F406571

General Info

Members Datasets Scaffolds Average Seq Length
322 182 644 116

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_1513283|Ga0466967_1513283_86_496
Length 136
Sequence VAAPSGGTGARPTIHREEQRVPDYLVNAAAVQHANTLIDDGQVDTETDWSKAAPSTKAENELIDEEGYDGFGRWHLGIEKDASEDTKSRYGFPFGDFRKVNRAALIHAKQRASQNDHDDLAKAADELLQRLDGSGA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.52
Metatranscriptomes 2.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.8
Rhizosphere 96.58
Stem 0
Stem Tuber 0
Unclassified 9.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_1513283 3300045976 Unclassified 668
2 JGI24737J22298_10246353 3300001990 Unclassified 528
3 Ga0070658_10223537 3300005327 Bacteria 1593
4 Ga0070658_10440540 3300005327 Bacteria 1122
5 Ga0070683_100044122 3300005329 Bacteria 4110
6 Ga0070683_100281880 3300005329 Bacteria 1581
7 Ga0070670_100115358 3300005331 Bacteria 2315
8 Ga0068869_100005095 3300005334 Bacteria 8241
9 Ga0068869_100956955 3300005334 Bacteria 743
10 Ga0070666_10540860 3300005335 Bacteria 847
11 Ga0070680_100177745 3300005336 Bacteria 1792
12 Ga0070680_100182202 3300005336 Bacteria 1769
13 Ga0070682_100022670 3300005337 Bacteria 3721
14 Ga0070682_100269821 3300005337 Bacteria 1235
15 Ga0070682_100471665 3300005337 Bacteria 966
16 Ga0068868_100004484 3300005338 Bacteria 9795
17 Ga0070660_100050849 3300005339 Bacteria 3189
18 Ga0070660_101238755 3300005339 Bacteria 633
19 Ga0070689_100069092 3300005340 Bacteria 2756
20 Ga0070689_100171915 3300005340 Bacteria 1756
21 Ga0070687_100216635 3300005343 Bacteria 1170
22 Ga0070661_100603402 3300005344 Bacteria 888
23 Ga0070692_10172879 3300005345 Bacteria 1246
24 Ga0070668_100072600 3300005347 Bacteria 2681
25 Ga0070675_100251985 3300005354 Bacteria 1545
26 Ga0070671_100251313 3300005355 Bacteria 1502
27 Ga0070674_100139651 3300005356 Bacteria 1817
28 Ga0070673_100505382 3300005364 Bacteria 1094
29 Ga0070673_100713386 3300005364 Bacteria 922
30 Ga0070688_100041501 3300005365 Bacteria 2825
31 Ga0070659_100334746 3300005366 Bacteria 1267
32 Ga0070667_101023781 3300005367 Unclassified 771
33 Ga0070714_100097727 3300005435 Bacteria 2582
34 Ga0070714_100569948 3300005435 Unclassified 1085
35 Ga0070713_100407865 3300005436 Bacteria 1270
36 Ga0070700_100058052 3300005441 Bacteria 2430
37 Ga0070663_100003285 3300005455 Bacteria 9305
38 Ga0070663_100374820 3300005455 Bacteria 1158
39 Ga0070678_101024177 3300005456 Unclassified 760
40 Ga0070662_100248715 3300005457 Bacteria 1428
41 Ga0070681_10808015 3300005458 Bacteria 855
42 Ga0070685_10017205 3300005466 Bacteria 3866
43 Ga0070685_10171275 3300005466 Bacteria 1391
44 Ga0070679_100308586 3300005530 Bacteria 1532
45 Ga0070679_100349998 3300005530 Bacteria 1425
46 Ga0070679_101695743 3300005530 Bacteria 580
47 Ga0070684_100034378 3300005535 Bacteria 4334
48 Ga0070684_100271502 3300005535 Bacteria 1552
49 Ga0070684_100409761 3300005535 Bacteria 1250
50 Ga0068853_100713566 3300005539 Bacteria 957
51 Ga0068853_100897925 3300005539 Bacteria 851
52 Ga0070693_101591514 3300005547 Bacteria 513
53 Ga0070665_100132965 3300005548 Bacteria 2489
54 Ga0070665_100676099 3300005548 Bacteria 1045
55 Ga0070665_101099338 3300005548 Bacteria 806
56 Ga0070664_100131520 3300005564 Bacteria 2198
57 Ga0068857_100106148 3300005577 Bacteria 2522
58 Ga0068857_100359946 3300005577 Bacteria 1348
59 Ga0068856_100728940 3300005614 Bacteria 1011
60 Ga0068856_100823620 3300005614 Bacteria 948
61 Ga0070702_100289149 3300005615 Bacteria 1129
62 Ga0068852_100010652 3300005616 Bacteria 6881
63 Ga0068859_100318337 3300005617 Bacteria 1650
64 Ga0068864_100106103 3300005618 Bacteria 2498
65 Ga0068866_10355038 3300005718 Bacteria 933
66 Ga0068861_100177390 3300005719 Bacteria 1770
67 Ga0068870_10105467 3300005840 Bacteria 1600
68 Ga0068863_101779765 3300005841 Unclassified 626
69 Ga0068858_100034378 3300005842 Bacteria 4701
70 Ga0068858_100299295 3300005842 Bacteria 1534
71 Ga0068860_101098850 3300005843 Bacteria 814
72 Ga0068862_100188680 3300005844 Bacteria 1854
73 Ga0068862_101650016 3300005844 Bacteria 649
74 Ga0070717_10125054 3300006028 Bacteria 2207
75 Ga0097621_100587282 3300006237 Bacteria 1017
76 Ga0097621_100797637 3300006237 Bacteria 875
77 Ga0068871_100866338 3300006358 Bacteria 836
78 Ga0075428_100846171 3300006844 Bacteria 971
79 Ga0068865_100468483 3300006881 Bacteria 1045
80 Ga0097620_100318326 3300006931 Bacteria 1650
81 Ga0105240_10378182 3300009093 Bacteria 1600
82 Ga0111539_10435294 3300009094 Bacteria 1527
83 Ga0105245_10089720 3300009098 Bacteria 2827
84 Ga0105247_10147870 3300009101 Bacteria 1546
85 Ga0105247_10190665 3300009101 Bacteria 1372
86 Ga0105243_10294259 3300009148 Bacteria 1468
87 Ga0105243_11916886 3300009148 Bacteria 626
88 Ga0105241_10430918 3300009174 Bacteria 1163
89 Ga0105242_10359433 3300009176 Bacteria 1347
90 Ga0105242_12525970 3300009176 Bacteria 562
91 Ga0105248_10782603 3300009177 Bacteria 1077
92 Ga0105248_10862850 3300009177 Bacteria 1022
93 Ga0105237_11262755 3300009545 Bacteria 745
94 Ga0105238_10203888 3300009551 Bacteria 1954
95 Ga0105249_10012527 3300009553 Bacteria 7475
96 Ga0105239_10012736 3300010375 Bacteria 9357
97 Ga0105239_12155239 3300010375 Bacteria 648
98 Ga0105246_10034400 3300011119 Bacteria 3376
99 Ga0105246_10351926 3300011119 Bacteria 1207
100 Ga0105246_10716940 3300011119 Bacteria 878
101 Ga0157371_10041171 3300013102 Bacteria 3298
102 Ga0157369_10186437 3300013105 Bacteria 2182
103 Ga0157369_10222746 3300013105 Bacteria 1974
104 Ga0157369_10373341 3300013105 Bacteria 1480
105 Ga0157369_10740136 3300013105 Bacteria 1012
106 Ga0157374_10854057 3300013296 Bacteria 927
107 Ga0157378_10426377 3300013297 Bacteria 1312
108 Ga0157372_10405014 3300013307 Bacteria 1589
109 Ga0157372_10525693 3300013307 Bacteria 1379
110 Ga0157372_10872293 3300013307 Bacteria 1044
111 Ga0157375_10021764 3300013308 Bacteria 5887
112 Ga0157375_11231252 3300013308 Bacteria 879
113 Ga0163163_10061753 3300014325 Bacteria 3713
114 Ga0163163_10109373 3300014325 Bacteria 2791
115 Ga0163163_11407048 3300014325 Bacteria 759
116 Ga0157380_10097235 3300014326 Bacteria 2443
117 Ga0157380_11753917 3300014326 Bacteria 679
118 Ga0157377_10094816 3300014745 Bacteria 1768
119 Ga0157377_10185878 3300014745 Bacteria 1310
120 Ga0157377_10485649 3300014745 Bacteria 860
121 Ga0157379_10100614 3300014968 Bacteria 2595
122 Ga0157379_10117996 3300014968 Bacteria 2387
123 Ga0157379_10649657 3300014968 Bacteria 987
124 Ga0157376_10600538 3300014969 Bacteria 1095
125 Ga0163161_10951048 3300017792 Bacteria 731
126 Ga0197907_11061531 3300020069 Bacteria 640
127 Ga0197907_11105545 3300020069 Bacteria 844
128 Ga0206353_10044641 3300020082 Bacteria 1127
129 Ga0206353_11964122 3300020082 Bacteria 989
130 Ga0154015_1069778 3300020610 Unclassified 736
131 Ga0224712_10180875 3300022467 Bacteria 950
132 Ga0224712_10219198 3300022467 Bacteria 870
133 Ga0224712_10253235 3300022467 Bacteria 814
134 Ga0207642_10605967 3300025899 Unclassified 682
135 Ga0207710_10188877 3300025900 Bacteria 1014
136 Ga0207688_10000585 3300025901 Bacteria 17934
137 Ga0207688_10205749 3300025901 Unclassified 1181
138 Ga0207680_10204193 3300025903 Bacteria 1348
139 Ga0207680_10636733 3300025903 Bacteria 763
140 Ga0207647_10011640 3300025904 Bacteria 6161
141 Ga0207647_10363936 3300025904 Bacteria 818
142 Ga0207643_10025482 3300025908 Bacteria 3268
143 Ga0207705_10000590 3300025909 Bacteria 30474
144 Ga0207705_10622438 3300025909 Bacteria 839
145 Ga0207705_10713691 3300025909 Bacteria 779
146 Ga0207654_10290642 3300025911 Bacteria 1108
147 Ga0207707_10950892 3300025912 Bacteria 708
148 Ga0207695_10719384 3300025913 Bacteria 879
149 Ga0207671_10294379 3300025914 Bacteria 1282
150 Ga0207660_10023238 3300025917 Bacteria 4186
151 Ga0207660_10202873 3300025917 Bacteria 1549
152 Ga0207660_11101773 3300025917 Bacteria 647
153 Ga0207662_10056703 3300025918 Bacteria 2340
154 Ga0207657_10145032 3300025919 Bacteria 1937
155 Ga0207657_10250935 3300025919 Bacteria 1410
156 Ga0207649_10484977 3300025920 Bacteria 938
157 Ga0207649_11661427 3300025920 Bacteria 506
158 Ga0207652_10252029 3300025921 Bacteria 1592
159 Ga0207652_10326842 3300025921 Bacteria 1384
160 Ga0207681_10804752 3300025923 Unclassified 785
161 Ga0207694_10277721 3300025924 Bacteria 1375
162 Ga0207650_10252103 3300025925 Bacteria 1429
163 Ga0207659_10960047 3300025926 Unclassified 735
164 Ga0207687_10042310 3300025927 Bacteria 3133
165 Ga0207687_10515485 3300025927 Bacteria 1000
166 Ga0207664_10112462 3300025929 Bacteria 2267
167 Ga0207644_10586334 3300025931 Bacteria 925
168 Ga0207690_11087728 3300025932 Unclassified 666
169 Ga0207690_11092618 3300025932 Unclassified 665
170 Ga0207706_10069179 3300025933 Bacteria 3105
171 Ga0207709_10344428 3300025935 Bacteria 1123
172 Ga0207670_10181976 3300025936 Bacteria 1584
173 Ga0207669_11359385 3300025937 Unclassified 604
174 Ga0207704_10145047 3300025938 Bacteria 1666
175 Ga0207711_10548009 3300025941 Bacteria 1079
176 Ga0207689_10009275 3300025942 Bacteria 8507
177 Ga0207661_10093943 3300025944 Bacteria 2504
178 Ga0207679_11312003 3300025945 Unclassified 664
179 Ga0207712_10998260 3300025961 Unclassified 743
180 Ga0207668_10155411 3300025972 Bacteria 1776
181 Ga0207640_10026669 3300025981 Bacteria 3512
182 Ga0207658_10263511 3300025986 Bacteria 1470
183 Ga0207677_10158147 3300026023 Bacteria 1757
184 Ga0207703_10149554 3300026035 Bacteria 2035
185 Ga0207703_10751844 3300026035 Bacteria 929
186 Ga0207639_11478922 3300026041 Bacteria 637
187 Ga0207678_10005160 3300026067 Bacteria 11710
188 Ga0207678_10290455 3300026067 Bacteria 1404
189 Ga0207708_10065969 3300026075 Bacteria 2767
190 Ga0207708_10378766 3300026075 Bacteria 1166
191 Ga0207702_10219211 3300026078 Bacteria 1772
192 Ga0207702_10271378 3300026078 Bacteria 1600
193 Ga0207702_10379219 3300026078 Bacteria 1360
194 Ga0207641_10969274 3300026088 Bacteria 846
195 Ga0207648_10290260 3300026089 Bacteria 1464
196 Ga0207676_10224133 3300026095 Bacteria 1676
197 Ga0207676_11062414 3300026095 Unclassified 799
198 Ga0207674_10012921 3300026116 Bacteria 9312
199 Ga0207674_10102562 3300026116 Bacteria 2841
200 Ga0207675_100312388 3300026118 Bacteria 1533
201 Ga0207683_10015313 3300026121 Bacteria 6530
202 Ga0207698_11303688 3300026142 Bacteria 741
203 Ga0207698_11463134 3300026142 Bacteria 698
204 Ga0207428_10148671 3300027907 Bacteria 1784
205 Ga0268266_10096665 3300028379 Bacteria 2596
206 Ga0268266_10528439 3300028379 Bacteria 1128
207 Ga0268265_10314266 3300028380 Bacteria 1416
208 Ga0268265_10350882 3300028380 Bacteria 1347
209 Ga0268264_10808111 3300028381 Bacteria 937
210 Ga0307408_101209989 3300031548 Bacteria 705
211 Ga0307405_10255348 3300031731 Bacteria 1306
212 Ga0307413_11073717 3300031824 Bacteria 694
213 Ga0307410_10392489 3300031852 Bacteria 1119
214 Ga0307410_10720675 3300031852 Bacteria 842
215 Ga0307410_10785853 3300031852 Bacteria 808
216 Ga0307407_10225324 3300031903 Bacteria 1270
217 Ga0307412_10105163 3300031911 Bacteria 2004
218 Ga0307412_10185998 3300031911 Bacteria 1567
219 Ga0307409_100249124 3300031995 Bacteria 1623
220 Ga0307416_100714228 3300032002 Bacteria 1092
221 Ga0307416_101240131 3300032002 Bacteria 851
222 Ga0307414_10074252 3300032004 Bacteria 2463
223 Ga0307414_10499075 3300032004 Bacteria 1076
224 Ga0307415_100200667 3300032126 Bacteria 1582
225 Ga0307415_100845589 3300032126 Bacteria 839
226 Ga0307415_101171586 3300032126 Bacteria 723
227 Ga0373931_0583760 3300035691 Bacteria 729
228 Ga0395899_0115591 3300037312 Bacteria 1926
229 Ga0395900_0045131 3300037418 Bacteria 4540
230 Ga0395900_0295929 3300037418 Bacteria 1606
231 Ga0395898_0368220 3300037466 Bacteria 1370
232 Ga0395898_0626430 3300037466 Bacteria 1018
233 Ga0436364_0661118 3300037853 Bacteria 2570
234 Ga0395901_0017546 3300038443 Bacteria 7306
235 Ga0436365_1404447 3300039437 Unclassified 945
236 Ga0466969_0095019 3300044656 Bacteria 1409
237 Ga0466969_0118569 3300044656 Unclassified 1234
238 Ga0466969_0505749 3300044656 Unclassified 552
239 Ga0466972_0648526 3300044658 Unclassified 500
240 Ga0466965_0071439 3300044683 Bacteria 1746
241 Ga0466965_0205136 3300044683 Bacteria 1047
242 Ga0466966_0002151 3300044684 Bacteria 12779
243 Ga0466966_0010367 3300044684 Bacteria 6187
244 Ga0466966_0059757 3300044684 Bacteria 2407
245 Ga0466966_0069381 3300044684 Bacteria 2211
246 Ga0466966_0086477 3300044684 Bacteria 1949
247 Ga0466966_0212470 3300044684 Bacteria 1169
248 Ga0466966_0250703 3300044684 Unclassified 1066
249 Ga0466961_0205144 3300044693 Bacteria 1218
250 Ga0466961_0305537 3300044693 Bacteria 971
251 Ga0466961_0326508 3300044693 Bacteria 935
252 Ga0466963_0127466 3300044694 Bacteria 1755
253 Ga0466963_0405484 3300044694 Bacteria 961
254 Ga0466963_0446316 3300044694 Bacteria 913
255 Ga0466963_0530235 3300044694 Bacteria 831
256 Ga0466963_0679271 3300044694 Bacteria 727
257 Ga0466963_1123811 3300044694 Unclassified 552
258 Ga0466964_0088115 3300044706 Bacteria 1346
259 Ga0466971_0134633 3300044719 Bacteria 1149
260 Ga0466971_0373622 3300044719 Bacteria 692
261 Ga0466970_0032475 3300044765 Bacteria 2758
262 Ga0466970_0040838 3300044765 Bacteria 2464
263 Ga0466970_0181820 3300044765 Bacteria 1167
264 Ga0466970_0333839 3300044765 Bacteria 858
265 Ga0466970_0447318 3300044765 Unclassified 740
266 Ga0466970_0660991 3300044765 Bacteria 608
267 Ga0466970_0742691 3300044765 Bacteria 573
268 Ga0466970_0796852 3300044765 Bacteria 553
269 Ga0466957_0016911 3300044842 Bacteria 4268
270 Ga0466957_0094372 3300044842 Bacteria 1878
271 Ga0466957_0163653 3300044842 Bacteria 1446
272 Ga0466957_0237678 3300044842 Bacteria 1208
273 Ga0466957_0477065 3300044842 Bacteria 862
274 Ga0466957_0737956 3300044842 Bacteria 697
275 Ga0466960_0037321 3300044901 Bacteria 2279
276 Ga0466960_0154205 3300044901 Bacteria 1229
277 Ga0466960_0285360 3300044901 Bacteria 926
278 Ga0466959_0016399 3300045049 Bacteria 5412
279 Ga0466959_0151225 3300045049 Bacteria 1636
280 Ga0466959_0178476 3300045049 Bacteria 1486
281 Ga0466959_0190366 3300045049 Bacteria 1432
282 Ga0466959_0450139 3300045049 Bacteria 873
283 Ga0466959_0479805 3300045049 Bacteria 841
284 Ga0466959_0600879 3300045049 Bacteria 740
285 Ga0466959_0721516 3300045049 Bacteria 668
286 Ga0466959_0824308 3300045049 Bacteria 620
287 Ga0466958_0132454 3300045836 Bacteria 1566
288 Ga0466958_0425033 3300045836 Bacteria 859
289 Ga0466958_0522689 3300045836 Bacteria 770
290 Ga0466958_0579235 3300045836 Unclassified 730
291 Ga0466958_0582754 3300045836 Bacteria 727
292 Ga0466958_0768036 3300045836 Bacteria 628
293 Ga0466967_0016524 3300045976 Bacteria 5824
294 Ga0466967_0092940 3300045976 Bacteria 2744
295 Ga0466967_0140226 3300045976 Unclassified 2251
296 Ga0466967_0213866 3300045976 Bacteria 1829
297 Ga0466967_0317142 3300045976 Bacteria 1503
298 Ga0466967_0366811 3300045976 Bacteria 1396
299 Ga0466967_0375242 3300045976 Bacteria 1380
300 Ga0466967_0477668 3300045976 Bacteria 1221
301 Ga0466967_0521730 3300045976 Bacteria 1167
302 Ga0466967_0739277 3300045976 Bacteria 975
303 Ga0466967_0798217 3300045976 Bacteria 937
304 Ga0466967_0903679 3300045976 Bacteria 878
305 Ga0466967_0922038 3300045976 Bacteria 869
306 Ga0466967_1695576 3300045976 Bacteria 629
307 Ga0495620_0286204 3300046515 Unclassified 627
308 Ga0496102_0362665 3300048905 Bacteria 1364
309 Ga0496103_0742048 3300048906 Unclassified 621
310 Ga0496106_0678496 3300048909 Unclassified 822
311 Ga0496108_0083704 3300048911 Bacteria 2706
312 Ga0496108_0144683 3300048911 Bacteria 2049
313 Ga0496109_0453291 3300048912 Bacteria 1211
314 Ga0496110_1537298 3300048913 Unclassified 575
315 Ga0496111_0593058 3300048914 Unclassified 811
316 Ga0496114_0411520 3300048917 Bacteria 1198
317 Ga0501045_1249095 3300049824 Bacteria 541
318 nmdc:mga08y16_56885_c1 3300050511 Bacteria 4087
319 Ga0501082_0525955 3300060353 Bacteria 1034
320 Ga0466962_0094779 3300061719 Bacteria 1431
321 Ga0466962_0284914 3300061719 Unclassified 816
322 Ga0466962_0310684 3300061719 Bacteria 781
323 Ga0466967_1513283
324 JGI24737J22298_10246353
325 Ga0070658_10223537
326 Ga0070658_10440540
327 Ga0070683_100044122
328 Ga0070683_100281880
329 Ga0070670_100115358
330 Ga0068869_100005095
331 Ga0068869_100956955
332 Ga0070666_10540860
333 Ga0070680_100177745
334 Ga0070680_100182202
335 Ga0070682_100022670
336 Ga0070682_100269821
337 Ga0070682_100471665
338 Ga0068868_100004484
339 Ga0070660_100050849
340 Ga0070660_101238755
341 Ga0070689_100069092
342 Ga0070689_100171915
343 Ga0070687_100216635
344 Ga0070661_100603402
345 Ga0070692_10172879
346 Ga0070668_100072600
347 Ga0070675_100251985
348 Ga0070671_100251313
349 Ga0070674_100139651
350 Ga0070673_100505382
351 Ga0070673_100713386
352 Ga0070688_100041501
353 Ga0070659_100334746
354 Ga0070667_101023781
355 Ga0070714_100097727
356 Ga0070714_100569948
357 Ga0070713_100407865
358 Ga0070700_100058052
359 Ga0070663_100003285
360 Ga0070663_100374820
361 Ga0070678_101024177
362 Ga0070662_100248715
363 Ga0070681_10808015
364 Ga0070685_10017205
365 Ga0070685_10171275
366 Ga0070679_100308586
367 Ga0070679_100349998
368 Ga0070679_101695743
369 Ga0070684_100034378
370 Ga0070684_100271502
371 Ga0070684_100409761
372 Ga0068853_100713566
373 Ga0068853_100897925
374 Ga0070693_101591514
375 Ga0070665_100132965
376 Ga0070665_100676099
377 Ga0070665_101099338
378 Ga0070664_100131520
379 Ga0068857_100106148
380 Ga0068857_100359946
381 Ga0068856_100728940
382 Ga0068856_100823620
383 Ga0070702_100289149
384 Ga0068852_100010652
385 Ga0068859_100318337
386 Ga0068864_100106103
387 Ga0068866_10355038
388 Ga0068861_100177390
389 Ga0068870_10105467
390 Ga0068863_101779765
391 Ga0068858_100034378
392 Ga0068858_100299295
393 Ga0068860_101098850
394 Ga0068862_100188680
395 Ga0068862_101650016
396 Ga0070717_10125054
397 Ga0097621_100587282
398 Ga0097621_100797637
399 Ga0068871_100866338
400 Ga0075428_100846171
401 Ga0068865_100468483
402 Ga0097620_100318326
403 Ga0105240_10378182
404 Ga0111539_10435294
405 Ga0105245_10089720
406 Ga0105247_10147870
407 Ga0105247_10190665
408 Ga0105243_10294259
409 Ga0105243_11916886
410 Ga0105241_10430918
411 Ga0105242_10359433
412 Ga0105242_12525970
413 Ga0105248_10782603
414 Ga0105248_10862850
415 Ga0105237_11262755
416 Ga0105238_10203888
417 Ga0105249_10012527
418 Ga0105239_10012736
419 Ga0105239_12155239
420 Ga0105246_10034400
421 Ga0105246_10351926
422 Ga0105246_10716940
423 Ga0157371_10041171
424 Ga0157369_10186437
425 Ga0157369_10222746
426 Ga0157369_10373341
427 Ga0157369_10740136
428 Ga0157374_10854057
429 Ga0157378_10426377
430 Ga0157372_10405014
431 Ga0157372_10525693
432 Ga0157372_10872293
433 Ga0157375_10021764
434 Ga0157375_11231252
435 Ga0163163_10061753
436 Ga0163163_10109373
437 Ga0163163_11407048
438 Ga0157380_10097235
439 Ga0157380_11753917
440 Ga0157377_10094816
441 Ga0157377_10185878
442 Ga0157377_10485649
443 Ga0157379_10100614
444 Ga0157379_10117996
445 Ga0157379_10649657
446 Ga0157376_10600538
447 Ga0163161_10951048
448 Ga0197907_11061531
449 Ga0197907_11105545
450 Ga0206353_10044641
451 Ga0206353_11964122
452 Ga0154015_1069778
453 Ga0224712_10180875
454 Ga0224712_10219198
455 Ga0224712_10253235
456 Ga0207642_10605967
457 Ga0207710_10188877
458 Ga0207688_10000585
459 Ga0207688_10205749
460 Ga0207680_10204193
461 Ga0207680_10636733
462 Ga0207647_10011640
463 Ga0207647_10363936
464 Ga0207643_10025482
465 Ga0207705_10000590
466 Ga0207705_10622438
467 Ga0207705_10713691
468 Ga0207654_10290642
469 Ga0207707_10950892
470 Ga0207695_10719384
471 Ga0207671_10294379
472 Ga0207660_10023238
473 Ga0207660_10202873
474 Ga0207660_11101773
475 Ga0207662_10056703
476 Ga0207657_10145032
477 Ga0207657_10250935
478 Ga0207649_10484977
479 Ga0207649_11661427
480 Ga0207652_10252029
481 Ga0207652_10326842
482 Ga0207681_10804752
483 Ga0207694_10277721
484 Ga0207650_10252103
485 Ga0207659_10960047
486 Ga0207687_10042310
487 Ga0207687_10515485
488 Ga0207664_10112462
489 Ga0207644_10586334
490 Ga0207690_11087728
491 Ga0207690_11092618
492 Ga0207706_10069179
493 Ga0207709_10344428
494 Ga0207670_10181976
495 Ga0207669_11359385
496 Ga0207704_10145047
497 Ga0207711_10548009
498 Ga0207689_10009275
499 Ga0207661_10093943
500 Ga0207679_11312003
501 Ga0207712_10998260
502 Ga0207668_10155411
503 Ga0207640_10026669
504 Ga0207658_10263511
505 Ga0207677_10158147
506 Ga0207703_10149554
507 Ga0207703_10751844
508 Ga0207639_11478922
509 Ga0207678_10005160
510 Ga0207678_10290455
511 Ga0207708_10065969
512 Ga0207708_10378766
513 Ga0207702_10219211
514 Ga0207702_10271378
515 Ga0207702_10379219
516 Ga0207641_10969274
517 Ga0207648_10290260
518 Ga0207676_10224133
519 Ga0207676_11062414
520 Ga0207674_10012921
521 Ga0207674_10102562
522 Ga0207675_100312388
523 Ga0207683_10015313
524 Ga0207698_11303688
525 Ga0207698_11463134
526 Ga0207428_10148671
527 Ga0268266_10096665
528 Ga0268266_10528439
529 Ga0268265_10314266
530 Ga0268265_10350882
531 Ga0268264_10808111
532 Ga0307408_101209989
533 Ga0307405_10255348
534 Ga0307413_11073717
535 Ga0307410_10392489
536 Ga0307410_10720675
537 Ga0307410_10785853
538 Ga0307407_10225324
539 Ga0307412_10105163
540 Ga0307412_10185998
541 Ga0307409_100249124
542 Ga0307416_100714228
543 Ga0307416_101240131
544 Ga0307414_10074252
545 Ga0307414_10499075
546 Ga0307415_100200667
547 Ga0307415_100845589
548 Ga0307415_101171586
549 Ga0373931_0583760
550 Ga0395899_0115591
551 Ga0395900_0045131
552 Ga0395900_0295929
553 Ga0395898_0368220
554 Ga0395898_0626430
555 Ga0436364_0661118
556 Ga0395901_0017546
557 Ga0436365_1404447
558 Ga0466969_0095019
559 Ga0466969_0118569
560 Ga0466969_0505749
561 Ga0466972_0648526
562 Ga0466965_0071439
563 Ga0466965_0205136
564 Ga0466966_0002151
565 Ga0466966_0010367
566 Ga0466966_0059757
567 Ga0466966_0069381
568 Ga0466966_0086477
569 Ga0466966_0212470
570 Ga0466966_0250703
571 Ga0466961_0205144
572 Ga0466961_0305537
573 Ga0466961_0326508
574 Ga0466963_0127466
575 Ga0466963_0405484
576 Ga0466963_0446316
577 Ga0466963_0530235
578 Ga0466963_0679271
579 Ga0466963_1123811
580 Ga0466964_0088115
581 Ga0466971_0134633
582 Ga0466971_0373622
583 Ga0466970_0032475
584 Ga0466970_0040838
585 Ga0466970_0181820
586 Ga0466970_0333839
587 Ga0466970_0447318
588 Ga0466970_0660991
589 Ga0466970_0742691
590 Ga0466970_0796852
591 Ga0466957_0016911
592 Ga0466957_0094372
593 Ga0466957_0163653
594 Ga0466957_0237678
595 Ga0466957_0477065
596 Ga0466957_0737956
597 Ga0466960_0037321
598 Ga0466960_0154205
599 Ga0466960_0285360
600 Ga0466959_0016399
601 Ga0466959_0151225
602 Ga0466959_0178476
603 Ga0466959_0190366
604 Ga0466959_0450139
605 Ga0466959_0479805
606 Ga0466959_0600879
607 Ga0466959_0721516
608 Ga0466959_0824308
609 Ga0466958_0132454
610 Ga0466958_0425033
611 Ga0466958_0522689
612 Ga0466958_0579235
613 Ga0466958_0582754
614 Ga0466958_0768036
615 Ga0466967_0016524
616 Ga0466967_0092940
617 Ga0466967_0140226
618 Ga0466967_0213866
619 Ga0466967_0317142
620 Ga0466967_0366811
621 Ga0466967_0375242
622 Ga0466967_0477668
623 Ga0466967_0521730
624 Ga0466967_0739277
625 Ga0466967_0798217
626 Ga0466967_0903679
627 Ga0466967_0922038
628 Ga0466967_1695576
629 Ga0495620_0286204
630 Ga0496102_0362665
631 Ga0496103_0742048
632 Ga0496106_0678496
633 Ga0496108_0083704
634 Ga0496108_0144683
635 Ga0496109_0453291
636 Ga0496110_1537298
637 Ga0496111_0593058
638 Ga0496114_0411520
639 Ga0501045_1249095
640 nmdc:mga08y16_56885_c1
641 Ga0501082_0525955
642 Ga0466962_0094779
643 Ga0466962_0284914
644 Ga0466962_0310684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o3v-assembly1.cif.gz_A-4 crystal structure for rva-vp3 0.9286 75 107
6o3v-assembly2.cif.gz_B crystal structure for rva-vp3 0.9219 76 107
6o3v-assembly1.cif.gz_C crystal structure for rva-vp3 0.9215 74 107
1f4n-assembly1.cif.gz_B c2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9049 75 107
6r2m-assembly1.cif.gz_A crystal structure of pssz from listeria monocytogenes 0.8525 64 102
ID Description Score Start End Superfamily
af_Q5TAA0_61_144_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9967 74 104 1.25.40.10
4evcA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9865 75 107 1.20.1260.10
5jajA03 Mainly Alpha;Up-down Bundle;phosphoenolpyruvate carboxylase, domain 3; 0.9837 75 105 1.20.1320.30
af_A0A2R8PY89_200_309_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.983 75 104 1.25.40.10
af_Q8MQ13_7_117_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.9756 75 102 3.30.710.10
ID Description Score Start End GO Terms
AF-A6WA41-F1-model_v4 Uncharacterized protein 0.8704 14 109
AF-A0A1H7S7X2-F1-model_v4 Bacteriophage HK97-gp10, tail-component 0.8671 13 107
AF-H6RJ05-F1-model_v4 Uncharacterized protein 0.8618 13 107
AF-A0A2W4NKC7-F1-model_v4 Uncharacterized protein 0.8618 14 108
AF-A0A7Y6A751-F1-model_v4 DUF3806 domain-containing protein 0.8606 15 109

Map