F406553
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 322 | 181 | 317 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0057967|Ga0451577_0057967_1065_1481 |
| Length | 138 |
| Sequence | MSTIFTKIIQGEIPCFKVAETATFFAFLDIRPVAFGHTLVVPKKEVDYIFDMEDDELGEMFLFAKKVSRVLEHHVTCERVGVSVIGLEVPHTHVHLIPIRTLQDMNFSADRYVFDKGEYEILSAKLFSTFTEWYGSGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 3 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 4 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 5 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 115 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 116 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 118 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 120 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 121 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 124 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 125 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 132 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 133 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 134 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 135 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 136 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 137 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 175 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 176 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 177 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 178 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 179 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 180 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 181 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.83 |
| Metatranscriptomes | 0.62 |
| Isolates | 1.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.97 |
| Nodule | 0 |
| Rhizoplane | 0.62 |
| Rhizosphere | 89.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10000007 | 3300002067 | Bacteria | 333510 |
| 2 | JGI25162J39368_1001130 | 3300002737 | Bacteria | 16055 |
| 3 | JGI25165J46597_1001079 | 3300003214 | Bacteria | 17498 |
| 4 | rootH2_10306871 | 3300003320 | Bacteria | 1060 |
| 5 | rootL2_10005487 | 3300003322 | Bacteria | 6002 |
| 6 | rootH1_10007236 | 3300003323 | Bacteria | 15279 |
| 7 | Ga0058863_11132184 | 3300004799 | Bacteria | 1045 |
| 8 | Ga0058862_11157795 | 3300004803 | Bacteria | 729 |
| 9 | Ga0065704_10470550 | 3300005289 | Bacteria | 689 |
| 10 | Ga0070658_10156097 | 3300005327 | Bacteria | 1913 |
| 11 | Ga0070658_10199513 | 3300005327 | Bacteria | 1688 |
| 12 | Ga0070658_11340938 | 3300005327 | Bacteria | 621 |
| 13 | Ga0070676_10002416 | 3300005328 | Bacteria | 9573 |
| 14 | Ga0070683_100106209 | 3300005329 | Bacteria | 2647 |
| 15 | Ga0070680_100050557 | 3300005336 | Bacteria | 3390 |
| 16 | Ga0068868_100031260 | 3300005338 | Bacteria | 4088 |
| 17 | Ga0070660_100190979 | 3300005339 | Bacteria | 1659 |
| 18 | Ga0070689_101888142 | 3300005340 | Unclassified | 545 |
| 19 | Ga0070675_101026573 | 3300005354 | Bacteria | 757 |
| 20 | Ga0070671_100017668 | 3300005355 | Bacteria | 5780 |
| 21 | Ga0070674_101007005 | 3300005356 | Bacteria | 731 |
| 22 | Ga0070673_100003698 | 3300005364 | Bacteria | 9581 |
| 23 | Ga0070673_100785563 | 3300005364 | Bacteria | 878 |
| 24 | Ga0070659_100000766 | 3300005366 | Bacteria | 23347 |
| 25 | Ga0070659_101160681 | 3300005366 | Bacteria | 682 |
| 26 | Ga0070711_100280871 | 3300005439 | Bacteria | 1317 |
| 27 | Ga0070678_100072911 | 3300005456 | Bacteria | 2575 |
| 28 | Ga0070678_100135001 | 3300005456 | Bacteria | 1966 |
| 29 | Ga0070662_100000043 | 3300005457 | Bacteria | 70660 |
| 30 | Ga0070681_10002600 | 3300005458 | Bacteria | 16566 |
| 31 | Ga0068867_100086395 | 3300005459 | Bacteria | 2373 |
| 32 | Ga0068867_101427587 | 3300005459 | Bacteria | 642 |
| 33 | Ga0070679_100005033 | 3300005530 | Bacteria | 12199 |
| 34 | Ga0070684_101023685 | 3300005535 | Bacteria | 775 |
| 35 | Ga0068853_100026336 | 3300005539 | Bacteria | 4882 |
| 36 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 37 | Ga0070665_101087588 | 3300005548 | Bacteria | 811 |
| 38 | Ga0068855_100000060 | 3300005563 | Bacteria | 133838 |
| 39 | Ga0068855_100000489 | 3300005563 | Bacteria | 48884 |
| 40 | Ga0068855_100005005 | 3300005563 | Bacteria | 16170 |
| 41 | Ga0068855_100093441 | 3300005563 | Bacteria | 3469 |
| 42 | Ga0068855_100269617 | 3300005563 | Bacteria | 1893 |
| 43 | Ga0068855_100490007 | 3300005563 | Bacteria | 1337 |
| 44 | Ga0068854_100172017 | 3300005578 | Bacteria | 1686 |
| 45 | Ga0068856_100015573 | 3300005614 | Bacteria | 7351 |
| 46 | Ga0068856_100310564 | 3300005614 | Bacteria | 1594 |
| 47 | Ga0068856_100403441 | 3300005614 | Bacteria | 1387 |
| 48 | Ga0068856_100440600 | 3300005614 | Unclassified | 1323 |
| 49 | Ga0068852_100001476 | 3300005616 | Bacteria | 15913 |
| 50 | Ga0068852_101612144 | 3300005616 | Bacteria | 671 |
| 51 | Ga0068859_101365763 | 3300005617 | Bacteria | 781 |
| 52 | Ga0068866_10092384 | 3300005718 | Bacteria | 1651 |
| 53 | Ga0068870_10035732 | 3300005840 | Bacteria | 2552 |
| 54 | Ga0068863_100170839 | 3300005841 | Bacteria | 2085 |
| 55 | Ga0068858_100220214 | 3300005842 | Bacteria | 1797 |
| 56 | Ga0075366_10003458 | 3300006195 | Bacteria | 8335 |
| 57 | Ga0097621_100000099 | 3300006237 | Bacteria | 48404 |
| 58 | Ga0068871_100000290 | 3300006358 | Bacteria | 35074 |
| 59 | Ga0068865_100005903 | 3300006881 | Bacteria | 7448 |
| 60 | Ga0097620_101365379 | 3300006931 | Bacteria | 781 |
| 61 | Ga0105240_10034592 | 3300009093 | Bacteria | 6516 |
| 62 | Ga0105240_10043975 | 3300009093 | Bacteria | 5679 |
| 63 | Ga0105240_10120468 | 3300009093 | Bacteria | 3160 |
| 64 | Ga0105240_10447706 | 3300009093 | Bacteria | 1446 |
| 65 | Ga0105240_10511755 | 3300009093 | Bacteria | 1333 |
| 66 | Ga0105240_10729843 | 3300009093 | Bacteria | 1079 |
| 67 | Ga0105240_10839050 | 3300009093 | Bacteria | 993 |
| 68 | Ga0105245_10818515 | 3300009098 | Bacteria | 970 |
| 69 | Ga0105243_10049063 | 3300009148 | Bacteria | 3330 |
| 70 | Ga0105243_10190265 | 3300009148 | Bacteria | 1792 |
| 71 | Ga0105241_10001269 | 3300009174 | Bacteria | 19251 |
| 72 | Ga0105241_10011955 | 3300009174 | Bacteria | 6375 |
| 73 | Ga0105241_10022435 | 3300009174 | Bacteria | 4676 |
| 74 | Ga0105241_10172944 | 3300009174 | Bacteria | 1785 |
| 75 | Ga0105241_10849084 | 3300009174 | Bacteria | 844 |
| 76 | Ga0105242_10125659 | 3300009176 | Bacteria | 2207 |
| 77 | Ga0105242_12868679 | 3300009176 | Bacteria | 532 |
| 78 | Ga0105237_10000935 | 3300009545 | Bacteria | 39308 |
| 79 | Ga0105237_10001359 | 3300009545 | Bacteria | 32392 |
| 80 | Ga0105237_10004303 | 3300009545 | Bacteria | 16508 |
| 81 | Ga0105237_10089329 | 3300009545 | Bacteria | 3071 |
| 82 | Ga0105237_10121520 | 3300009545 | Bacteria | 2606 |
| 83 | Ga0105237_10860750 | 3300009545 | Bacteria | 913 |
| 84 | Ga0105238_10096865 | 3300009551 | Bacteria | 2936 |
| 85 | Ga0105238_10273348 | 3300009551 | Bacteria | 1670 |
| 86 | Ga0105238_10316085 | 3300009551 | Bacteria | 1547 |
| 87 | Ga0105238_10559830 | 3300009551 | Bacteria | 1148 |
| 88 | Ga0105238_10630769 | 3300009551 | Bacteria | 1081 |
| 89 | Ga0105249_10214518 | 3300009553 | Bacteria | 1891 |
| 90 | Ga0105239_10000074 | 3300010375 | Bacteria | 140673 |
| 91 | Ga0105239_10004144 | 3300010375 | Bacteria | 17403 |
| 92 | Ga0105239_10004630 | 3300010375 | Bacteria | 16346 |
| 93 | Ga0105239_10152189 | 3300010375 | Bacteria | 2582 |
| 94 | Ga0105239_10153183 | 3300010375 | Bacteria | 2573 |
| 95 | Ga0105239_10192263 | 3300010375 | Bacteria | 2284 |
| 96 | Ga0105239_10591045 | 3300010375 | Bacteria | 1266 |
| 97 | Ga0105246_10034040 | 3300011119 | Bacteria | 3390 |
| 98 | Ga0157326_1076873 | 3300012513 | Bacteria | 539 |
| 99 | Ga0157373_10000090 | 3300013100 | Bacteria | 78142 |
| 100 | Ga0157371_10080148 | 3300013102 | Bacteria | 2312 |
| 101 | Ga0157370_10953368 | 3300013104 | Bacteria | 778 |
| 102 | Ga0157369_10032151 | 3300013105 | Bacteria | 5771 |
| 103 | Ga0157369_10178585 | 3300013105 | Bacteria | 2234 |
| 104 | Ga0157369_11383589 | 3300013105 | Bacteria | 716 |
| 105 | Ga0157369_11825787 | 3300013105 | Unclassified | 617 |
| 106 | Ga0157374_10000360 | 3300013296 | Bacteria | 42177 |
| 107 | Ga0157374_10001750 | 3300013296 | Bacteria | 18236 |
| 108 | Ga0157378_10027617 | 3300013297 | Bacteria | 5007 |
| 109 | Ga0157378_10033590 | 3300013297 | Bacteria | 4536 |
| 110 | Ga0157378_10916692 | 3300013297 | Bacteria | 908 |
| 111 | Ga0157378_12013557 | 3300013297 | Bacteria | 627 |
| 112 | Ga0163162_10000051 | 3300013306 | Bacteria | 117695 |
| 113 | Ga0163162_10002853 | 3300013306 | Bacteria | 16447 |
| 114 | Ga0163162_10003445 | 3300013306 | Bacteria | 15107 |
| 115 | Ga0163162_10828998 | 3300013306 | Bacteria | 1041 |
| 116 | Ga0157372_10002344 | 3300013307 | Bacteria | 20484 |
| 117 | Ga0157372_10021408 | 3300013307 | Bacteria | 6985 |
| 118 | Ga0157375_10580485 | 3300013308 | Bacteria | 1281 |
| 119 | Ga0157375_12448513 | 3300013308 | Bacteria | 623 |
| 120 | Ga0163163_10827982 | 3300014325 | Bacteria | 989 |
| 121 | Ga0157380_11465993 | 3300014326 | Unclassified | 735 |
| 122 | Ga0157380_11748410 | 3300014326 | Bacteria | 680 |
| 123 | Ga0182008_10170899 | 3300014497 | Bacteria | 1097 |
| 124 | Ga0182008_10218746 | 3300014497 | Bacteria | 974 |
| 125 | Ga0157377_10011833 | 3300014745 | Bacteria | 4368 |
| 126 | Ga0157376_10115178 | 3300014969 | Bacteria | 2373 |
| 127 | Ga0157376_11025479 | 3300014969 | Bacteria | 848 |
| 128 | Ga0182007_10006614 | 3300015262 | Bacteria | 4964 |
| 129 | Ga0182007_10018866 | 3300015262 | Bacteria | 2491 |
| 130 | Ga0182007_10207193 | 3300015262 | Bacteria | 688 |
| 131 | Ga0207427_100159 | 3300025231 | Bacteria | 76256 |
| 132 | Ga0209437_100021 | 3300025233 | Bacteria | 646400 |
| 133 | Ga0209026_1003403 | 3300025250 | Bacteria | 5243 |
| 134 | Ga0209026_1008965 | 3300025250 | Bacteria | 2022 |
| 135 | Ga0209026_1041216 | 3300025250 | Unclassified | 669 |
| 136 | Ga0209233_1000035 | 3300025261 | Bacteria | 568478 |
| 137 | Ga0209233_1020888 | 3300025261 | Bacteria | 1707 |
| 138 | Ga0209455_1000854 | 3300025272 | Bacteria | 16294 |
| 139 | Ga0207647_10000036 | 3300025904 | Bacteria | 98204 |
| 140 | Ga0207647_10137175 | 3300025904 | Bacteria | 1435 |
| 141 | Ga0207645_10000312 | 3300025907 | Bacteria | 40968 |
| 142 | Ga0207643_10277759 | 3300025908 | Bacteria | 1038 |
| 143 | Ga0207705_10152355 | 3300025909 | Bacteria | 1733 |
| 144 | Ga0207705_10248913 | 3300025909 | Bacteria | 1355 |
| 145 | Ga0207705_10804605 | 3300025909 | Bacteria | 729 |
| 146 | Ga0207654_10012162 | 3300025911 | Bacteria | 4405 |
| 147 | Ga0207654_10066304 | 3300025911 | Bacteria | 2129 |
| 148 | Ga0207654_10188108 | 3300025911 | Bacteria | 1351 |
| 149 | Ga0207654_10509575 | 3300025911 | Bacteria | 851 |
| 150 | Ga0207654_10671750 | 3300025911 | Bacteria | 743 |
| 151 | Ga0207707_10090091 | 3300025912 | Bacteria | 2681 |
| 152 | Ga0207695_10000197 | 3300025913 | Bacteria | 168837 |
| 153 | Ga0207695_10044337 | 3300025913 | Bacteria | 4731 |
| 154 | Ga0207695_10048999 | 3300025913 | Bacteria | 4456 |
| 155 | Ga0207695_10053524 | 3300025913 | Bacteria | 4221 |
| 156 | Ga0207695_10378920 | 3300025913 | Bacteria | 1300 |
| 157 | Ga0207695_10460502 | 3300025913 | Bacteria | 1155 |
| 158 | Ga0207695_10859376 | 3300025913 | Bacteria | 787 |
| 159 | Ga0207671_10000516 | 3300025914 | Bacteria | 52391 |
| 160 | Ga0207671_10008997 | 3300025914 | Bacteria | 8400 |
| 161 | Ga0207671_10050514 | 3300025914 | Bacteria | 3079 |
| 162 | Ga0207671_10320513 | 3300025914 | Bacteria | 1226 |
| 163 | Ga0207660_10061068 | 3300025917 | Bacteria | 2712 |
| 164 | Ga0207657_10131676 | 3300025919 | Bacteria | 2049 |
| 165 | Ga0207652_10027483 | 3300025921 | Bacteria | 4741 |
| 166 | Ga0207694_10129991 | 3300025924 | Bacteria | 2018 |
| 167 | Ga0207694_10377887 | 3300025924 | Bacteria | 1176 |
| 168 | Ga0207644_10004264 | 3300025931 | Bacteria | 9279 |
| 169 | Ga0207690_10003074 | 3300025932 | Bacteria | 10052 |
| 170 | Ga0207690_10105159 | 3300025932 | Bacteria | 2024 |
| 171 | Ga0207706_10000466 | 3300025933 | Bacteria | 43209 |
| 172 | Ga0207706_10356900 | 3300025933 | Bacteria | 1270 |
| 173 | Ga0207686_10184554 | 3300025934 | Bacteria | 1482 |
| 174 | Ga0207669_10794542 | 3300025937 | Bacteria | 784 |
| 175 | Ga0207704_10000123 | 3300025938 | Bacteria | 41995 |
| 176 | Ga0207661_10080160 | 3300025944 | Bacteria | 2693 |
| 177 | Ga0207667_10000033 | 3300025949 | Bacteria | 314353 |
| 178 | Ga0207667_10000408 | 3300025949 | Bacteria | 58389 |
| 179 | Ga0207667_10013290 | 3300025949 | Bacteria | 9430 |
| 180 | Ga0207667_10038475 | 3300025949 | Bacteria | 5109 |
| 181 | Ga0207667_10097087 | 3300025949 | Bacteria | 3041 |
| 182 | Ga0207667_10382533 | 3300025949 | Bacteria | 1434 |
| 183 | Ga0207667_11333979 | 3300025949 | Bacteria | 693 |
| 184 | Ga0207651_10588222 | 3300025960 | Bacteria | 972 |
| 185 | Ga0207651_11507880 | 3300025960 | Bacteria | 605 |
| 186 | Ga0207712_10130332 | 3300025961 | Bacteria | 1915 |
| 187 | Ga0207640_10333275 | 3300025981 | Bacteria | 1213 |
| 188 | Ga0207677_10029951 | 3300026023 | Bacteria | 3467 |
| 189 | Ga0207677_10039733 | 3300026023 | Bacteria | 3096 |
| 190 | Ga0207703_10149657 | 3300026035 | Bacteria | 2034 |
| 191 | Ga0207639_10008486 | 3300026041 | Bacteria | 7043 |
| 192 | Ga0207702_10041295 | 3300026078 | Bacteria | 3868 |
| 193 | Ga0207702_10143412 | 3300026078 | Bacteria | 2164 |
| 194 | Ga0207702_10951974 | 3300026078 | Unclassified | 851 |
| 195 | Ga0207702_11047276 | 3300026078 | Bacteria | 809 |
| 196 | Ga0207641_10677779 | 3300026088 | Bacteria | 1014 |
| 197 | Ga0207648_10000913 | 3300026089 | Bacteria | 33285 |
| 198 | Ga0207648_11970823 | 3300026089 | Bacteria | 545 |
| 199 | Ga0207683_10042837 | 3300026121 | Bacteria | 3953 |
| 200 | Ga0207698_10158689 | 3300026142 | Bacteria | 1975 |
| 201 | Ga0207698_12407986 | 3300026142 | Unclassified | 537 |
| 202 | Ga0207698_12754545 | 3300026142 | Bacteria | 500 |
| 203 | Ga0268266_10000037 | 3300028379 | Bacteria | 342368 |
| 204 | Ga0265322_10051744 | 3300028654 | Bacteria | 1166 |
| 205 | Ga0307517_10008846 | 3300028786 | Bacteria | 14389 |
| 206 | Ga0307515_10000299 | 3300028794 | Bacteria | 122087 |
| 207 | Ga0307515_10017355 | 3300028794 | Bacteria | 13116 |
| 208 | Ga0265338_10000448 | 3300028800 | Bacteria | 73538 |
| 209 | Ga0316181_1053068 | 3300030744 | Unclassified | 984 |
| 210 | Ga0265327_10029801 | 3300031251 | Bacteria | 3097 |
| 211 | Ga0265327_10154410 | 3300031251 | Bacteria | 1064 |
| 212 | Ga0307509_10117242 | 3300031507 | Bacteria | 2650 |
| 213 | Ga0307509_10332984 | 3300031507 | Bacteria | 1249 |
| 214 | Ga0316576_10088165 | 3300031727 | Unclassified | 2310 |
| 215 | Ga0307405_10030688 | 3300031731 | Bacteria | 3154 |
| 216 | Ga0307412_10011880 | 3300031911 | Bacteria | 5057 |
| 217 | Ga0307507_10000313 | 3300033179 | Bacteria | 97672 |
| 218 | Ga0307510_10001091 | 3300033180 | Bacteria | 28923 |
| 219 | Ga0373941_0003096 | 3300035115 | Bacteria | 3730 |
| 220 | Ga0395899_0004206 | 3300037312 | Bacteria | 11292 |
| 221 | Ga0395900_0000478 | 3300037418 | Bacteria | 56604 |
| 222 | Ga0395900_0001720 | 3300037418 | Bacteria | 25283 |
| 223 | Ga0395900_0215864 | 3300037418 | Bacteria | 1936 |
| 224 | Ga0395898_0057445 | 3300037466 | Bacteria | 3792 |
| 225 | Ga0395905_0002686 | 3300037471 | Bacteria | 19498 |
| 226 | Ga0395905_0182922 | 3300037471 | Bacteria | 1968 |
| 227 | Ga0395905_1052421 | 3300037471 | Bacteria | 717 |
| 228 | Ga0395901_0013694 | 3300038443 | Bacteria | 8244 |
| 229 | Ga0451855_1553403 | 3300041511 | Bacteria | 1516 |
| 230 | Ga0451577_0000112 | 3300042876 | Bacteria | 177581 |
| 231 | Ga0451577_0016611 | 3300042876 | Bacteria | 6810 |
| 232 | Ga0451577_0057967 | 3300042876 | Bacteria | 3452 |
| 233 | Ga0451577_0060018 | 3300042876 | Bacteria | 3391 |
| 234 | Ga0451577_0080184 | 3300042876 | Bacteria | 2910 |
| 235 | Ga0451577_0155585 | 3300042876 | Bacteria | 2057 |
| 236 | Ga0451577_0435898 | 3300042876 | Bacteria | 1190 |
| 237 | Ga0453683_0000166 | 3300044673 | Bacteria | 94433 |
| 238 | Ga0453683_0092761 | 3300044673 | Bacteria | 1893 |
| 239 | Ga0453683_0277755 | 3300044673 | Bacteria | 1069 |
| 240 | Ga0453683_0413304 | 3300044673 | Bacteria | 870 |
| 241 | Ga0453684_0000225 | 3300044712 | Bacteria | 245902 |
| 242 | Ga0453684_0000398 | 3300044712 | Bacteria | 178891 |
| 243 | Ga0453684_0001657 | 3300044712 | Bacteria | 60393 |
| 244 | Ga0453684_0027908 | 3300044712 | Bacteria | 8075 |
| 245 | Ga0453684_0201874 | 3300044712 | Bacteria | 2317 |
| 246 | Ga0453684_0876731 | 3300044712 | Bacteria | 963 |
| 247 | Ga0453684_0883893 | 3300044712 | Bacteria | 958 |
| 248 | Ga0466959_0128403 | 3300045049 | Bacteria | 1798 |
| 249 | Ga0451576_0000835 | 3300045051 | Bacteria | 60014 |
| 250 | Ga0451576_0003107 | 3300045051 | Bacteria | 23290 |
| 251 | Ga0451576_0009419 | 3300045051 | Bacteria | 11321 |
| 252 | Ga0451576_0167121 | 3300045051 | Bacteria | 2296 |
| 253 | Ga0451576_0196003 | 3300045051 | Bacteria | 2110 |
| 254 | Ga0451576_0250882 | 3300045051 | Bacteria | 1849 |
| 255 | Ga0451576_0349764 | 3300045051 | Unclassified | 1547 |
| 256 | Ga0451576_0448896 | 3300045051 | Bacteria | 1354 |
| 257 | Ga0495592_0398711 | 3300046454 | Bacteria | 872 |
| 258 | Ga0495629_0121174 | 3300046459 | Bacteria | 1822 |
| 259 | Ga0495638_0091176 | 3300046460 | Bacteria | 1836 |
| 260 | Ga0495651_0500993 | 3300046462 | Bacteria | 777 |
| 261 | Ga0495651_0739583 | 3300046462 | Bacteria | 611 |
| 262 | Ga0495653_0812578 | 3300046463 | Bacteria | 561 |
| 263 | Ga0495650_0000050 | 3300046471 | Bacteria | 318894 |
| 264 | Ga0495605_0154218 | 3300046474 | Bacteria | 1023 |
| 265 | Ga0495585_0000198 | 3300046492 | Bacteria | 62640 |
| 266 | Ga0495585_0001607 | 3300046492 | Bacteria | 17441 |
| 267 | Ga0495583_0011473 | 3300046506 | Bacteria | 5085 |
| 268 | Ga0495606_0000213 | 3300046507 | Bacteria | 103305 |
| 269 | Ga0495606_0183159 | 3300046507 | Bacteria | 1206 |
| 270 | Ga0495606_0430662 | 3300046507 | Bacteria | 680 |
| 271 | Ga0495610_0001134 | 3300046512 | Bacteria | 24228 |
| 272 | Ga0495616_0022684 | 3300046513 | Bacteria | 3387 |
| 273 | Ga0495616_0148772 | 3300046513 | Bacteria | 1061 |
| 274 | Ga0495616_0202795 | 3300046513 | Bacteria | 871 |
| 275 | Ga0495618_0355076 | 3300046514 | Bacteria | 903 |
| 276 | Ga0495631_0240086 | 3300046518 | Bacteria | 773 |
| 277 | Ga0495632_0161917 | 3300046519 | Bacteria | 1030 |
| 278 | Ga0495637_0024299 | 3300046520 | Bacteria | 2742 |
| 279 | Ga0495637_0033328 | 3300046520 | Bacteria | 2263 |
| 280 | Ga0495648_0007028 | 3300046524 | Bacteria | 9074 |
| 281 | Ga0495642_0176040 | 3300046528 | Bacteria | 930 |
| 282 | Ga0495652_0170280 | 3300046529 | Bacteria | 1682 |
| 283 | Ga0495654_0099397 | 3300046530 | Bacteria | 1341 |
| 284 | Ga0495609_0002985 | 3300046538 | Bacteria | 9997 |
| 285 | Ga0495622_0066925 | 3300046557 | Bacteria | 1660 |
| 286 | Ga0495633_0000295 | 3300046558 | Bacteria | 56870 |
| 287 | Ga0495633_0004623 | 3300046558 | Bacteria | 8671 |
| 288 | Ga0495668_0000121 | 3300046616 | Bacteria | 116234 |
| 289 | Ga0495668_0169339 | 3300046616 | Bacteria | 1197 |
| 290 | Ga0495668_0483421 | 3300046616 | Bacteria | 682 |
| 291 | Ga0495625_0000105 | 3300046660 | Bacteria | 126078 |
| 292 | Ga0495625_0000316 | 3300046660 | Bacteria | 73939 |
| 293 | Ga0495625_0438323 | 3300046660 | Bacteria | 809 |
| 294 | Ga0495635_0935810 | 3300046663 | Bacteria | 554 |
| 295 | Ga0495661_0001116 | 3300046665 | Bacteria | 23480 |
| 296 | Ga0495661_0004162 | 3300046665 | Bacteria | 10522 |
| 297 | Ga0495661_0021682 | 3300046665 | Bacteria | 4184 |
| 298 | Ga0495649_0322160 | 3300046694 | Unclassified | 784 |
| 299 | Ga0495600_0344552 | 3300046809 | Bacteria | 934 |
| 300 | Ga0495660_0014777 | 3300046810 | Bacteria | 4515 |
| 301 | Ga0495660_0089654 | 3300046810 | Bacteria | 1601 |
| 302 | Ga0495674_1424345 | 3300047319 | Bacteria | 516 |
| 303 | Ga0495683_0071377 | 3300047323 | Bacteria | 1704 |
| 304 | Ga0495687_000249 | 3300047443 | Bacteria | 72846 |
| 305 | Ga0495673_0017458 | 3300047469 | Bacteria | 3643 |
| 306 | Ga0495686_0054555 | 3300047472 | Bacteria | 2502 |
| 307 | Ga0495614_0012346 | 3300048089 | Bacteria | 3749 |
| 308 | Ga0496105_1222973 | 3300048908 | Bacteria | 552 |
| 309 | Ga0501223_003582 | 3300049663 | Bacteria | 3360 |
| 310 | nmdc:mga0k408_20927_c1 | 3300050493 | Bacteria | 3671 |
| 311 | nmdc:mga0k408_66_c1 | 3300050493 | Bacteria | 33479 |
| 312 | Ga0500647_0072279 | 3300053091 | Bacteria | 1657 |
| 313 | Ga0500608_000596 | 3300053122 | Bacteria | 13310 |
| 314 | Ga0500642_0144417 | 3300053130 | Bacteria | 1117 |
| 315 | Ga0500655_043043 | 3300053133 | Bacteria | 889 |
| 316 | Ga0500561_0027880 | 3300053137 | Bacteria | 1397 |
| 317 | Ga0500634_0111127 | 3300053161 | Bacteria | 1352 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10043975 | Ga0105240_100439751 | 119 |
| 2 | 3300014325 | Ga0163163_10827982 | Ga0163163_108279821 | 119 |
| 3 | 3300025913 | Ga0207695_10053524 | Ga0207695_100535244 | 120 |
| 4 | 3300037418 | Ga0395900_0000478 | Ga0395900_0000478_14627_15007 | 123 |
| 5 | iso_pu_bacteria | 2599185184 | 2599479813 | 126 |
| 6 | iso_pu_bacteria | 2928078545 | 2928080944 | 126 |
| 7 | iso_pu_bacteria | 2928147474 | 2928152637 | 126 |
| 8 | iso_pu_bacteria | 2932082852 | 2932086963 | 126 |
| 9 | iso_pu_bacteria | 2977232053 | 2977234088 | 126 |
| 10 | 3300037471 | Ga0395905_0182922 | Ga0395905_0182922_722_1111 | 128 |
| 11 | 3300042876 | Ga0451577_0155585 | Ga0451577_0155585_1444_1836 | 128 |
| 12 | 3300044712 | Ga0453684_0000225 | Ga0453684_0000225_194607_194999 | 128 |
| 13 | 3300003322 | rootL2_10005487 | rootL2_100054872 | 129 |
| 14 | 3300005289 | Ga0065704_10470550 | Ga0065704_104705501 | 129 |
| 15 | 3300005563 | Ga0068855_100000489 | Ga0068855_10000048926 | 129 |
| 16 | 3300014326 | Ga0157380_11465993 | Ga0157380_114659932 | 129 |
| 17 | 3300014497 | Ga0182008_10170899 | Ga0182008_101708991 | 129 |
| 18 | 3300014497 | Ga0182008_10218746 | Ga0182008_102187462 | 129 |
| 19 | 3300015262 | Ga0182007_10006614 | Ga0182007_100066145 | 129 |
| 20 | 3300015262 | Ga0182007_10018866 | Ga0182007_100188663 | 129 |
| 21 | 3300025250 | Ga0209026_1003403 | Ga0209026_10034036 | 129 |
| 22 | 3300025261 | Ga0209233_1020888 | Ga0209233_10208882 | 129 |
| 23 | 3300025949 | Ga0207667_10000408 | Ga0207667_1000040831 | 129 |
| 24 | 3300028794 | Ga0307515_10000299 | Ga0307515_10000299120 | 129 |
| 25 | 3300028794 | Ga0307515_10017355 | Ga0307515_1001735512 | 129 |
| 26 | 3300030744 | Ga0316181_1053068 | Ga0316181_10530682 | 129 |
| 27 | 3300031727 | Ga0316576_10088165 | Ga0316576_100881652 | 129 |
| 28 | 3300031731 | Ga0307405_10030688 | Ga0307405_100306882 | 129 |
| 29 | 3300031911 | Ga0307412_10011880 | Ga0307412_100118804 | 129 |
| 30 | 3300033179 | Ga0307507_10000313 | Ga0307507_1000031361 | 129 |
| 31 | 3300042876 | Ga0451577_0000112 | Ga0451577_0000112_168599_168991 | 129 |
| 32 | 3300042876 | Ga0451577_0016611 | Ga0451577_0016611_5513_5908 | 129 |
| 33 | 3300044673 | Ga0453683_0092761 | Ga0453683_0092761_110_502 | 129 |
| 34 | 3300044673 | Ga0453683_0413304 | Ga0453683_0413304_458_853 | 129 |
| 35 | 3300044712 | Ga0453684_0000398 | Ga0453684_0000398_168448_168840 | 129 |
| 36 | 3300044712 | Ga0453684_0001657 | Ga0453684_0001657_1402_1797 | 129 |
| 37 | 3300044712 | Ga0453684_0027908 | Ga0453684_0027908_3917_4312 | 129 |
| 38 | 3300045051 | Ga0451576_0000835 | Ga0451576_0000835_58607_59002 | 129 |
| 39 | 3300045051 | Ga0451576_0003107 | Ga0451576_0003107_15980_16372 | 129 |
| 40 | 3300045051 | Ga0451576_0009419 | Ga0451576_0009419_2347_2739 | 129 |
| 41 | 3300045051 | Ga0451576_0196003 | Ga0451576_0196003_896_1291 | 129 |
| 42 | 3300045051 | Ga0451576_0448896 | Ga0451576_0448896_919_1320 | 129 |
| 43 | 3300046459 | Ga0495629_0121174 | Ga0495629_0121174_778_1167 | 129 |
| 44 | 3300046462 | Ga0495651_0500993 | Ga0495651_0500993_108_497 | 129 |
| 45 | 3300046463 | Ga0495653_0812578 | Ga0495653_0812578_106_495 | 129 |
| 46 | 3300046492 | Ga0495585_0001607 | Ga0495585_0001607_3197_3586 | 129 |
| 47 | 3300046513 | Ga0495616_0148772 | Ga0495616_0148772_147_536 | 129 |
| 48 | 3300046518 | Ga0495631_0240086 | Ga0495631_0240086_56_445 | 129 |
| 49 | 3300046524 | Ga0495648_0007028 | Ga0495648_0007028_1146_1535 | 129 |
| 50 | 3300046530 | Ga0495654_0099397 | Ga0495654_0099397_738_1127 | 129 |
| 51 | 3300046538 | Ga0495609_0002985 | Ga0495609_0002985_1786_2175 | 129 |
| 52 | 3300046557 | Ga0495622_0066925 | Ga0495622_0066925_683_1072 | 129 |
| 53 | 3300046558 | Ga0495633_0000295 | Ga0495633_0000295_55334_55723 | 129 |
| 54 | 3300046616 | Ga0495668_0000121 | Ga0495668_0000121_4375_4764 | 129 |
| 55 | 3300046660 | Ga0495625_0000316 | Ga0495625_0000316_37936_38325 | 129 |
| 56 | 3300046663 | Ga0495635_0935810 | Ga0495635_0935810_131_520 | 129 |
| 57 | 3300046809 | Ga0495600_0344552 | Ga0495600_0344552_482_871 | 129 |
| 58 | 3300046810 | Ga0495660_0089654 | Ga0495660_0089654_1159_1548 | 129 |
| 59 | 3300048089 | Ga0495614_0012346 | Ga0495614_0012346_1262_1651 | 129 |
| 60 | 3300049663 | Ga0501223_003582 | Ga0501223_003582_2608_3000 | 129 |
| 61 | 3300053091 | Ga0500647_0072279 | Ga0500647_0072279_245_634 | 129 |
| 62 | 3300053133 | Ga0500655_043043 | Ga0500655_043043_420_809 | 129 |
| 63 | 3300053137 | Ga0500561_0027880 | Ga0500561_0027880_681_1070 | 129 |
| 64 | 3300002067 | JGI24735J21928_10000007 | JGI24735J21928_10000007147 | 130 |
| 65 | 3300002737 | JGI25162J39368_1001130 | JGI25162J39368_100113011 | 130 |
| 66 | 3300003214 | JGI25165J46597_1001079 | JGI25165J46597_10010796 | 130 |
| 67 | 3300003320 | rootH2_10306871 | rootH2_103068712 | 130 |
| 68 | 3300003323 | rootH1_10007236 | rootH1_1000723610 | 130 |
| 69 | 3300004799 | Ga0058863_11132184 | Ga0058863_111321841 | 130 |
| 70 | 3300004803 | Ga0058862_11157795 | Ga0058862_111577952 | 130 |
| 71 | 3300005327 | Ga0070658_10156097 | Ga0070658_101560972 | 130 |
| 72 | 3300005327 | Ga0070658_10199513 | Ga0070658_101995133 | 130 |
| 73 | 3300005327 | Ga0070658_11340938 | Ga0070658_113409381 | 130 |
| 74 | 3300005328 | Ga0070676_10002416 | Ga0070676_100024166 | 130 |
| 75 | 3300005329 | Ga0070683_100106209 | Ga0070683_1001062093 | 130 |
| 76 | 3300005336 | Ga0070680_100050557 | Ga0070680_1000505572 | 130 |
| 77 | 3300005338 | Ga0068868_100031260 | Ga0068868_1000312604 | 130 |
| 78 | 3300005339 | Ga0070660_100190979 | Ga0070660_1001909791 | 130 |
| 79 | 3300005340 | Ga0070689_101888142 | Ga0070689_1018881421 | 130 |
| 80 | 3300005354 | Ga0070675_101026573 | Ga0070675_1010265732 | 130 |
| 81 | 3300005355 | Ga0070671_100017668 | Ga0070671_1000176682 | 130 |
| 82 | 3300005356 | Ga0070674_101007005 | Ga0070674_1010070051 | 130 |
| 83 | 3300005364 | Ga0070673_100003698 | Ga0070673_1000036981 | 130 |
| 84 | 3300005364 | Ga0070673_100785563 | Ga0070673_1007855632 | 130 |
| 85 | 3300005366 | Ga0070659_100000766 | Ga0070659_10000076610 | 130 |
| 86 | 3300005366 | Ga0070659_101160681 | Ga0070659_1011606812 | 130 |
| 87 | 3300005439 | Ga0070711_100280871 | Ga0070711_1002808712 | 130 |
| 88 | 3300005456 | Ga0070678_100072911 | Ga0070678_1000729111 | 130 |
| 89 | 3300005456 | Ga0070678_100135001 | Ga0070678_1001350011 | 130 |
| 90 | 3300005457 | Ga0070662_100000043 | Ga0070662_10000004335 | 130 |
| 91 | 3300005458 | Ga0070681_10002600 | Ga0070681_1000260017 | 130 |
| 92 | 3300005459 | Ga0068867_100086395 | Ga0068867_1000863953 | 130 |
| 93 | 3300005459 | Ga0068867_101427587 | Ga0068867_1014275871 | 130 |
| 94 | 3300005530 | Ga0070679_100005033 | Ga0070679_10000503311 | 130 |
| 95 | 3300005535 | Ga0070684_101023685 | Ga0070684_1010236852 | 130 |
| 96 | 3300005539 | Ga0068853_100026336 | Ga0068853_1000263363 | 130 |
| 97 | 3300005548 | Ga0070665_100000017 | Ga0070665_100000017207 | 130 |
| 98 | 3300005548 | Ga0070665_101087588 | Ga0070665_1010875882 | 130 |
| 99 | 3300005563 | Ga0068855_100000060 | Ga0068855_10000006035 | 130 |
| 100 | 3300005563 | Ga0068855_100005005 | Ga0068855_1000050055 | 130 |
| 101 | 3300005563 | Ga0068855_100093441 | Ga0068855_1000934413 | 130 |
| 102 | 3300005563 | Ga0068855_100269617 | Ga0068855_1002696173 | 130 |
| 103 | 3300005563 | Ga0068855_100490007 | Ga0068855_1004900071 | 130 |
| 104 | 3300005578 | Ga0068854_100172017 | Ga0068854_1001720172 | 130 |
| 105 | 3300005614 | Ga0068856_100015573 | Ga0068856_1000155736 | 130 |
| 106 | 3300005614 | Ga0068856_100310564 | Ga0068856_1003105643 | 130 |
| 107 | 3300005614 | Ga0068856_100403441 | Ga0068856_1004034411 | 130 |
| 108 | 3300005614 | Ga0068856_100440600 | Ga0068856_1004406002 | 130 |
| 109 | 3300005616 | Ga0068852_100001476 | Ga0068852_10000147614 | 130 |
| 110 | 3300005616 | Ga0068852_101612144 | Ga0068852_1016121441 | 130 |
| 111 | 3300005617 | Ga0068859_101365763 | Ga0068859_1013657632 | 130 |
| 112 | 3300005718 | Ga0068866_10092384 | Ga0068866_100923843 | 130 |
| 113 | 3300005840 | Ga0068870_10035732 | Ga0068870_100357322 | 130 |
| 114 | 3300005841 | Ga0068863_100170839 | Ga0068863_1001708393 | 130 |
| 115 | 3300005842 | Ga0068858_100220214 | Ga0068858_1002202142 | 130 |
| 116 | 3300006195 | Ga0075366_10003458 | Ga0075366_100034586 | 130 |
| 117 | 3300006237 | Ga0097621_100000099 | Ga0097621_10000009919 | 130 |
| 118 | 3300006358 | Ga0068871_100000290 | Ga0068871_1000002905 | 130 |
| 119 | 3300006881 | Ga0068865_100005903 | Ga0068865_1000059034 | 130 |
| 120 | 3300006931 | Ga0097620_101365379 | Ga0097620_1013653792 | 130 |
| 121 | 3300009093 | Ga0105240_10034592 | Ga0105240_100345924 | 130 |
| 122 | 3300009093 | Ga0105240_10120468 | Ga0105240_101204683 | 130 |
| 123 | 3300009093 | Ga0105240_10447706 | Ga0105240_104477062 | 130 |
| 124 | 3300009093 | Ga0105240_10511755 | Ga0105240_105117552 | 130 |
| 125 | 3300009093 | Ga0105240_10729843 | Ga0105240_107298432 | 130 |
| 126 | 3300009093 | Ga0105240_10839050 | Ga0105240_108390501 | 130 |
| 127 | 3300009098 | Ga0105245_10818515 | Ga0105245_108185152 | 130 |
| 128 | 3300009148 | Ga0105243_10049063 | Ga0105243_100490633 | 130 |
| 129 | 3300009148 | Ga0105243_10190265 | Ga0105243_101902653 | 130 |
| 130 | 3300009174 | Ga0105241_10001269 | Ga0105241_100012693 | 130 |
| 131 | 3300009174 | Ga0105241_10011955 | Ga0105241_100119554 | 130 |
| 132 | 3300009174 | Ga0105241_10022435 | Ga0105241_100224356 | 130 |
| 133 | 3300009174 | Ga0105241_10172944 | Ga0105241_101729443 | 130 |
| 134 | 3300009174 | Ga0105241_10849084 | Ga0105241_108490842 | 130 |
| 135 | 3300009176 | Ga0105242_10125659 | Ga0105242_101256593 | 130 |
| 136 | 3300009176 | Ga0105242_12868679 | Ga0105242_128686791 | 130 |
| 137 | 3300009545 | Ga0105237_10000935 | Ga0105237_1000093511 | 130 |
| 138 | 3300009545 | Ga0105237_10001359 | Ga0105237_1000135923 | 130 |
| 139 | 3300009545 | Ga0105237_10004303 | Ga0105237_1000430315 | 130 |
| 140 | 3300009545 | Ga0105237_10089329 | Ga0105237_100893292 | 130 |
| 141 | 3300009545 | Ga0105237_10121520 | Ga0105237_101215202 | 130 |
| 142 | 3300009545 | Ga0105237_10860750 | Ga0105237_108607502 | 130 |
| 143 | 3300009551 | Ga0105238_10096865 | Ga0105238_100968652 | 130 |
| 144 | 3300009551 | Ga0105238_10273348 | Ga0105238_102733483 | 130 |
| 145 | 3300009551 | Ga0105238_10316085 | Ga0105238_103160853 | 130 |
| 146 | 3300009551 | Ga0105238_10559830 | Ga0105238_105598301 | 130 |
| 147 | 3300009551 | Ga0105238_10630769 | Ga0105238_106307692 | 130 |
| 148 | 3300009553 | Ga0105249_10214518 | Ga0105249_102145182 | 130 |
| 149 | 3300010375 | Ga0105239_10000074 | Ga0105239_10000074138 | 130 |
| 150 | 3300010375 | Ga0105239_10004144 | Ga0105239_1000414420 | 130 |
| 151 | 3300010375 | Ga0105239_10004630 | Ga0105239_100046302 | 130 |
| 152 | 3300010375 | Ga0105239_10152189 | Ga0105239_101521892 | 130 |
| 153 | 3300010375 | Ga0105239_10153183 | Ga0105239_101531835 | 130 |
| 154 | 3300010375 | Ga0105239_10192263 | Ga0105239_101922632 | 130 |
| 155 | 3300010375 | Ga0105239_10591045 | Ga0105239_105910452 | 130 |
| 156 | 3300011119 | Ga0105246_10034040 | Ga0105246_100340401 | 130 |
| 157 | 3300012513 | Ga0157326_1076873 | Ga0157326_10768731 | 130 |
| 158 | 3300013100 | Ga0157373_10000090 | Ga0157373_1000009050 | 130 |
| 159 | 3300013102 | Ga0157371_10080148 | Ga0157371_100801482 | 130 |
| 160 | 3300013104 | Ga0157370_10953368 | Ga0157370_109533682 | 130 |
| 161 | 3300013105 | Ga0157369_10032151 | Ga0157369_100321513 | 130 |
| 162 | 3300013105 | Ga0157369_10178585 | Ga0157369_101785852 | 130 |
| 163 | 3300013105 | Ga0157369_11383589 | Ga0157369_113835891 | 130 |
| 164 | 3300013105 | Ga0157369_11825787 | Ga0157369_118257871 | 130 |
| 165 | 3300013296 | Ga0157374_10000360 | Ga0157374_1000036038 | 130 |
| 166 | 3300013296 | Ga0157374_10001750 | Ga0157374_1000175012 | 130 |
| 167 | 3300013297 | Ga0157378_10027617 | Ga0157378_100276174 | 130 |
| 168 | 3300013297 | Ga0157378_10033590 | Ga0157378_100335901 | 130 |
| 169 | 3300013297 | Ga0157378_10916692 | Ga0157378_109166921 | 130 |
| 170 | 3300013297 | Ga0157378_12013557 | Ga0157378_120135571 | 130 |
| 171 | 3300013306 | Ga0163162_10000051 | Ga0163162_1000005183 | 130 |
| 172 | 3300013306 | Ga0163162_10002853 | Ga0163162_1000285314 | 130 |
| 173 | 3300013306 | Ga0163162_10003445 | Ga0163162_100034452 | 130 |
| 174 | 3300013306 | Ga0163162_10828998 | Ga0163162_108289982 | 130 |
| 175 | 3300013307 | Ga0157372_10002344 | Ga0157372_1000234423 | 130 |
| 176 | 3300013307 | Ga0157372_10021408 | Ga0157372_100214084 | 130 |
| 177 | 3300013308 | Ga0157375_10580485 | Ga0157375_105804852 | 130 |
| 178 | 3300013308 | Ga0157375_12448513 | Ga0157375_124485132 | 130 |
| 179 | 3300014326 | Ga0157380_11748410 | Ga0157380_117484101 | 130 |
| 180 | 3300014745 | Ga0157377_10011833 | Ga0157377_100118333 | 130 |
| 181 | 3300014969 | Ga0157376_10115178 | Ga0157376_101151783 | 130 |
| 182 | 3300014969 | Ga0157376_11025479 | Ga0157376_110254792 | 130 |
| 183 | 3300015262 | Ga0182007_10207193 | Ga0182007_102071932 | 130 |
| 184 | 3300025231 | Ga0207427_100159 | Ga0207427_10015973 | 130 |
| 185 | 3300025233 | Ga0209437_100021 | Ga0209437_10002193 | 130 |
| 186 | 3300025250 | Ga0209026_1008965 | Ga0209026_10089654 | 130 |
| 187 | 3300025250 | Ga0209026_1041216 | Ga0209026_10412161 | 130 |
| 188 | 3300025261 | Ga0209233_1000035 | Ga0209233_1000035544 | 130 |
| 189 | 3300025272 | Ga0209455_1000854 | Ga0209455_100085415 | 130 |
| 190 | 3300025904 | Ga0207647_10000036 | Ga0207647_1000003615 | 130 |
| 191 | 3300025904 | Ga0207647_10137175 | Ga0207647_101371752 | 130 |
| 192 | 3300025907 | Ga0207645_10000312 | Ga0207645_1000031236 | 130 |
| 193 | 3300025908 | Ga0207643_10277759 | Ga0207643_102777592 | 130 |
| 194 | 3300025909 | Ga0207705_10152355 | Ga0207705_101523551 | 130 |
| 195 | 3300025909 | Ga0207705_10248913 | Ga0207705_102489132 | 130 |
| 196 | 3300025909 | Ga0207705_10804605 | Ga0207705_108046052 | 130 |
| 197 | 3300025911 | Ga0207654_10012162 | Ga0207654_100121622 | 130 |
| 198 | 3300025911 | Ga0207654_10066304 | Ga0207654_100663043 | 130 |
| 199 | 3300025911 | Ga0207654_10188108 | Ga0207654_101881081 | 130 |
| 200 | 3300025911 | Ga0207654_10509575 | Ga0207654_105095751 | 130 |
| 201 | 3300025911 | Ga0207654_10671750 | Ga0207654_106717502 | 130 |
| 202 | 3300025912 | Ga0207707_10090091 | Ga0207707_100900914 | 130 |
| 203 | 3300025913 | Ga0207695_10000197 | Ga0207695_1000019759 | 130 |
| 204 | 3300025913 | Ga0207695_10044337 | Ga0207695_100443375 | 130 |
| 205 | 3300025913 | Ga0207695_10048999 | Ga0207695_100489995 | 130 |
| 206 | 3300025913 | Ga0207695_10378920 | Ga0207695_103789202 | 130 |
| 207 | 3300025913 | Ga0207695_10460502 | Ga0207695_104605022 | 130 |
| 208 | 3300025913 | Ga0207695_10859376 | Ga0207695_108593762 | 130 |
| 209 | 3300025914 | Ga0207671_10000516 | Ga0207671_1000051646 | 130 |
| 210 | 3300025914 | Ga0207671_10008997 | Ga0207671_100089972 | 130 |
| 211 | 3300025914 | Ga0207671_10050514 | Ga0207671_100505145 | 130 |
| 212 | 3300025914 | Ga0207671_10320513 | Ga0207671_103205132 | 130 |
| 213 | 3300025917 | Ga0207660_10061068 | Ga0207660_100610682 | 130 |
| 214 | 3300025919 | Ga0207657_10131676 | Ga0207657_101316761 | 130 |
| 215 | 3300025921 | Ga0207652_10027483 | Ga0207652_100274834 | 130 |
| 216 | 3300025924 | Ga0207694_10129991 | Ga0207694_101299912 | 130 |
| 217 | 3300025924 | Ga0207694_10377887 | Ga0207694_103778872 | 130 |
| 218 | 3300025931 | Ga0207644_10004264 | Ga0207644_100042645 | 130 |
| 219 | 3300025932 | Ga0207690_10003074 | Ga0207690_100030747 | 130 |
| 220 | 3300025932 | Ga0207690_10105159 | Ga0207690_101051592 | 130 |
| 221 | 3300025933 | Ga0207706_10000466 | Ga0207706_1000046636 | 130 |
| 222 | 3300025933 | Ga0207706_10356900 | Ga0207706_103569002 | 130 |
| 223 | 3300025934 | Ga0207686_10184554 | Ga0207686_101845543 | 130 |
| 224 | 3300025937 | Ga0207669_10794542 | Ga0207669_107945422 | 130 |
| 225 | 3300025938 | Ga0207704_10000123 | Ga0207704_100001233 | 130 |
| 226 | 3300025944 | Ga0207661_10080160 | Ga0207661_100801603 | 130 |
| 227 | 3300025949 | Ga0207667_10000033 | Ga0207667_10000033254 | 130 |
| 228 | 3300025949 | Ga0207667_10013290 | Ga0207667_100132908 | 130 |
| 229 | 3300025949 | Ga0207667_10038475 | Ga0207667_100384753 | 130 |
| 230 | 3300025949 | Ga0207667_10097087 | Ga0207667_100970873 | 130 |
| 231 | 3300025949 | Ga0207667_10382533 | Ga0207667_103825332 | 130 |
| 232 | 3300025949 | Ga0207667_11333979 | Ga0207667_113339792 | 130 |
| 233 | 3300025960 | Ga0207651_10588222 | Ga0207651_105882222 | 130 |
| 234 | 3300025960 | Ga0207651_11507880 | Ga0207651_115078801 | 130 |
| 235 | 3300025961 | Ga0207712_10130332 | Ga0207712_101303322 | 130 |
| 236 | 3300025981 | Ga0207640_10333275 | Ga0207640_103332752 | 130 |
| 237 | 3300026023 | Ga0207677_10029951 | Ga0207677_100299514 | 130 |
| 238 | 3300026023 | Ga0207677_10039733 | Ga0207677_100397333 | 130 |
| 239 | 3300026035 | Ga0207703_10149657 | Ga0207703_101496572 | 130 |
| 240 | 3300026041 | Ga0207639_10008486 | Ga0207639_100084865 | 130 |
| 241 | 3300026078 | Ga0207702_10041295 | Ga0207702_100412953 | 130 |
| 242 | 3300026078 | Ga0207702_10143412 | Ga0207702_101434122 | 130 |
| 243 | 3300026078 | Ga0207702_10951974 | Ga0207702_109519742 | 130 |
| 244 | 3300026078 | Ga0207702_11047276 | Ga0207702_110472762 | 130 |
| 245 | 3300026088 | Ga0207641_10677779 | Ga0207641_106777792 | 130 |
| 246 | 3300026089 | Ga0207648_10000913 | Ga0207648_100009135 | 130 |
| 247 | 3300026089 | Ga0207648_11970823 | Ga0207648_119708231 | 130 |
| 248 | 3300026121 | Ga0207683_10042837 | Ga0207683_100428375 | 130 |
| 249 | 3300026142 | Ga0207698_10158689 | Ga0207698_101586892 | 130 |
| 250 | 3300026142 | Ga0207698_12407986 | Ga0207698_124079861 | 130 |
| 251 | 3300026142 | Ga0207698_12754545 | Ga0207698_127545451 | 130 |
| 252 | 3300028379 | Ga0268266_10000037 | Ga0268266_10000037111 | 130 |
| 253 | 3300028654 | Ga0265322_10051744 | Ga0265322_100517442 | 130 |
| 254 | 3300028786 | Ga0307517_10008846 | Ga0307517_100088469 | 130 |
| 255 | 3300028800 | Ga0265338_10000448 | Ga0265338_1000044825 | 130 |
| 256 | 3300031251 | Ga0265327_10029801 | Ga0265327_100298014 | 130 |
| 257 | 3300031251 | Ga0265327_10154410 | Ga0265327_101544101 | 130 |
| 258 | 3300031507 | Ga0307509_10117242 | Ga0307509_101172421 | 130 |
| 259 | 3300031507 | Ga0307509_10332984 | Ga0307509_103329842 | 130 |
| 260 | 3300033180 | Ga0307510_10001091 | Ga0307510_1000109125 | 130 |
| 261 | 3300035115 | Ga0373941_0003096 | Ga0373941_0003096_1685_2083 | 130 |
| 262 | 3300037312 | Ga0395899_0004206 | Ga0395899_0004206_8008_8409 | 130 |
| 263 | 3300037418 | Ga0395900_0001720 | Ga0395900_0001720_17969_18370 | 130 |
| 264 | 3300037418 | Ga0395900_0215864 | Ga0395900_0215864_1106_1510 | 130 |
| 265 | 3300037466 | Ga0395898_0057445 | Ga0395898_0057445_2984_3385 | 130 |
| 266 | 3300037471 | Ga0395905_0002686 | Ga0395905_0002686_100_501 | 130 |
| 267 | 3300037471 | Ga0395905_1052421 | Ga0395905_1052421_294_695 | 130 |
| 268 | 3300038443 | Ga0395901_0013694 | Ga0395901_0013694_351_752 | 130 |
| 269 | 3300041511 | Ga0451855_1553403 | Ga0451855_1553403_677_1072 | 130 |
| 270 | 3300042876 | Ga0451577_0057967 | Ga0451577_0057967_1065_1481 | 130 |
| 271 | 3300042876 | Ga0451577_0060018 | Ga0451577_0060018_822_1223 | 130 |
| 272 | 3300042876 | Ga0451577_0080184 | Ga0451577_0080184_318_716 | 130 |
| 273 | 3300042876 | Ga0451577_0435898 | Ga0451577_0435898_699_1112 | 130 |
| 274 | 3300044673 | Ga0453683_0000166 | Ga0453683_0000166_30680_31078 | 130 |
| 275 | 3300044673 | Ga0453683_0277755 | Ga0453683_0277755_587_988 | 130 |
| 276 | 3300044712 | Ga0453684_0201874 | Ga0453684_0201874_1545_1958 | 130 |
| 277 | 3300044712 | Ga0453684_0876731 | Ga0453684_0876731_14_424 | 130 |
| 278 | 3300044712 | Ga0453684_0883893 | Ga0453684_0883893_97_498 | 130 |
| 279 | 3300045049 | Ga0466959_0128403 | Ga0466959_0128403_1006_1407 | 130 |
| 280 | 3300045051 | Ga0451576_0167121 | Ga0451576_0167121_1263_1658 | 130 |
| 281 | 3300045051 | Ga0451576_0250882 | Ga0451576_0250882_349_747 | 130 |
| 282 | 3300045051 | Ga0451576_0349764 | Ga0451576_0349764_268_669 | 130 |
| 283 | 3300046454 | Ga0495592_0398711 | Ga0495592_0398711_416_814 | 130 |
| 284 | 3300046460 | Ga0495638_0091176 | Ga0495638_0091176_456_848 | 130 |
| 285 | 3300046462 | Ga0495651_0739583 | Ga0495651_0739583_122_520 | 130 |
| 286 | 3300046471 | Ga0495650_0000050 | Ga0495650_0000050_62987_63379 | 130 |
| 287 | 3300046474 | Ga0495605_0154218 | Ga0495605_0154218_290_694 | 130 |
| 288 | 3300046492 | Ga0495585_0000198 | Ga0495585_0000198_2806_3198 | 130 |
| 289 | 3300046506 | Ga0495583_0011473 | Ga0495583_0011473_4156_4548 | 130 |
| 290 | 3300046507 | Ga0495606_0000213 | Ga0495606_0000213_83487_83879 | 130 |
| 291 | 3300046507 | Ga0495606_0183159 | Ga0495606_0183159_10_408 | 130 |
| 292 | 3300046507 | Ga0495606_0430662 | Ga0495606_0430662_250_654 | 130 |
| 293 | 3300046512 | Ga0495610_0001134 | Ga0495610_0001134_10253_10645 | 130 |
| 294 | 3300046513 | Ga0495616_0022684 | Ga0495616_0022684_36_428 | 130 |
| 295 | 3300046513 | Ga0495616_0202795 | Ga0495616_0202795_434_826 | 130 |
| 296 | 3300046514 | Ga0495618_0355076 | Ga0495618_0355076_176_574 | 130 |
| 297 | 3300046519 | Ga0495632_0161917 | Ga0495632_0161917_290_688 | 130 |
| 298 | 3300046520 | Ga0495637_0024299 | Ga0495637_0024299_183_575 | 130 |
| 299 | 3300046520 | Ga0495637_0033328 | Ga0495637_0033328_1606_1998 | 130 |
| 300 | 3300046528 | Ga0495642_0176040 | Ga0495642_0176040_165_563 | 130 |
| 301 | 3300046529 | Ga0495652_0170280 | Ga0495652_0170280_158_556 | 130 |
| 302 | 3300046558 | Ga0495633_0004623 | Ga0495633_0004623_2943_3335 | 130 |
| 303 | 3300046616 | Ga0495668_0169339 | Ga0495668_0169339_325_723 | 130 |
| 304 | 3300046616 | Ga0495668_0483421 | Ga0495668_0483421_13_405 | 130 |
| 305 | 3300046660 | Ga0495625_0000105 | Ga0495625_0000105_72929_73321 | 130 |
| 306 | 3300046660 | Ga0495625_0438323 | Ga0495625_0438323_201_599 | 130 |
| 307 | 3300046665 | Ga0495661_0001116 | Ga0495661_0001116_5176_5580 | 130 |
| 308 | 3300046665 | Ga0495661_0004162 | Ga0495661_0004162_554_946 | 130 |
| 309 | 3300046665 | Ga0495661_0021682 | Ga0495661_0021682_714_1118 | 130 |
| 310 | 3300046694 | Ga0495649_0322160 | Ga0495649_0322160_346_744 | 130 |
| 311 | 3300046810 | Ga0495660_0014777 | Ga0495660_0014777_1863_2264 | 130 |
| 312 | 3300047319 | Ga0495674_1424345 | Ga0495674_1424345_27_425 | 130 |
| 313 | 3300047323 | Ga0495683_0071377 | Ga0495683_0071377_1011_1409 | 130 |
| 314 | 3300047443 | Ga0495687_000249 | Ga0495687_000249_10172_10564 | 130 |
| 315 | 3300047469 | Ga0495673_0017458 | Ga0495673_0017458_1046_1438 | 130 |
| 316 | 3300047472 | Ga0495686_0054555 | Ga0495686_0054555_327_722 | 130 |
| 317 | 3300048908 | Ga0496105_1222973 | Ga0496105_1222973_33_431 | 130 |
| 318 | 3300050493 | nmdc:mga0k408_20927_c1 | nmdc:mga0k408_20927_c1_1406_1798 | 130 |
| 319 | 3300050493 | nmdc:mga0k408_66_c1 | nmdc:mga0k408_66_c1_17042_17455 | 130 |
| 320 | 3300053122 | Ga0500608_000596 | Ga0500608_000596_5233_5631 | 130 |
| 321 | 3300053130 | Ga0500642_0144417 | Ga0500642_0144417_261_659 | 130 |
| 322 | 3300053161 | Ga0500634_0111127 | Ga0500634_0111127_363_761 | 130 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p0t-assembly1.cif.gz_B | crystal structure of an hit-like protein from mycobacterium paratuberculosis | 0.9384 | 3 | 129 |
| 7mqw-assembly1.cif.gz_B | histidine triad protein | 0.9115 | 1 | 129 |
| 3p0t-assembly1.cif.gz_B | crystal structure of an hit-like protein from mycobacterium paratuberculosis | 0.911 | 3 | 129 |
| 2eo4-assembly1.cif.gz_A-2 | crystal structure of hypothetical histidine triad nucleotide-binding protein st2152 from sulfolobus tokodaii strain7 | 0.9031 | 4 | 129 |
| 7mqw-assembly1.cif.gz_B | histidine triad protein | 0.8983 | 1 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WML3_1_133_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9583 | 1 | 129 | 3.30.428.10 |
| af_P9WML3_1_133_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9441 | 1 | 129 | 3.30.428.10 |
| af_A0A140LH01_2_105_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9279 | 15 | 98 | 3.30.428.10 |
| 1y23D01 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9235 | 2 | 103 | 3.30.428.10 |
| af_Q0IQH7_1_86_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9079 | 36 | 101 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A497YNP7-F1-model_v4 | deleted | 1.005 | 1 | 130 |
|
| AF-A0A5C1I6Y5-F1-model_v4 | HIT family protein | 1.005 | 1 | 130 |
GO:0003824
GO:0009117 |
| AF-A0A642C457-F1-model_v4 | HIT family protein | 1.001 | 15 | 128 |
GO:0003824
GO:0009117 |
| AF-A0A1G6U5L8-F1-model_v4 | Histidine triad (HIT) family protein | 0.9998 | 1 | 129 |
GO:0003824
GO:0009117 |
| AF-A0A358M0E2-F1-model_v4 | deleted | 0.9998 | 1 | 126 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar