207687_10023246 3300025927 Unclassified 4130
124 Ga0207687_10038020 3300025927 Bacteria 3287
125 Ga0207644_10004449 3300025931 Bacteria 9100
126 Ga0207690_10064163 3300025932 Bacteria 2507
127 Ga0207706_10162801 3300025933 Bacteria 1961
128 Ga0207686_10047651 3300025934 Bacteria 2650
129 Ga0207686_10127429 3300025934 Bacteria 1741
130 Ga0207670_10036496 3300025936 Bacteria 3197
131 Ga0207704_10119903 3300025938 Bacteria 1798
132 Ga0207704_10155109 3300025938 Bacteria 1622
133 Ga0207691_10033013 3300025940 Bacteria 4822
134 Ga0207691_10250063 3300025940 Unclassified 1530
135 Ga0207711_10380133 3300025941 Bacteria 1310
136 Ga0207667_10658662 3300025949 Bacteria 1052
137 Ga0207640_10427683 3300025981 Bacteria 1085
138 Ga0207658_10008457 3300025986 Bacteria 7004
139 Ga0207703_10089267 3300026035 Bacteria 2588
140 Ga0207703_10311134 3300026035 Bacteria 1440
141 Ga0207639_10111099 3300026041 Bacteria 2234
142 Ga0207702_10017677 3300026078 Bacteria 5901
143 Ga0207641_10000431 3300026088 Bacteria 48383
144 Ga0207648_10060833 3300026089 Bacteria 3293
145 Ga0207675_100016294 3300026118 Bacteria 6938
146 Ga0207428_10000019 3300027907 Bacteria 276945
147 Ga0207428_10028372 3300027907 Bacteria 4650
148 Ga0207428_10150902 3300027907 Bacteria 1769
149 Ga0207428_10269989 3300027907 Bacteria 1265
150 Ga0268266_10342560 3300028379 Bacteria 1403
151 Ga0268265_10099868 3300028380 Bacteria 2341
152 Ga0268264_10031939 3300028381 Bacteria 4319
153 Ga0268264_10260047 3300028381 Bacteria 1616
154 Ga0307408_100006456 3300031548 Bacteria 7775
155 Ga0307408_100015445 3300031548 Bacteria 5083
156 Ga0307408_100337331 3300031548 Bacteria 1275
157 Ga0316578_10276312 3300031728 Bacteria 1006
158 Ga0307405_10224485 3300031731 Bacteria 1380
159 Ga0307413_10038589 3300031824 Bacteria 2770
160 Ga0307413_10221570 3300031824 Bacteria 1382
161 Ga0307410_10019913 3300031852 Bacteria 4093
162 Ga0307410_10022083 3300031852 Bacteria 3927
163 Ga0307406_10021221 3300031901 Bacteria 3839
164 Ga0307407_10008274 3300031903 Bacteria 4765
165 Ga0307407_10025092 3300031903 Bacteria 3137
166 Ga0307407_10173721 3300031903 Bacteria 1422
167 Ga0307412_10018299 3300031911 Bacteria 4213
168 Ga0307409_100030659 3300031995 Bacteria 3867
169 Ga0307409_100201154 3300031995 Bacteria 1782
170 Ga0307409_100277067 3300031995 Bacteria 1548
171 Ga0307409_100419706 3300031995 Bacteria 1283
172 Ga0307416_100039976 3300032002 Bacteria 3637
173 Ga0307416_100060138 3300032002 Bacteria 3092
174 Ga0307411_10005703 3300032005 Bacteria 6150
175 Ga0307411_10016800 3300032005 Bacteria 4150
176 Ga0307411_10162948 3300032005 Bacteria 1673
177 Ga0307411_10266879 3300032005 Bacteria 1355
178 Ga0307411_10498122 3300032005 Bacteria 1029
179 Ga0307415_100060594 3300032126 Bacteria 2616
180 Ga0307415_100167617 3300032126 Bacteria 1709
181 Ga0373930_0005872 3300034816 Bacteria 2056
182 Ga0373938_0000670 3300034957 Bacteria 5489
183 Ga0373929_0000990 3300035085 Bacteria 5517
184 Ga0373940_0000344 3300035088 Bacteria 6919
185 Ga0373951_0048021 3300035091 Bacteria 1044
186 Ga0373952_0000050 3300035092 Bacteria 14460
187 Ga0373932_0001217 3300035112 Bacteria 7308
188 Ga0373941_0005589 3300035115 Bacteria 2969
189 Ga0373954_0059108 3300035118 Bacteria 1807
190 Ga0373956_0160200 3300035119 Bacteria 1060
191 Ga0373960_0000734 3300035121 Bacteria 6848
192 Ga0373943_0022215 3300035170 Bacteria 2937
193 Ga0373962_0000398 3300035242 Bacteria 9512
194 Ga0373924_0036742 3300035410 Bacteria 1992
195 Ga0373927_0010905 3300035695 Bacteria 6051
196 Ga0373947_0105495 3300035725 Bacteria 1775
197 Ga0373937_0214745 3300036401 Bacteria 1810
198 Ga0373937_0474497 3300036401 Bacteria 1188
199 Ga0373925_0000987 3300037068 Bacteria 25925
200 Ga0373925_0457091 3300037068 Bacteria 1046
201 Ga0436365_1091994 3300039437 Bacteria 2187
202 Ga0439453_0014556 3300041408 Bacteria 1350
203 Ga0439434_0025842 3300042435 Bacteria 1773
204 Ga0439435_0004604 3300042436 Bacteria 2983
205 Ga0451577_0072866 3300042876 Bacteria 3065
206 Ga0466963_0133008 3300044694 Bacteria 1719
207 Ga0453684_0028137 3300044712 Bacteria 8035
208 Ga0451576_0072441 3300045051 Bacteria 3585
209 Ga0451576_0434324 3300045051 Bacteria 1378
210 Ga0495592_0012201 3300046454 Bacteria 6521
211 Ga0495629_0242826 3300046459 Bacteria 1240
212 Ga0495580_0043139 3300046472 Bacteria 3211
213 Ga0495662_0133143 3300046476 Bacteria 1223
214 Ga0495664_0072936 3300046477 Bacteria 2052
215 Ga0495664_0147558 3300046477 Bacteria 1427
216 Ga0495594_0160567 3300046499 Bacteria 1278
217 Ga0495608_0035230 3300046511 Bacteria 3377
218 Ga0495628_0010696 3300046516 Bacteria 7770
219 Ga0495630_0029770 3300046517 Bacteria 4059
220 Ga0495645_0001334 3300046543 Bacteria 16733
221 Ga0495645_0010248 3300046543 Bacteria 6568
222 Ga0495634_0091944 3300046642 Bacteria 1969
223 Ga0495635_0250639 3300046663 Bacteria 1194
224 Ga0495599_0142300 3300046678 Bacteria 1487
225 Ga0495646_0060978 3300046680 Bacteria 2248
226 Ga0495647_0008427 3300046681 Bacteria 3468
227 Ga0495658_0065879 3300046683 Bacteria 2091
228 Ga0495613_0060272 3300046689 Bacteria 2780
229 Ga0495600_0033752 3300046809 Bacteria 3322
230 Ga0495674_0055450 3300047319 Bacteria 3476
231 Ga0495684_0006668 3300047471 Bacteria 8958
232 Ga0495684_0100341 3300047471 Bacteria 2189
233 Ga0496101_0000451 3300048904 Bacteria 26069
234 Ga0496102_0163838 3300048905 Bacteria 2092
235 Ga0496102_0184204 3300048905 Bacteria 1967
236 Ga0496104_0061033 3300048907 Bacteria 3573
237 Ga0496106_0110988 3300048909 Bacteria 2135
238 Ga0496106_0394193 3300048909 Bacteria 1113
239 Ga0496110_0306705 3300048913 Bacteria 1446
240 Ga0496110_0520515 3300048913 Bacteria 1082
241 Ga0496112_0183202 3300048915 Bacteria 2058
242 Ga0496114_0001764 3300048917 Bacteria 16428
243 Ga0496114_0085458 3300048917 Bacteria 2672
244 Ga0501031_0073151 3300049568 Bacteria 2232
245 Ga0501033_0148859 3300049570 Bacteria 1690
246 Ga0501036_0117541 3300049572 Unclassified 2246
247 Ga0501040_0055193 3300049576 Unclassified 2724
248 Ga0501040_0067266 3300049576 Bacteria 2469
249 Ga0501040_0333657 3300049576 Bacteria 1085
250 Ga0501041_0057384 3300049577 Unclassified 2381
251 Ga0501041_0127526 3300049577 Bacteria 1584
252 Ga0501042_0200137 3300049578 Bacteria 1440
253 Ga0501048_0075355 3300049582 Bacteria 2380
254 Ga0501071_0348861 3300049587 Bacteria 1126
255 Ga0501071_0487651 3300049587 Bacteria 945
256 Ga0501072_0051626 3300049588 Bacteria 3237
257 Ga0501072_0175364 3300049588 Bacteria 1710
258 Ga0501073_0213615 3300049589 Bacteria 1333
259 Ga0501074_0044787 3300049590 Bacteria 3202
260 Ga0501074_0209489 3300049590 Bacteria 1389
261 Ga0501075_0005055 3300049591 Bacteria 9009
262 Ga0501075_0006201 3300049591 Bacteria 8217
263 Ga0501076_0003268 3300049592 Bacteria 11350
264 Ga0501076_0126564 3300049592 Unclassified 2070
265 Ga0501076_0134404 3300049592 Bacteria 2008
266 Ga0501076_0202260 3300049592 Bacteria 1622
267 Ga0501076_0286887 3300049592 Bacteria 1349
268 Ga0501076_0337040 3300049592 Bacteria 1237
269 Ga0501221_041859 3300049704 Bacteria 1002
270 Ga0501225_0078089 3300049705 Bacteria 948
271 Ga0501079_0148473 3300049741 Unclassified 1827
272 Ga0501080_0142866 3300049742 Unclassified 2213
273 Ga0501081_0003823 3300049743 Bacteria 9643
274 Ga0501081_0112399 3300049743 Bacteria 1934
275 Ga0501045_0088726 3300049824 Unclassified 2284
276 Ga0501045_0138838 3300049824 Bacteria 1807
277 Ga0501045_0162558 3300049824 Bacteria 1662
278 Ga0501045_0205598 3300049824 Bacteria 1467
279 nmdc:mga03683_128939_c1 3300050489 Bacteria 1130
280 nmdc:mga0k408_6152_c1 3300050493 Bacteria 6401
281 nmdc:mga05p37_72417_c1 3300050507 Bacteria 4240
282 nmdc:mga06r32_38767_c1 3300050510 Bacteria 4517
283 nmdc:mga06r32_72489_c1 3300050510 Bacteria 3334
284 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
285 nmdc:mga08y16_182335_c1 3300050511 Bacteria 2180
286 nmdc:mga08y16_266490_c1 3300050511 Bacteria 1769
287 nmdc:mga08y16_34056_c1 3300050511 Bacteria 5350
288 nmdc:mga08y16_8901_c1 3300050511 Bacteria 10540
289 nmdc:mga0n895_111_c1 3300050512 Bacteria 48235
290 nmdc:mga0n895_139113_c1 3300050512 Bacteria 2455
291 nmdc:mga0n895_240185_c1 3300050512 Bacteria 1838
292 nmdc:mga0n895_6455_c1 3300050512 Bacteria 9957
293 nmdc:mga0rr50_114742_c1 3300050513 Bacteria 2137
294 nmdc:mga0rr50_45818_c1 3300050513 Bacteria 3217
295 nmdc:mga0rr50_57_c1 3300050513 Bacteria 67718
296 nmdc:mga08x19_132864_c1 3300050514 Bacteria 1675
297 nmdc:mga08x19_152191_c1 3300050514 Bacteria 1567
298 nmdc:mga08x19_250110_c1 3300050514 Bacteria 1224
299 nmdc:mga08x19_426_c1 3300050514 Bacteria 28960
300 nmdc:mga0a205_13339_c1 3300050515 Bacteria 7645
301 Ga0495601_0046084 3300053077 Bacteria 2744
302 Ga0495601_0047119 3300053077 Bacteria 2713
303 Ga0495601_0117881 3300053077 Bacteria 1723
304 Ga0495619_0001542 3300053085 Bacteria 15176
305 Ga0501084_0056044 3300054114 Bacteria 3297
306 Ga0501084_0120869 3300054114 Unclassified 2202
307 Ga0501084_0144436 3300054114 Bacteria 2004
308 Ga0590071_001570 3300059421 Bacteria 5976
309 Ga0590071_002322 3300059421 Bacteria 4808
310 Ga0590074_000742 3300059423 Bacteria 4983
311 Ga0590074_015863 3300059423 Bacteria 1280
312 Ga0590075_003338 3300059424 Bacteria 3823
313 Ga0590075_007306 3300059424 Bacteria 2623
314 Ga0590077_000003 3300059426 Bacteria 50145
315 Ga0590077_000937 3300059426 Bacteria 7455
316 Ga0501082_0026477 3300060353 Bacteria 4998
317 Ga0501082_0063038 3300060353 Unclassified 3192
318 Ga0501082_0148169 3300060353 Bacteria 2038
319 Ga0501082_0413161 3300060353 Bacteria 1178
320 Ga0530510_0022920 3300061734 Bacteria 4449
321 Ga0530510_0061569 3300061734 Bacteria 2717
322 Ga0530510_0368614 3300061734 Bacteria 1080
323 nmdc:mga08x19_168009_c1
324 Ga0065715_10099907
325 Ga0065715_10132716
326 Ga0065707_10001222
327 Ga0070670_100020899
328 Ga0070680_100261123
329 Ga0068868_100012388
330 Ga0070660_100249081
331 Ga0070689_100055437
332 Ga0070689_100647352
333 Ga0070661_100010982
334 Ga0070668_100398840
335 Ga0070669_100110938
336 Ga0070671_100041373
337 Ga0070674_100216967
338 Ga0070674_100339782
339 Ga0070673_100153572
340 Ga0070673_100514901
341 Ga0070688_100123876
342 Ga0070688_100154819
343 Ga0070659_100057597
344 Ga0070667_100008245
345 Ga0070711_100028763
346 Ga0070705_100029909
347 Ga0070705_100192621
348 Ga0070681_10181521
349 Ga0068867_100050010
350 Ga0070707_100028528
351 Ga0070699_100307867
352 Ga0070679_100454195
353 Ga0070684_100529867
354 Ga0070697_100043271
355 Ga0070697_100229724
356 Ga0068853_100235602
357 Ga0068853_100703136
358 Ga0070672_100064167
359 Ga0070672_100246738
360 Ga0070686_100001456
361 Ga0070695_100023654
362 Ga0070696_100226381
363 Ga0070665_100046853
364 Ga0070704_100073670
365 Ga0068855_100279548
366 Ga0068856_100021485
367 Ga0068859_100476803
368 Ga0068861_100021177
369 Ga0068863_100001594
370 Ga0068858_100047926
371 Ga0068860_100013508
372 Ga0068860_100591369
373 Ga0068862_100058521
374 Ga0068862_100163108
375 Ga0081455_10030568
376 Ga0081455_10105298
377 Ga0075366_10010373
378 Ga0097621_100000820
379 Ga0097621_100005002
380 Ga0097621_100485985
381 Ga0068871_100000748
382 Ga0068871_100016047
383 Ga0068871_100124803
384 Ga0068871_100256178
385 Ga0068871_100256831
386 Ga0075428_100000005
387 Ga0075428_100216788
388 Ga0075431_100097374
389 Ga0075434_100000100
390 Ga0075434_100024212
391 Ga0075434_100208640
392 Ga0075434_100645813
393 Ga0068865_100073581
394 Ga0068865_100286404
395 Ga0075436_100000583
396 Ga0075436_100122227
397 Ga0097620_100476824
398 Ga0075435_100000192
399 Ga0075435_100029366
400 Ga0075435_100150002
401 Ga0075435_100295428
402 Ga0105240_10064661
403 Ga0111539_10000008
404 Ga0111539_10003965
405 Ga0111539_10012733
406 Ga0111539_10015361
407 Ga0111539_10016316
408 Ga0111539_10365541
409 Ga0111539_10562840
410 Ga0111539_10654177
411 Ga0105245_10119698
412 Ga0114129_10013888
413 Ga0114129_10087158
414 Ga0105243_10280410
415 Ga0105242_10014046
416 Ga0105242_10055861
417 Ga0105242_10067335
418 Ga0105242_10325158
419 Ga0105248_10020727
420 Ga0105248_10149341
421 Ga0105249_10159121
422 Ga0105239_10454065
423 Ga0105246_10302610
424 Ga0157374_10046922
425 Ga0157378_10001160
426 Ga0157378_10161480
427 Ga0163162_10082770
428 Ga0163162_10104036
429 Ga0157372_10242589
430 Ga0157375_10309946
431 Ga0157380_10192058
432 Ga0157379_10003996
433 Ga0157376_10003823
434 Ga0157376_10074399
435 Ga0157376_10238855
436 Ga0207707_10099744
437 Ga0207695_10082960
438 Ga0207663_10152488
439 Ga0207662_10157854
440 Ga0207649_10117169
441 Ga0207646_10025847
442 Ga0207681_10030553
443 Ga0207681_10364919
444 Ga0207650_10056183
445 Ga0207687_10023246
446 Ga0207687_10038020
447 Ga0207644_10004449
448 Ga0207690_10064163
449 Ga0207706_10162801
450 Ga0207686_10047651
451 Ga0207686_10127429
452 Ga0207670_10036496
453 Ga0207704_10119903
454 Ga0207704_10155109
455 Ga0207691_10033013
456 Ga0207691_10250063
457 Ga0207711_10380133
458 Ga0207667_10658662
459 Ga0207640_10427683
460 Ga0207658_10008457
461 Ga0207703_10089267
462 Ga0207703_10311134
463 Ga0207639_10111099
464 Ga0207702_10017677
465 Ga0207641_10000431
466 Ga0207648_10060833
467 Ga0207675_100016294
468 Ga0207428_10000019
469 Ga0207428_10028372
470 Ga0207428_10150902
471 Ga0207428_10269989
472 Ga0268266_10342560
473 Ga0268265_10099868
474 Ga0268264_10031939
475 Ga0268264_10260047
476 Ga0307408_100006456
477 Ga0307408_100015445
478 Ga0307408_100337331
479 Ga0316578_10276312
480 Ga0307405_10224485
481 Ga0307413_10038589
482 Ga0307413_10221570
483 Ga0307410_10019913
484 Ga0307410_10022083
485 Ga0307406_10021221
486 Ga0307407_10008274
487 Ga0307407_10025092
488 Ga0307407_10173721
489 Ga0307412_10018299
490 Ga0307409_100030659
491 Ga0307409_100201154
492 Ga0307409_100277067
493 Ga0307409_100419706
494 Ga0307416_100039976
495 Ga0307416_100060138
496 Ga0307411_10005703
497 Ga0307411_10016800
498 Ga0307411_10162948
499 Ga0307411_10266879
500 Ga0307411_10498122
501 Ga0307415_100060594
502 Ga0307415_100167617
503 Ga0373930_0005872
504 Ga0373938_0000670
505 Ga0373929_0000990
506 Ga0373940_0000344
507 Ga0373951_0048021
508 Ga0373952_0000050
509 Ga0373932_0001217
510 Ga0373941_0005589
511 Ga0373954_0059108
512 Ga0373956_0160200
513 Ga0373960_0000734
514 Ga0373943_0022215
515 Ga0373962_0000398
516 Ga0373924_0036742
517 Ga0373927_0010905
518 Ga0373947_0105495
519 Ga0373937_0214745
520 Ga0373937_0474497
521 Ga0373925_0000987
522 Ga0373925_0457091
523 Ga0436365_1091994
524 Ga0439453_0014556
525 Ga0439434_0025842
526 Ga0439435_0004604
527 Ga0451577_0072866
528 Ga0466963_0133008
529 Ga0453684_0028137
530 Ga0451576_0072441
531 Ga0451576_0434324
532 Ga0495592_0012201
533 Ga0495629_0242826
534 Ga0495580_0043139
535 Ga0495662_0133143
536 Ga0495664_0072936
537 Ga0495664_0147558
538 Ga0495594_0160567
539 Ga0495608_0035230
540 Ga0495628_0010696
541 Ga0495630_0029770
542 Ga0495645_0001334
543 Ga0495645_0010248
544 Ga0495634_0091944
545 Ga0495635_0250639
546 Ga0495599_0142300
547 Ga0495646_0060978
548 Ga0495647_0008427
549 Ga0495658_0065879
550 Ga0495613_0060272
551 Ga0495600_0033752
552 Ga0495674_0055450
553 Ga0495684_0006668
554 Ga0495684_0100341
555 Ga0496101_0000451
556 Ga0496102_0163838
557 Ga0496102_0184204
558 Ga0496104_0061033
559 Ga0496106_0110988
560 Ga0496106_0394193
561 Ga0496110_0306705
562 Ga0496110_0520515
563 Ga0496112_0183202
564 Ga0496114_0001764
565 Ga0496114_0085458
566 Ga0501031_0073151
567 Ga0501033_0148859
568 Ga0501036_0117541
569 Ga0501040_0055193
570 Ga0501040_0067266
571 Ga0501040_0333657
572 Ga0501041_0057384
573 Ga0501041_0127526
574 Ga0501042_0200137
575 Ga0501048_0075355
576 Ga0501071_0348861
577 Ga0501071_0487651
578 Ga0501072_0051626
579 Ga0501072_0175364
580 Ga0501073_0213615
581 Ga0501074_0044787
582 Ga0501074_0209489
583 Ga0501075_0005055
584 Ga0501075_0006201
585 Ga0501076_0003268
586 Ga0501076_0126564
587 Ga0501076_0134404
588 Ga0501076_0202260
589 Ga0501076_0286887
590 Ga0501076_0337040
591 Ga0501221_041859
592 Ga0501225_0078089
593 Ga0501079_0148473
594 Ga0501080_0142866
595 Ga0501081_0003823
596 Ga0501081_0112399
597 Ga0501045_0088726
598 Ga0501045_0138838
599 Ga0501045_0162558
600 Ga0501045_0205598
601 nmdc:mga03683_128939_c1
602 nmdc:mga0k408_6152_c1
603 nmdc:mga05p37_72417_c1
604 nmdc:mga06r32_38767_c1
605 nmdc:mga06r32_72489_c1
606 nmdc:mga08y16_17_c1
607 nmdc:mga08y16_182335_c1
608 nmdc:mga08y16_266490_c1
609 nmdc:mga08y16_34056_c1
610 nmdc:mga08y16_8901_c1
611 nmdc:mga0n895_111_c1
612 nmdc:mga0n895_139113_c1
613 nmdc:mga0n895_240185_c1
614 nmdc:mga0n895_6455_c1
615 nmdc:mga0rr50_114742_c1
616 nmdc:mga0rr50_45818_c1
617 nmdc:mga0rr50_57_c1
618 nmdc:mga08x19_132864_c1
619 nmdc:mga08x19_152191_c1
620 nmdc:mga08x19_250110_c1
621 nmdc:mga08x19_426_c1
622 nmdc:mga0a205_13339_c1
623 Ga0495601_0046084
624 Ga0495601_0047119
625 Ga0495601_0117881
626 Ga0495619_0001542
627 Ga0501084_0056044
628 Ga0501084_0120869
629 Ga0501084_0144436
630 Ga0590071_001570
631 Ga0590071_002322
632 Ga0590074_000742
633 Ga0590074_015863
634 Ga0590075_003338
635 Ga0590075_007306
636 Ga0590077_000003
637 Ga0590077_000937
638 Ga0501082_0026477
639 Ga0501082_0063038
640 Ga0501082_0148169
641 Ga0501082_0413161
642 Ga0530510_0022920
643 Ga0530510_0061569
644 Ga0530510_0368614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

56

311

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6muj-assembly1.cif.gz_A formylglycine generating enzyme bound to copper 0.8254 3 261
5nyy-assembly1.cif.gz_A formylglycine generating enzyme from t. curvata in complex with cd(ii) 0.8197 6 259
6muj-assembly1.cif.gz_A formylglycine generating enzyme bound to copper 0.8168 3 261
6xtn-assembly1.cif.gz_A crystal structure reveals non-coordinative binding of o2 to the copper center of the formylglycine-generating enzyme - fge:ag:s:no complex 0.8113 6 259
8aru-assembly1.cif.gz_A crystal structure of human formylglycine generating enzyme 0.8039 2 259
ID Description Score Start End Superfamily
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7924 2 261 3.90.1580.10
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7866 2 261 3.90.1580.10
2y3cA00 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7609 7 259 3.90.1580.10
af_Q8NBJ7_27_294_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7441 6 259 3.90.1580.10
2y3cA00 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7358 7 259 3.90.1580.10
ID Description Score Start End GO Terms
AF-A0A2V8BBW3-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9851 5 259 GO:0120147
AF-A0A1F2TS95-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9803 1 257 GO:0120147
AF-A0A661KIC4-F1-model_v4 Formylglycine-generating enzyme family protein 0.9675 7 260 GO:0120147
AF-A0A1F2TS95-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9618 1 257 GO:0120147
AF-A0A2V8BBW3-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.959 5 259 GO:0120147

Map