F406621

General Info

Members Datasets Scaffolds Average Seq Length
322 204 644 303

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0308904|Ga0496115_0308904_52_1056
Length 334
Sequence MSDRVVEVRDLRKSYGDVEAVRGISFHVDHGEVFAMLGPNGAGKTTTTEILEGYRTRSAGDVTVLGHDPAKRERSLKERVGIVLQSTGIDPFLTVTETIEMYAGYYPSRRPTGEVIEVVGLAEKRDTRVNKLSGGQQRRLDVAIALAGDPELLFLDEPTTGFDPNARRNAWEVVKNLVALGKTVFLTTHFMDEAQYLADRVVVIADGLIVAEGPPASIAGREQMRTRIRFRLPNGAPDPDDRVRRLPDGTYELQVEANETTKTVHDLTGWALDRGFELEAFEITLPTLEDVYLQLTGAEVGTCTTSRSPPGRFATRTGRSGGTRRQRSSPSRSR

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
108 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
204 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.97
Rhizosphere 95.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0308904 3300048918 Bacteria 1295
2 JGI24751J29686_10000361 3300002459 Bacteria 15810
3 Ga0070676_10198615 3300005328 Bacteria 1313
4 Ga0070690_100165360 3300005330 Bacteria 1519
5 Ga0070670_100045449 3300005331 Bacteria 3775
6 Ga0068869_100048299 3300005334 Bacteria 3077
7 Ga0068868_100009686 3300005338 Bacteria 6951
8 Ga0070691_10207141 3300005341 Bacteria 1033
9 Ga0070661_100065220 3300005344 Bacteria 2675
10 Ga0070692_10053359 3300005345 Bacteria 2108
11 Ga0070692_10075865 3300005345 Bacteria 1801
12 Ga0070675_100026331 3300005354 Bacteria 4668
13 Ga0070675_100266085 3300005354 Bacteria 1503
14 Ga0070659_100057233 3300005366 Bacteria 3074
15 Ga0070703_10000025 3300005406 Bacteria 73971
16 Ga0070701_10018065 3300005438 Bacteria 3309
17 Ga0070705_100025789 3300005440 Bacteria 3191
18 Ga0070705_100154686 3300005440 Bacteria 1526
19 Ga0070705_100309112 3300005440 Bacteria 1136
20 Ga0070700_100014742 3300005441 Bacteria 4417
21 Ga0070700_100055135 3300005441 Bacteria 2487
22 Ga0070694_100004047 3300005444 Bacteria 8786
23 Ga0070708_100001184 3300005445 Bacteria 20038
24 Ga0070708_100004124 3300005445 Bacteria 11408
25 Ga0070678_100009712 3300005456 Bacteria 5846
26 Ga0070706_100000161 3300005467 Bacteria 85173
27 Ga0070706_100003009 3300005467 Bacteria 16702
28 Ga0070706_100204175 3300005467 Bacteria 1846
29 Ga0070707_100000062 3300005468 Bacteria 96912
30 Ga0070707_100001702 3300005468 Bacteria 21201
31 Ga0070707_100007624 3300005468 Bacteria 10049
32 Ga0070707_100029642 3300005468 Bacteria 5209
33 Ga0070698_100001516 3300005471 Bacteria 25740
34 Ga0070698_100006430 3300005471 Bacteria 12740
35 Ga0070698_100021319 3300005471 Bacteria 6788
36 Ga0070698_100026993 3300005471 Bacteria 5971
37 Ga0070698_100048143 3300005471 Bacteria 4356
38 Ga0070698_100149286 3300005471 Bacteria 2286
39 Ga0070699_100000070 3300005518 Bacteria 96912
40 Ga0070699_100060472 3300005518 Bacteria 3283
41 Ga0070684_100341848 3300005535 Bacteria 1376
42 Ga0070697_100158727 3300005536 Bacteria 1910
43 Ga0070697_100229422 3300005536 Bacteria 1583
44 Ga0070686_100176652 3300005544 Bacteria 1514
45 Ga0070696_100097571 3300005546 Bacteria 2101
46 Ga0070696_100443695 3300005546 Bacteria 1023
47 Ga0070693_100007427 3300005547 Bacteria 5358
48 Ga0070704_100002076 3300005549 Bacteria 11130
49 Ga0070704_100185508 3300005549 Bacteria 1667
50 Ga0070664_100005388 3300005564 Bacteria 10270
51 Ga0068857_100309253 3300005577 Bacteria 1458
52 Ga0068856_100482453 3300005614 Bacteria 1261
53 Ga0068852_100311266 3300005616 Bacteria 1527
54 Ga0068864_100026383 3300005618 Bacteria 4901
55 Ga0068864_100331589 3300005618 Bacteria 1432
56 Ga0068866_10035001 3300005718 Bacteria 2450
57 Ga0068861_100015946 3300005719 Bacteria 5305
58 Ga0068851_10043714 3300005834 Bacteria 2258
59 Ga0068870_10000167 3300005840 Bacteria 23422
60 Ga0068863_100002447 3300005841 Bacteria 18442
61 Ga0068863_100407239 3300005841 Bacteria 1331
62 Ga0081455_10003651 3300005937 Bacteria 17630
63 Ga0081455_10014688 3300005937 Bacteria 7650
64 Ga0081455_10065611 3300005937 Bacteria 3035
65 Ga0081539_10015810 3300005985 Bacteria 5451
66 Ga0081539_10017141 3300005985 Bacteria 5106
67 Ga0081539_10029293 3300005985 Bacteria 3442
68 Ga0070717_10138974 3300006028 Bacteria 2094
69 Ga0070715_10002612 3300006163 Bacteria 5568
70 Ga0070715_10038966 3300006163 Bacteria 1976
71 Ga0070712_100025216 3300006175 Bacteria 3950
72 Ga0075428_100014689 3300006844 Bacteria 8698
73 Ga0075428_100174286 3300006844 Bacteria 2330
74 Ga0075431_100509643 3300006847 Bacteria 1193
75 Ga0075433_10020574 3300006852 Bacteria 5522
76 Ga0075433_10193312 3300006852 Bacteria 1810
77 Ga0075434_100000420 3300006871 Bacteria 31423
78 Ga0075434_100005421 3300006871 Bacteria 11613
79 Ga0075434_100019227 3300006871 Bacteria 6608
80 Ga0075429_100043210 3300006880 Bacteria 3921
81 Ga0068865_100105183 3300006881 Bacteria 2073
82 Ga0075436_100094353 3300006914 Bacteria 2081
83 Ga0075436_100106221 3300006914 Bacteria 1958
84 Ga0075435_100008754 3300007076 Bacteria 7284
85 Ga0111539_10068303 3300009094 Bacteria 4196
86 Ga0111539_10108868 3300009094 Bacteria 3252
87 Ga0111539_10110371 3300009094 Bacteria 3228
88 Ga0111539_10236584 3300009094 Bacteria 2126
89 Ga0105245_10050358 3300009098 Bacteria 3733
90 Ga0114129_10001302 3300009147 Bacteria 33282
91 Ga0114129_10004131 3300009147 Bacteria 20513
92 Ga0114129_10031186 3300009147 Bacteria 7538
93 Ga0114129_10041501 3300009147 Bacteria 6483
94 Ga0105243_10004779 3300009148 Bacteria 10648
95 Ga0105243_10020315 3300009148 Bacteria 5036
96 Ga0105243_10025027 3300009148 Bacteria 4558
97 Ga0105243_10054173 3300009148 Bacteria 3183
98 Ga0105242_10006356 3300009176 Bacteria 9095
99 Ga0105242_10079680 3300009176 Bacteria 2736
100 Ga0105248_10035421 3300009177 Bacteria 5583
101 Ga0105249_10013376 3300009553 Bacteria 7248
102 Ga0105249_10199093 3300009553 Bacteria 1959
103 Ga0105246_10009204 3300011119 Bacteria 6080
104 Ga0105246_10190774 3300011119 Bacteria 1586
105 Ga0157374_10021980 3300013296 Bacteria 5684
106 Ga0157374_10111879 3300013296 Bacteria 2627
107 Ga0157375_10033855 3300013308 Bacteria 4860
108 Ga0157375_10053385 3300013308 Bacteria 3976
109 Ga0163163_10025226 3300014325 Bacteria 5667
110 Ga0163163_10176494 3300014325 Bacteria 2183
111 Ga0157380_10461156 3300014326 Bacteria 1223
112 Ga0207656_10041618 3300025321 Bacteria 1953
113 Ga0207653_10000010 3300025885 Bacteria 165368
114 Ga0207688_10012308 3300025901 Bacteria 4656
115 Ga0207688_10034293 3300025901 Bacteria 2810
116 Ga0207647_10006372 3300025904 Bacteria 8583
117 Ga0207685_10001954 3300025905 Bacteria 4564
118 Ga0207685_10050866 3300025905 Bacteria 1598
119 Ga0207643_10000262 3300025908 Bacteria 36583
120 Ga0207684_10000160 3300025910 Bacteria 115343
121 Ga0207684_10000192 3300025910 Bacteria 96931
122 Ga0207684_10008399 3300025910 Bacteria 9181
123 Ga0207693_10022583 3300025915 Bacteria 4999
124 Ga0207693_10045408 3300025915 Bacteria 3452
125 Ga0207663_10030619 3300025916 Bacteria 3176
126 Ga0207649_10038093 3300025920 Bacteria 2909
127 Ga0207652_10510903 3300025921 Bacteria 1081
128 Ga0207646_10000144 3300025922 Bacteria 96931
129 Ga0207646_10000382 3300025922 Bacteria 59480
130 Ga0207646_10018680 3300025922 Bacteria 6464
131 Ga0207646_10214069 3300025922 Bacteria 1740
132 Ga0207646_10215679 3300025922 Bacteria 1733
133 Ga0207650_10004969 3300025925 Bacteria 9088
134 Ga0207650_10071415 3300025925 Bacteria 2611
135 Ga0207687_10019159 3300025927 Bacteria 4532
136 Ga0207644_10022661 3300025931 Bacteria 4293
137 Ga0207690_10034859 3300025932 Bacteria 3246
138 Ga0207686_10130930 3300025934 Bacteria 1720
139 Ga0207709_10067367 3300025935 Bacteria 2259
140 Ga0207689_10009389 3300025942 Bacteria 8448
141 Ga0207689_10282585 3300025942 Bacteria 1374
142 Ga0207679_10082295 3300025945 Bacteria 2464
143 Ga0207712_10018807 3300025961 Bacteria 4504
144 Ga0207712_10075064 3300025961 Bacteria 2443
145 Ga0207677_10008503 3300026023 Bacteria 5738
146 Ga0207703_10522478 3300026035 Bacteria 1117
147 Ga0207708_10017504 3300026075 Bacteria 5395
148 Ga0207708_10035900 3300026075 Bacteria 3771
149 Ga0207676_10000365 3300026095 Bacteria 38642
150 Ga0207676_10059871 3300026095 Bacteria 3009
151 Ga0207674_10000382 3300026116 Bacteria 57645
152 Ga0207675_100012004 3300026118 Bacteria 8096
153 Ga0207675_100087111 3300026118 Bacteria 2933
154 Ga0207428_10000591 3300027907 Bacteria 42796
155 Ga0207428_10126625 3300027907 Bacteria 1956
156 Ga0268264_10085627 3300028381 Bacteria 2705
157 Ga0265338_10163320 3300028800 Bacteria 1717
158 Ga0265320_10067889 3300031240 Bacteria 1686
159 Ga0265325_10066533 3300031241 Bacteria 1816
160 Ga0265340_10082344 3300031247 Bacteria 1513
161 Ga0265339_10010890 3300031249 Bacteria 5622
162 Ga0265331_10111285 3300031250 Bacteria 1256
163 Ga0265316_10054961 3300031344 Bacteria 3116
164 Ga0265313_10032678 3300031595 Bacteria 2653
165 Ga0265342_10055213 3300031712 Bacteria 2358
166 Ga0307416_100822067 3300032002 Bacteria 1026
167 Ga0373926_0001070 3300035083 Bacteria 8049
168 Ga0373923_0009512 3300035111 Bacteria 3510
169 Ga0373936_0001879 3300035113 Bacteria 7750
170 Ga0373939_0001323 3300035114 Bacteria 6018
171 Ga0373960_0012945 3300035121 Bacteria 2083
172 Ga0373943_0055033 3300035170 Bacteria 1969
173 Ga0373946_0001873 3300035171 Bacteria 7346
174 Ga0373955_0218260 3300035172 Bacteria 1138
175 Ga0373931_0022355 3300035691 Bacteria 3183
176 Ga0373935_0016739 3300035692 Bacteria 4437
177 Ga0373925_0006479 3300037068 Bacteria 8610
178 Ga0395899_0014635 3300037312 Bacteria 5988
179 Ga0395900_0003236 3300037418 Bacteria 17630
180 Ga0395900_0059844 3300037418 Bacteria 3921
181 Ga0395900_0341836 3300037418 Bacteria 1472
182 Ga0395898_0004288 3300037466 Bacteria 15627
183 Ga0395898_0140817 3300037466 Bacteria 2309
184 Ga0395898_0221375 3300037466 Bacteria 1805
185 Ga0395905_0002848 3300037471 Bacteria 18910
186 Ga0395905_0148829 3300037471 Bacteria 2203
187 Ga0395905_0158500 3300037471 Bacteria 2128
188 Ga0395901_0001624 3300038443 Bacteria 23244
189 Ga0395901_0001696 3300038443 Bacteria 22740
190 Ga0395901_0063310 3300038443 Bacteria 3849
191 Ga0395901_0064081 3300038443 Bacteria 3825
192 Ga0395901_0101194 3300038443 Bacteria 3024
193 Ga0395901_0386327 3300038443 Bacteria 1440
194 Ga0439464_0032363 3300042439 Bacteria 1470
195 Ga0466967_0142372 3300045976 Bacteria 2234
196 Ga0466967_0154464 3300045976 Bacteria 2148
197 Ga0466967_0227766 3300045976 Bacteria 1774
198 Ga0466967_0356695 3300045976 Bacteria 1416
199 Ga0495603_0001585 3300046455 Bacteria 13326
200 Ga0495603_0007781 3300046455 Bacteria 6458
201 Ga0495603_0022670 3300046455 Bacteria 3799
202 Ga0495603_0052483 3300046455 Bacteria 2421
203 Ga0495629_0002956 3300046459 Bacteria 12938
204 Ga0495629_0006723 3300046459 Bacteria 8502
205 Ga0495641_0009560 3300046461 Bacteria 5747
206 Ga0495641_0173331 3300046461 Bacteria 965
207 Ga0495582_0000520 3300046473 Bacteria 21190
208 Ga0495605_0070122 3300046474 Bacteria 1658
209 Ga0495639_0021000 3300046475 Bacteria 2856
210 Ga0495664_0139613 3300046477 Bacteria 1469
211 Ga0495584_0090969 3300046491 Bacteria 1539
212 Ga0495585_0049505 3300046492 Bacteria 2333
213 Ga0495594_0047920 3300046499 Bacteria 2347
214 Ga0495630_0021946 3300046517 Bacteria 4715
215 Ga0495637_0034184 3300046520 Bacteria 2228
216 Ga0495663_0010005 3300046525 Bacteria 2632
217 Ga0495666_0006236 3300046526 Bacteria 6006
218 Ga0495665_0001681 3300046531 Bacteria 11879
219 Ga0495665_0013771 3300046531 Bacteria 4368
220 Ga0495640_0008140 3300046533 Bacteria 8233
221 Ga0495586_0003892 3300046535 Bacteria 8000
222 Ga0495598_0003239 3300046537 Bacteria 3441
223 Ga0495667_0034710 3300046559 Bacteria 3372
224 Ga0495656_0040710 3300046615 Bacteria 1938
225 Ga0495656_0065442 3300046615 Bacteria 1598
226 Ga0495634_0004320 3300046642 Bacteria 11198
227 Ga0495611_0104583 3300046648 Bacteria 1317
228 Ga0495635_0001712 3300046663 Bacteria 14760
229 Ga0495588_0005878 3300046674 Bacteria 5497
230 Ga0495658_0000156 3300046683 Bacteria 38011
231 Ga0495658_0000286 3300046683 Bacteria 28512
232 Ga0495613_0000454 3300046689 Bacteria 34974
233 Ga0495613_0233452 3300046689 Bacteria 1288
234 Ga0495670_0060297 3300046691 Bacteria 1906
235 Ga0495581_0012036 3300047315 Bacteria 5006
236 Ga0495581_0029714 3300047315 Bacteria 3167
237 Ga0495636_0108837 3300047318 Bacteria 1218
238 Ga0495674_0000427 3300047319 Bacteria 37853
239 Ga0495676_0047787 3300047321 Bacteria 3456
240 Ga0495676_0095109 3300047321 Bacteria 2218
241 Ga0495680_0008783 3300047322 Bacteria 9155
242 Ga0495593_0020553 3300047673 Bacteria 3697
243 Ga0496101_0021860 3300048904 Bacteria 4397
244 Ga0496101_0154959 3300048904 Bacteria 1754
245 Ga0496102_0042784 3300048905 Bacteria 4106
246 Ga0496106_0015519 3300048909 Bacteria 5636
247 Ga0496107_0085862 3300048910 Bacteria 2296
248 Ga0496108_0044410 3300048911 Bacteria 3710
249 Ga0496108_0064183 3300048911 Bacteria 3093
250 Ga0496108_0339848 3300048911 Bacteria 1310
251 Ga0496109_0114363 3300048912 Bacteria 2510
252 Ga0496110_0055120 3300048913 Bacteria 3498
253 Ga0496110_0353297 3300048913 Bacteria 1339
254 Ga0496111_0011073 3300048914 Bacteria 6070
255 Ga0496111_0091007 3300048914 Bacteria 2235
256 Ga0496112_0075148 3300048915 Bacteria 3342
257 Ga0496114_0018409 3300048917 Bacteria 5646
258 Ga0501031_0024219 3300049568 Bacteria 3957
259 Ga0501036_0026443 3300049572 Bacteria 4898
260 Ga0501036_0416277 3300049572 Bacteria 1120
261 Ga0501037_0020588 3300049573 Bacteria 4871
262 Ga0501038_0044404 3300049574 Bacteria 3861
263 Ga0501039_0020016 3300049575 Bacteria 5129
264 Ga0501039_0146183 3300049575 Bacteria 1857
265 Ga0501040_0004041 3300049576 Bacteria 9535
266 Ga0501040_0018157 3300049576 Bacteria 4671
267 Ga0501040_0028576 3300049576 Bacteria 3760
268 Ga0501040_0038892 3300049576 Bacteria 3235
269 Ga0501041_0016120 3300049577 Bacteria 4438
270 Ga0501042_0001298 3300049578 Bacteria 14558
271 Ga0501043_0137965 3300049579 Bacteria 1910
272 Ga0501046_0023015 3300049580 Bacteria 5129
273 Ga0501048_0047933 3300049582 Bacteria 3047
274 Ga0501067_0151930 3300049583 Bacteria 1290
275 Ga0501068_0080234 3300049584 Bacteria 2001
276 Ga0501069_0111858 3300049585 Bacteria 1555
277 Ga0501069_0127338 3300049585 Bacteria 1457
278 Ga0501070_0002343 3300049586 Bacteria 16630
279 Ga0501070_0089658 3300049586 Bacteria 2545
280 Ga0501071_0100612 3300049587 Bacteria 2130
281 Ga0501072_0251126 3300049588 Bacteria 1409
282 Ga0501073_0218626 3300049589 Bacteria 1316
283 Ga0501074_0053982 3300049590 Bacteria 2898
284 Ga0501074_0138714 3300049590 Bacteria 1739
285 Ga0501075_0067023 3300049591 Bacteria 2710
286 Ga0501075_0296599 3300049591 Bacteria 1231
287 Ga0501076_0047520 3300049592 Bacteria 3393
288 Ga0501077_0008064 3300049593 Bacteria 6510
289 Ga0501077_0011534 3300049593 Bacteria 5521
290 Ga0501079_0002259 3300049741 Bacteria 13896
291 Ga0501080_0001111 3300049742 Bacteria 22170
292 Ga0501080_0064412 3300049742 Bacteria 3409
293 Ga0501080_0078501 3300049742 Bacteria 3070
294 Ga0501044_0171200 3300049823 Bacteria 2143
295 Ga0501045_0018975 3300049824 Bacteria 4897
296 nmdc:mga05p37_15865_c1 3300050507 Bacteria 9061
297 nmdc:mga05p37_17565_c1 3300050507 Bacteria 8637
298 nmdc:mga05p37_22384_c1 3300050507 Bacteria 7666
299 nmdc:mga05p37_23966_c1 3300050507 Bacteria 7411
300 nmdc:mga05p37_24861_c1 3300050507 Bacteria 7282
301 nmdc:mga05p37_33750_c1 3300050507 Bacteria 6268
302 nmdc:mga09592_438425_c1 3300050508 Bacteria 1127
303 nmdc:mga09592_54181_c1 3300050508 Bacteria 3388
304 nmdc:mga0qj67_72783_c1 3300050509 Bacteria 2744
305 nmdc:mga06r32_129092_c1 3300050510 Bacteria 2498
306 nmdc:mga06r32_253835_c1 3300050510 Bacteria 1746
307 nmdc:mga08y16_204403_c1 3300050511 Bacteria 2047
308 nmdc:mga08y16_45595_c1 3300050511 Bacteria 4594
309 nmdc:mga0n895_11968_c1 3300050512 Bacteria 7763
310 nmdc:mga0n895_12562_c1 3300050512 Bacteria 7599
311 nmdc:mga0rr50_191664_c1 3300050513 Bacteria 1676
312 nmdc:mga08x19_32293_c1 3300050514 Bacteria 3298
313 nmdc:mga08x19_75370_c1 3300050514 Bacteria 2205
314 nmdc:mga0a205_39268_c1 3300050515 Bacteria 4557
315 nmdc:mga0a205_8112_c1 3300050515 Bacteria 9543
316 Ga0495619_0008709 3300053085 Bacteria 6416
317 Ga0501084_0431051 3300054114 Bacteria 1114
318 Ga0501082_0026252 3300060353 Bacteria 5018
319 Ga0501082_0208596 3300060353 Bacteria 1700
320 Ga0530510_0028285 3300061734 Bacteria 4019
321 Ga0530510_0342439 3300061734 Bacteria 1122
322 2870631311 2870628048 Bacteria 3696012
323 Ga0496115_0308904
324 JGI24751J29686_10000361
325 Ga0070676_10198615
326 Ga0070690_100165360
327 Ga0070670_100045449
328 Ga0068869_100048299
329 Ga0068868_100009686
330 Ga0070691_10207141
331 Ga0070661_100065220
332 Ga0070692_10053359
333 Ga0070692_10075865
334 Ga0070675_100026331
335 Ga0070675_100266085
336 Ga0070659_100057233
337 Ga0070703_10000025
338 Ga0070701_10018065
339 Ga0070705_100025789
340 Ga0070705_100154686
341 Ga0070705_100309112
342 Ga0070700_100014742
343 Ga0070700_100055135
344 Ga0070694_100004047
345 Ga0070708_100001184
346 Ga0070708_100004124
347 Ga0070678_100009712
348 Ga0070706_100000161
349 Ga0070706_100003009
350 Ga0070706_100204175
351 Ga0070707_100000062
352 Ga0070707_100001702
353 Ga0070707_100007624
354 Ga0070707_100029642
355 Ga0070698_100001516
356 Ga0070698_100006430
357 Ga0070698_100021319
358 Ga0070698_100026993
359 Ga0070698_100048143
360 Ga0070698_100149286
361 Ga0070699_100000070
362 Ga0070699_100060472
363 Ga0070684_100341848
364 Ga0070697_100158727
365 Ga0070697_100229422
366 Ga0070686_100176652
367 Ga0070696_100097571
368 Ga0070696_100443695
369 Ga0070693_100007427
370 Ga0070704_100002076
371 Ga0070704_100185508
372 Ga0070664_100005388
373 Ga0068857_100309253
374 Ga0068856_100482453
375 Ga0068852_100311266
376 Ga0068864_100026383
377 Ga0068864_100331589
378 Ga0068866_10035001
379 Ga0068861_100015946
380 Ga0068851_10043714
381 Ga0068870_10000167
382 Ga0068863_100002447
383 Ga0068863_100407239
384 Ga0081455_10003651
385 Ga0081455_10014688
386 Ga0081455_10065611
387 Ga0081539_10015810
388 Ga0081539_10017141
389 Ga0081539_10029293
390 Ga0070717_10138974
391 Ga0070715_10002612
392 Ga0070715_10038966
393 Ga0070712_100025216
394 Ga0075428_100014689
395 Ga0075428_100174286
396 Ga0075431_100509643
397 Ga0075433_10020574
398 Ga0075433_10193312
399 Ga0075434_100000420
400 Ga0075434_100005421
401 Ga0075434_100019227
402 Ga0075429_100043210
403 Ga0068865_100105183
404 Ga0075436_100094353
405 Ga0075436_100106221
406 Ga0075435_100008754
407 Ga0111539_10068303
408 Ga0111539_10108868
409 Ga0111539_10110371
410 Ga0111539_10236584
411 Ga0105245_10050358
412 Ga0114129_10001302
413 Ga0114129_10004131
414 Ga0114129_10031186
415 Ga0114129_10041501
416 Ga0105243_10004779
417 Ga0105243_10020315
418 Ga0105243_10025027
419 Ga0105243_10054173
420 Ga0105242_10006356
421 Ga0105242_10079680
422 Ga0105248_10035421
423 Ga0105249_10013376
424 Ga0105249_10199093
425 Ga0105246_10009204
426 Ga0105246_10190774
427 Ga0157374_10021980
428 Ga0157374_10111879
429 Ga0157375_10033855
430 Ga0157375_10053385
431 Ga0163163_10025226
432 Ga0163163_10176494
433 Ga0157380_10461156
434 Ga0207656_10041618
435 Ga0207653_10000010
436 Ga0207688_10012308
437 Ga0207688_10034293
438 Ga0207647_10006372
439 Ga0207685_10001954
440 Ga0207685_10050866
441 Ga0207643_10000262
442 Ga0207684_10000160
443 Ga0207684_10000192
444 Ga0207684_10008399
445 Ga0207693_10022583
446 Ga0207693_10045408
447 Ga0207663_10030619
448 Ga0207649_10038093
449 Ga0207652_10510903
450 Ga0207646_10000144
451 Ga0207646_10000382
452 Ga0207646_10018680
453 Ga0207646_10214069
454 Ga0207646_10215679
455 Ga0207650_10004969
456 Ga0207650_10071415
457 Ga0207687_10019159
458 Ga0207644_10022661
459 Ga0207690_10034859
460 Ga0207686_10130930
461 Ga0207709_10067367
462 Ga0207689_10009389
463 Ga0207689_10282585
464 Ga0207679_10082295
465 Ga0207712_10018807
466 Ga0207712_10075064
467 Ga0207677_10008503
468 Ga0207703_10522478
469 Ga0207708_10017504
470 Ga0207708_10035900
471 Ga0207676_10000365
472 Ga0207676_10059871
473 Ga0207674_10000382
474 Ga0207675_100012004
475 Ga0207675_100087111
476 Ga0207428_10000591
477 Ga0207428_10126625
478 Ga0268264_10085627
479 Ga0265338_10163320
480 Ga0265320_10067889
481 Ga0265325_10066533
482 Ga0265340_10082344
483 Ga0265339_10010890
484 Ga0265331_10111285
485 Ga0265316_10054961
486 Ga0265313_10032678
487 Ga0265342_10055213
488 Ga0307416_100822067
489 Ga0373926_0001070
490 Ga0373923_0009512
491 Ga0373936_0001879
492 Ga0373939_0001323
493 Ga0373960_0012945
494 Ga0373943_0055033
495 Ga0373946_0001873
496 Ga0373955_0218260
497 Ga0373931_0022355
498 Ga0373935_0016739
499 Ga0373925_0006479
500 Ga0395899_0014635
501 Ga0395900_0003236
502 Ga0395900_0059844
503 Ga0395900_0341836
504 Ga0395898_0004288
505 Ga0395898_0140817
506 Ga0395898_0221375
507 Ga0395905_0002848
508 Ga0395905_0148829
509 Ga0395905_0158500
510 Ga0395901_0001624
511 Ga0395901_0001696
512 Ga0395901_0063310
513 Ga0395901_0064081
514 Ga0395901_0101194
515 Ga0395901_0386327
516 Ga0439464_0032363
517 Ga0466967_0142372
518 Ga0466967_0154464
519 Ga0466967_0227766
520 Ga0466967_0356695
521 Ga0495603_0001585
522 Ga0495603_0007781
523 Ga0495603_0022670
524 Ga0495603_0052483
525 Ga0495629_0002956
526 Ga0495629_0006723
527 Ga0495641_0009560
528 Ga0495641_0173331
529 Ga0495582_0000520
530 Ga0495605_0070122
531 Ga0495639_0021000
532 Ga0495664_0139613
533 Ga0495584_0090969
534 Ga0495585_0049505
535 Ga0495594_0047920
536 Ga0495630_0021946
537 Ga0495637_0034184
538 Ga0495663_0010005
539 Ga0495666_0006236
540 Ga0495665_0001681
541 Ga0495665_0013771
542 Ga0495640_0008140
543 Ga0495586_0003892
544 Ga0495598_0003239
545 Ga0495667_0034710
546 Ga0495656_0040710
547 Ga0495656_0065442
548 Ga0495634_0004320
549 Ga0495611_0104583
550 Ga0495635_0001712
551 Ga0495588_0005878
552 Ga0495658_0000156
553 Ga0495658_0000286
554 Ga0495613_0000454
555 Ga0495613_0233452
556 Ga0495670_0060297
557 Ga0495581_0012036
558 Ga0495581_0029714
559 Ga0495636_0108837
560 Ga0495674_0000427
561 Ga0495676_0047787
562 Ga0495676_0095109
563 Ga0495680_0008783
564 Ga0495593_0020553
565 Ga0496101_0021860
566 Ga0496101_0154959
567 Ga0496102_0042784
568 Ga0496106_0015519
569 Ga0496107_0085862
570 Ga0496108_0044410
571 Ga0496108_0064183
572 Ga0496108_0339848
573 Ga0496109_0114363
574 Ga0496110_0055120
575 Ga0496110_0353297
576 Ga0496111_0011073
577 Ga0496111_0091007
578 Ga0496112_0075148
579 Ga0496114_0018409
580 Ga0501031_0024219
581 Ga0501036_0026443
582 Ga0501036_0416277
583 Ga0501037_0020588
584 Ga0501038_0044404
585 Ga0501039_0020016
586 Ga0501039_0146183
587 Ga0501040_0004041
588 Ga0501040_0018157
589 Ga0501040_0028576
590 Ga0501040_0038892
591 Ga0501041_0016120
592 Ga0501042_0001298
593 Ga0501043_0137965
594 Ga0501046_0023015
595 Ga0501048_0047933
596 Ga0501067_0151930
597 Ga0501068_0080234
598 Ga0501069_0111858
599 Ga0501069_0127338
600 Ga0501070_0002343
601 Ga0501070_0089658
602 Ga0501071_0100612
603 Ga0501072_0251126
604 Ga0501073_0218626
605 Ga0501074_0053982
606 Ga0501074_0138714
607 Ga0501075_0067023
608 Ga0501075_0296599
609 Ga0501076_0047520
610 Ga0501077_0008064
611 Ga0501077_0011534
612 Ga0501079_0002259
613 Ga0501080_0001111
614 Ga0501080_0064412
615 Ga0501080_0078501
616 Ga0501044_0171200
617 Ga0501045_0018975
618 nmdc:mga05p37_15865_c1
619 nmdc:mga05p37_17565_c1
620 nmdc:mga05p37_22384_c1
621 nmdc:mga05p37_23966_c1
622 nmdc:mga05p37_24861_c1
623 nmdc:mga05p37_33750_c1
624 nmdc:mga09592_438425_c1
625 nmdc:mga09592_54181_c1
626 nmdc:mga0qj67_72783_c1
627 nmdc:mga06r32_129092_c1
628 nmdc:mga06r32_253835_c1
629 nmdc:mga08y16_204403_c1
630 nmdc:mga08y16_45595_c1
631 nmdc:mga0n895_11968_c1
632 nmdc:mga0n895_12562_c1
633 nmdc:mga0rr50_191664_c1
634 nmdc:mga08x19_32293_c1
635 nmdc:mga08x19_75370_c1
636 nmdc:mga0a205_39268_c1
637 nmdc:mga0a205_8112_c1
638 Ga0495619_0008709
639 Ga0501084_0431051
640 Ga0501082_0026252
641 Ga0501082_0208596
642 Ga0530510_0028285
643 Ga0530510_0342439
644 2870631311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

160

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9185 5 214
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9159 3 216
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.912 3 216
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9103 4 215
8idd-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc 0.8988 6 214
ID Description Score Start End Superfamily
af_Q8T6J0_514_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9316 4 214 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9309 3 214 3.40.50.300
af_B5DDZ5_904_1157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9253 3 215 3.40.50.300
af_Q656J6_6_216_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9252 114 214 3.40.50.300
af_Q0E8Q7_447_706_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9247 2 215 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A660SR74-F1-model_v4 ABC transporter ATP-binding protein 0.9389 6 161 GO:0005524
GO:0016887
AF-A0A2B9EER2-F1-model_v4 deleted 0.9358 1 210
AF-A0A3C0HMP1-F1-model_v4 ABC transporter domain-containing protein 0.9358 4 121 GO:0005524
GO:0016887
AF-T1IS52-F1-model_v4 Uncharacterized protein 0.9294 3 153 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359
AF-A0A182T4C8-F1-model_v4 ABC transporter domain-containing protein 0.9246 1 216 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359

Map