F406553

General Info

Members Datasets Scaffolds Average Seq Length
322 181 317 132

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0057967|Ga0451577_0057967_1065_1481
Length 138
Sequence MSTIFTKIIQGEIPCFKVAETATFFAFLDIRPVAFGHTLVVPKKEVDYIFDMEDDELGEMFLFAKKVSRVLEHHVTCERVGVSVIGLEVPHTHVHLIPIRTLQDMNFSADRYVFDKGEYEILSAKLFSTFTEWYGSGE

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
3 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
4 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
5 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
177 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
178 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
179 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
180 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
181 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0.62
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.97
Nodule 0
Rhizoplane 0.62
Rhizosphere 89.13
Stem 0
Stem Tuber 0
Unclassified 5.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000007 3300002067 Bacteria 333510
2 JGI25162J39368_1001130 3300002737 Bacteria 16055
3 JGI25165J46597_1001079 3300003214 Bacteria 17498
4 rootH2_10306871 3300003320 Bacteria 1060
5 rootL2_10005487 3300003322 Bacteria 6002
6 rootH1_10007236 3300003323 Bacteria 15279
7 Ga0058863_11132184 3300004799 Bacteria 1045
8 Ga0058862_11157795 3300004803 Bacteria 729
9 Ga0065704_10470550 3300005289 Bacteria 689
10 Ga0070658_10156097 3300005327 Bacteria 1913
11 Ga0070658_10199513 3300005327 Bacteria 1688
12 Ga0070658_11340938 3300005327 Bacteria 621
13 Ga0070676_10002416 3300005328 Bacteria 9573
14 Ga0070683_100106209 3300005329 Bacteria 2647
15 Ga0070680_100050557 3300005336 Bacteria 3390
16 Ga0068868_100031260 3300005338 Bacteria 4088
17 Ga0070660_100190979 3300005339 Bacteria 1659
18 Ga0070689_101888142 3300005340 Unclassified 545
19 Ga0070675_101026573 3300005354 Bacteria 757
20 Ga0070671_100017668 3300005355 Bacteria 5780
21 Ga0070674_101007005 3300005356 Bacteria 731
22 Ga0070673_100003698 3300005364 Bacteria 9581
23 Ga0070673_100785563 3300005364 Bacteria 878
24 Ga0070659_100000766 3300005366 Bacteria 23347
25 Ga0070659_101160681 3300005366 Bacteria 682
26 Ga0070711_100280871 3300005439 Bacteria 1317
27 Ga0070678_100072911 3300005456 Bacteria 2575
28 Ga0070678_100135001 3300005456 Bacteria 1966
29 Ga0070662_100000043 3300005457 Bacteria 70660
30 Ga0070681_10002600 3300005458 Bacteria 16566
31 Ga0068867_100086395 3300005459 Bacteria 2373
32 Ga0068867_101427587 3300005459 Bacteria 642
33 Ga0070679_100005033 3300005530 Bacteria 12199
34 Ga0070684_101023685 3300005535 Bacteria 775
35 Ga0068853_100026336 3300005539 Bacteria 4882
36 Ga0070665_100000017 3300005548 Bacteria 448013
37 Ga0070665_101087588 3300005548 Bacteria 811
38 Ga0068855_100000060 3300005563 Bacteria 133838
39 Ga0068855_100000489 3300005563 Bacteria 48884
40 Ga0068855_100005005 3300005563 Bacteria 16170
41 Ga0068855_100093441 3300005563 Bacteria 3469
42 Ga0068855_100269617 3300005563 Bacteria 1893
43 Ga0068855_100490007 3300005563 Bacteria 1337
44 Ga0068854_100172017 3300005578 Bacteria 1686
45 Ga0068856_100015573 3300005614 Bacteria 7351
46 Ga0068856_100310564 3300005614 Bacteria 1594
47 Ga0068856_100403441 3300005614 Bacteria 1387
48 Ga0068856_100440600 3300005614 Unclassified 1323
49 Ga0068852_100001476 3300005616 Bacteria 15913
50 Ga0068852_101612144 3300005616 Bacteria 671
51 Ga0068859_101365763 3300005617 Bacteria 781
52 Ga0068866_10092384 3300005718 Bacteria 1651
53 Ga0068870_10035732 3300005840 Bacteria 2552
54 Ga0068863_100170839 3300005841 Bacteria 2085
55 Ga0068858_100220214 3300005842 Bacteria 1797
56 Ga0075366_10003458 3300006195 Bacteria 8335
57 Ga0097621_100000099 3300006237 Bacteria 48404
58 Ga0068871_100000290 3300006358 Bacteria 35074
59 Ga0068865_100005903 3300006881 Bacteria 7448
60 Ga0097620_101365379 3300006931 Bacteria 781
61 Ga0105240_10034592 3300009093 Bacteria 6516
62 Ga0105240_10043975 3300009093 Bacteria 5679
63 Ga0105240_10120468 3300009093 Bacteria 3160
64 Ga0105240_10447706 3300009093 Bacteria 1446
65 Ga0105240_10511755 3300009093 Bacteria 1333
66 Ga0105240_10729843 3300009093 Bacteria 1079
67 Ga0105240_10839050 3300009093 Bacteria 993
68 Ga0105245_10818515 3300009098 Bacteria 970
69 Ga0105243_10049063 3300009148 Bacteria 3330
70 Ga0105243_10190265 3300009148 Bacteria 1792
71 Ga0105241_10001269 3300009174 Bacteria 19251
72 Ga0105241_10011955 3300009174 Bacteria 6375
73 Ga0105241_10022435 3300009174 Bacteria 4676
74 Ga0105241_10172944 3300009174 Bacteria 1785
75 Ga0105241_10849084 3300009174 Bacteria 844
76 Ga0105242_10125659 3300009176 Bacteria 2207
77 Ga0105242_12868679 3300009176 Bacteria 532
78 Ga0105237_10000935 3300009545 Bacteria 39308
79 Ga0105237_10001359 3300009545 Bacteria 32392
80 Ga0105237_10004303 3300009545 Bacteria 16508
81 Ga0105237_10089329 3300009545 Bacteria 3071
82 Ga0105237_10121520 3300009545 Bacteria 2606
83 Ga0105237_10860750 3300009545 Bacteria 913
84 Ga0105238_10096865 3300009551 Bacteria 2936
85 Ga0105238_10273348 3300009551 Bacteria 1670
86 Ga0105238_10316085 3300009551 Bacteria 1547
87 Ga0105238_10559830 3300009551 Bacteria 1148
88 Ga0105238_10630769 3300009551 Bacteria 1081
89 Ga0105249_10214518 3300009553 Bacteria 1891
90 Ga0105239_10000074 3300010375 Bacteria 140673
91 Ga0105239_10004144 3300010375 Bacteria 17403
92 Ga0105239_10004630 3300010375 Bacteria 16346
93 Ga0105239_10152189 3300010375 Bacteria 2582
94 Ga0105239_10153183 3300010375 Bacteria 2573
95 Ga0105239_10192263 3300010375 Bacteria 2284
96 Ga0105239_10591045 3300010375 Bacteria 1266
97 Ga0105246_10034040 3300011119 Bacteria 3390
98 Ga0157326_1076873 3300012513 Bacteria 539
99 Ga0157373_10000090 3300013100 Bacteria 78142
100 Ga0157371_10080148 3300013102 Bacteria 2312
101 Ga0157370_10953368 3300013104 Bacteria 778
102 Ga0157369_10032151 3300013105 Bacteria 5771
103 Ga0157369_10178585 3300013105 Bacteria 2234
104 Ga0157369_11383589 3300013105 Bacteria 716
105 Ga0157369_11825787 3300013105 Unclassified 617
106 Ga0157374_10000360 3300013296 Bacteria 42177
107 Ga0157374_10001750 3300013296 Bacteria 18236
108 Ga0157378_10027617 3300013297 Bacteria 5007
109 Ga0157378_10033590 3300013297 Bacteria 4536
110 Ga0157378_10916692 3300013297 Bacteria 908
111 Ga0157378_12013557 3300013297 Bacteria 627
112 Ga0163162_10000051 3300013306 Bacteria 117695
113 Ga0163162_10002853 3300013306 Bacteria 16447
114 Ga0163162_10003445 3300013306 Bacteria 15107
115 Ga0163162_10828998 3300013306 Bacteria 1041
116 Ga0157372_10002344 3300013307 Bacteria 20484
117 Ga0157372_10021408 3300013307 Bacteria 6985
118 Ga0157375_10580485 3300013308 Bacteria 1281
119 Ga0157375_12448513 3300013308 Bacteria 623
120 Ga0163163_10827982 3300014325 Bacteria 989
121 Ga0157380_11465993 3300014326 Unclassified 735
122 Ga0157380_11748410 3300014326 Bacteria 680
123 Ga0182008_10170899 3300014497 Bacteria 1097
124 Ga0182008_10218746 3300014497 Bacteria 974
125 Ga0157377_10011833 3300014745 Bacteria 4368
126 Ga0157376_10115178 3300014969 Bacteria 2373
127 Ga0157376_11025479 3300014969 Bacteria 848
128 Ga0182007_10006614 3300015262 Bacteria 4964
129 Ga0182007_10018866 3300015262 Bacteria 2491
130 Ga0182007_10207193 3300015262 Bacteria 688
131 Ga0207427_100159 3300025231 Bacteria 76256
132 Ga0209437_100021 3300025233 Bacteria 646400
133 Ga0209026_1003403 3300025250 Bacteria 5243
134 Ga0209026_1008965 3300025250 Bacteria 2022
135 Ga0209026_1041216 3300025250 Unclassified 669
136 Ga0209233_1000035 3300025261 Bacteria 568478
137 Ga0209233_1020888 3300025261 Bacteria 1707
138 Ga0209455_1000854 3300025272 Bacteria 16294
139 Ga0207647_10000036 3300025904 Bacteria 98204
140 Ga0207647_10137175 3300025904 Bacteria 1435
141 Ga0207645_10000312 3300025907 Bacteria 40968
142 Ga0207643_10277759 3300025908 Bacteria 1038
143 Ga0207705_10152355 3300025909 Bacteria 1733
144 Ga0207705_10248913 3300025909 Bacteria 1355
145 Ga0207705_10804605 3300025909 Bacteria 729
146 Ga0207654_10012162 3300025911 Bacteria 4405
147 Ga0207654_10066304 3300025911 Bacteria 2129
148 Ga0207654_10188108 3300025911 Bacteria 1351
149 Ga0207654_10509575 3300025911 Bacteria 851
150 Ga0207654_10671750 3300025911 Bacteria 743
151 Ga0207707_10090091 3300025912 Bacteria 2681
152 Ga0207695_10000197 3300025913 Bacteria 168837
153 Ga0207695_10044337 3300025913 Bacteria 4731
154 Ga0207695_10048999 3300025913 Bacteria 4456
155 Ga0207695_10053524 3300025913 Bacteria 4221
156 Ga0207695_10378920 3300025913 Bacteria 1300
157 Ga0207695_10460502 3300025913 Bacteria 1155
158 Ga0207695_10859376 3300025913 Bacteria 787
159 Ga0207671_10000516 3300025914 Bacteria 52391
160 Ga0207671_10008997 3300025914 Bacteria 8400
161 Ga0207671_10050514 3300025914 Bacteria 3079
162 Ga0207671_10320513 3300025914 Bacteria 1226
163 Ga0207660_10061068 3300025917 Bacteria 2712
164 Ga0207657_10131676 3300025919 Bacteria 2049
165 Ga0207652_10027483 3300025921 Bacteria 4741
166 Ga0207694_10129991 3300025924 Bacteria 2018
167 Ga0207694_10377887 3300025924 Bacteria 1176
168 Ga0207644_10004264 3300025931 Bacteria 9279
169 Ga0207690_10003074 3300025932 Bacteria 10052
170 Ga0207690_10105159 3300025932 Bacteria 2024
171 Ga0207706_10000466 3300025933 Bacteria 43209
172 Ga0207706_10356900 3300025933 Bacteria 1270
173 Ga0207686_10184554 3300025934 Bacteria 1482
174 Ga0207669_10794542 3300025937 Bacteria 784
175 Ga0207704_10000123 3300025938 Bacteria 41995
176 Ga0207661_10080160 3300025944 Bacteria 2693
177 Ga0207667_10000033 3300025949 Bacteria 314353
178 Ga0207667_10000408 3300025949 Bacteria 58389
179 Ga0207667_10013290 3300025949 Bacteria 9430
180 Ga0207667_10038475 3300025949 Bacteria 5109
181 Ga0207667_10097087 3300025949 Bacteria 3041
182 Ga0207667_10382533 3300025949 Bacteria 1434
183 Ga0207667_11333979 3300025949 Bacteria 693
184 Ga0207651_10588222 3300025960 Bacteria 972
185 Ga0207651_11507880 3300025960 Bacteria 605
186 Ga0207712_10130332 3300025961 Bacteria 1915
187 Ga0207640_10333275 3300025981 Bacteria 1213
188 Ga0207677_10029951 3300026023 Bacteria 3467
189 Ga0207677_10039733 3300026023 Bacteria 3096
190 Ga0207703_10149657 3300026035 Bacteria 2034
191 Ga0207639_10008486 3300026041 Bacteria 7043
192 Ga0207702_10041295 3300026078 Bacteria 3868
193 Ga0207702_10143412 3300026078 Bacteria 2164
194 Ga0207702_10951974 3300026078 Unclassified 851
195 Ga0207702_11047276 3300026078 Bacteria 809
196 Ga0207641_10677779 3300026088 Bacteria 1014
197 Ga0207648_10000913 3300026089 Bacteria 33285
198 Ga0207648_11970823 3300026089 Bacteria 545
199 Ga0207683_10042837 3300026121 Bacteria 3953
200 Ga0207698_10158689 3300026142 Bacteria 1975
201 Ga0207698_12407986 3300026142 Unclassified 537
202 Ga0207698_12754545 3300026142 Bacteria 500
203 Ga0268266_10000037 3300028379 Bacteria 342368
204 Ga0265322_10051744 3300028654 Bacteria 1166
205 Ga0307517_10008846 3300028786 Bacteria 14389
206 Ga0307515_10000299 3300028794 Bacteria 122087
207 Ga0307515_10017355 3300028794 Bacteria 13116
208 Ga0265338_10000448 3300028800 Bacteria 73538
209 Ga0316181_1053068 3300030744 Unclassified 984
210 Ga0265327_10029801 3300031251 Bacteria 3097
211 Ga0265327_10154410 3300031251 Bacteria 1064
212 Ga0307509_10117242 3300031507 Bacteria 2650
213 Ga0307509_10332984 3300031507 Bacteria 1249
214 Ga0316576_10088165 3300031727 Unclassified 2310
215 Ga0307405_10030688 3300031731 Bacteria 3154
216 Ga0307412_10011880 3300031911 Bacteria 5057
217 Ga0307507_10000313 3300033179 Bacteria 97672
218 Ga0307510_10001091 3300033180 Bacteria 28923
219 Ga0373941_0003096 3300035115 Bacteria 3730
220 Ga0395899_0004206 3300037312 Bacteria 11292
221 Ga0395900_0000478 3300037418 Bacteria 56604
222 Ga0395900_0001720 3300037418 Bacteria 25283
223 Ga0395900_0215864 3300037418 Bacteria 1936
224 Ga0395898_0057445 3300037466 Bacteria 3792
225 Ga0395905_0002686 3300037471 Bacteria 19498
226 Ga0395905_0182922 3300037471 Bacteria 1968
227 Ga0395905_1052421 3300037471 Bacteria 717
228 Ga0395901_0013694 3300038443 Bacteria 8244
229 Ga0451855_1553403 3300041511 Bacteria 1516
230 Ga0451577_0000112 3300042876 Bacteria 177581
231 Ga0451577_0016611 3300042876 Bacteria 6810
232 Ga0451577_0057967 3300042876 Bacteria 3452
233 Ga0451577_0060018 3300042876 Bacteria 3391
234 Ga0451577_0080184 3300042876 Bacteria 2910
235 Ga0451577_0155585 3300042876 Bacteria 2057
236 Ga0451577_0435898 3300042876 Bacteria 1190
237 Ga0453683_0000166 3300044673 Bacteria 94433
238 Ga0453683_0092761 3300044673 Bacteria 1893
239 Ga0453683_0277755 3300044673 Bacteria 1069
240 Ga0453683_0413304 3300044673 Bacteria 870
241 Ga0453684_0000225 3300044712 Bacteria 245902
242 Ga0453684_0000398 3300044712 Bacteria 178891
243 Ga0453684_0001657 3300044712 Bacteria 60393
244 Ga0453684_0027908 3300044712 Bacteria 8075
245 Ga0453684_0201874 3300044712 Bacteria 2317
246 Ga0453684_0876731 3300044712 Bacteria 963
247 Ga0453684_0883893 3300044712 Bacteria 958
248 Ga0466959_0128403 3300045049 Bacteria 1798
249 Ga0451576_0000835 3300045051 Bacteria 60014
250 Ga0451576_0003107 3300045051 Bacteria 23290
251 Ga0451576_0009419 3300045051 Bacteria 11321
252 Ga0451576_0167121 3300045051 Bacteria 2296
253 Ga0451576_0196003 3300045051 Bacteria 2110
254 Ga0451576_0250882 3300045051 Bacteria 1849
255 Ga0451576_0349764 3300045051 Unclassified 1547
256 Ga0451576_0448896 3300045051 Bacteria 1354
257 Ga0495592_0398711 3300046454 Bacteria 872
258 Ga0495629_0121174 3300046459 Bacteria 1822
259 Ga0495638_0091176 3300046460 Bacteria 1836
260 Ga0495651_0500993 3300046462 Bacteria 777
261 Ga0495651_0739583 3300046462 Bacteria 611
262 Ga0495653_0812578 3300046463 Bacteria 561
263 Ga0495650_0000050 3300046471 Bacteria 318894
264 Ga0495605_0154218 3300046474 Bacteria 1023
265 Ga0495585_0000198 3300046492 Bacteria 62640
266 Ga0495585_0001607 3300046492 Bacteria 17441
267 Ga0495583_0011473 3300046506 Bacteria 5085
268 Ga0495606_0000213 3300046507 Bacteria 103305
269 Ga0495606_0183159 3300046507 Bacteria 1206
270 Ga0495606_0430662 3300046507 Bacteria 680
271 Ga0495610_0001134 3300046512 Bacteria 24228
272 Ga0495616_0022684 3300046513 Bacteria 3387
273 Ga0495616_0148772 3300046513 Bacteria 1061
274 Ga0495616_0202795 3300046513 Bacteria 871
275 Ga0495618_0355076 3300046514 Bacteria 903
276 Ga0495631_0240086 3300046518 Bacteria 773
277 Ga0495632_0161917 3300046519 Bacteria 1030
278 Ga0495637_0024299 3300046520 Bacteria 2742
279 Ga0495637_0033328 3300046520 Bacteria 2263
280 Ga0495648_0007028 3300046524 Bacteria 9074
281 Ga0495642_0176040 3300046528 Bacteria 930
282 Ga0495652_0170280 3300046529 Bacteria 1682
283 Ga0495654_0099397 3300046530 Bacteria 1341
284 Ga0495609_0002985 3300046538 Bacteria 9997
285 Ga0495622_0066925 3300046557 Bacteria 1660
286 Ga0495633_0000295 3300046558 Bacteria 56870
287 Ga0495633_0004623 3300046558 Bacteria 8671
288 Ga0495668_0000121 3300046616 Bacteria 116234
289 Ga0495668_0169339 3300046616 Bacteria 1197
290 Ga0495668_0483421 3300046616 Bacteria 682
291 Ga0495625_0000105 3300046660 Bacteria 126078
292 Ga0495625_0000316 3300046660 Bacteria 73939
293 Ga0495625_0438323 3300046660 Bacteria 809
294 Ga0495635_0935810 3300046663 Bacteria 554
295 Ga0495661_0001116 3300046665 Bacteria 23480
296 Ga0495661_0004162 3300046665 Bacteria 10522
297 Ga0495661_0021682 3300046665 Bacteria 4184
298 Ga0495649_0322160 3300046694 Unclassified 784
299 Ga0495600_0344552 3300046809 Bacteria 934
300 Ga0495660_0014777 3300046810 Bacteria 4515
301 Ga0495660_0089654 3300046810 Bacteria 1601
302 Ga0495674_1424345 3300047319 Bacteria 516
303 Ga0495683_0071377 3300047323 Bacteria 1704
304 Ga0495687_000249 3300047443 Bacteria 72846
305 Ga0495673_0017458 3300047469 Bacteria 3643
306 Ga0495686_0054555 3300047472 Bacteria 2502
307 Ga0495614_0012346 3300048089 Bacteria 3749
308 Ga0496105_1222973 3300048908 Bacteria 552
309 Ga0501223_003582 3300049663 Bacteria 3360
310 nmdc:mga0k408_20927_c1 3300050493 Bacteria 3671
311 nmdc:mga0k408_66_c1 3300050493 Bacteria 33479
312 Ga0500647_0072279 3300053091 Bacteria 1657
313 Ga0500608_000596 3300053122 Bacteria 13310
314 Ga0500642_0144417 3300053130 Bacteria 1117
315 Ga0500655_043043 3300053133 Bacteria 889
316 Ga0500561_0027880 3300053137 Bacteria 1397
317 Ga0500634_0111127 3300053161 Bacteria 1352

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10043975 Ga0105240_100439751 119
2 3300014325 Ga0163163_10827982 Ga0163163_108279821 119
3 3300025913 Ga0207695_10053524 Ga0207695_100535244 120
4 3300037418 Ga0395900_0000478 Ga0395900_0000478_14627_15007 123
5 iso_pu_bacteria 2599185184 2599479813 126
6 iso_pu_bacteria 2928078545 2928080944 126
7 iso_pu_bacteria 2928147474 2928152637 126
8 iso_pu_bacteria 2932082852 2932086963 126
9 iso_pu_bacteria 2977232053 2977234088 126
10 3300037471 Ga0395905_0182922 Ga0395905_0182922_722_1111 128
11 3300042876 Ga0451577_0155585 Ga0451577_0155585_1444_1836 128
12 3300044712 Ga0453684_0000225 Ga0453684_0000225_194607_194999 128
13 3300003322 rootL2_10005487 rootL2_100054872 129
14 3300005289 Ga0065704_10470550 Ga0065704_104705501 129
15 3300005563 Ga0068855_100000489 Ga0068855_10000048926 129
16 3300014326 Ga0157380_11465993 Ga0157380_114659932 129
17 3300014497 Ga0182008_10170899 Ga0182008_101708991 129
18 3300014497 Ga0182008_10218746 Ga0182008_102187462 129
19 3300015262 Ga0182007_10006614 Ga0182007_100066145 129
20 3300015262 Ga0182007_10018866 Ga0182007_100188663 129
21 3300025250 Ga0209026_1003403 Ga0209026_10034036 129
22 3300025261 Ga0209233_1020888 Ga0209233_10208882 129
23 3300025949 Ga0207667_10000408 Ga0207667_1000040831 129
24 3300028794 Ga0307515_10000299 Ga0307515_10000299120 129
25 3300028794 Ga0307515_10017355 Ga0307515_1001735512 129
26 3300030744 Ga0316181_1053068 Ga0316181_10530682 129
27 3300031727 Ga0316576_10088165 Ga0316576_100881652 129
28 3300031731 Ga0307405_10030688 Ga0307405_100306882 129
29 3300031911 Ga0307412_10011880 Ga0307412_100118804 129
30 3300033179 Ga0307507_10000313 Ga0307507_1000031361 129
31 3300042876 Ga0451577_0000112 Ga0451577_0000112_168599_168991 129
32 3300042876 Ga0451577_0016611 Ga0451577_0016611_5513_5908 129
33 3300044673 Ga0453683_0092761 Ga0453683_0092761_110_502 129
34 3300044673 Ga0453683_0413304 Ga0453683_0413304_458_853 129
35 3300044712 Ga0453684_0000398 Ga0453684_0000398_168448_168840 129
36 3300044712 Ga0453684_0001657 Ga0453684_0001657_1402_1797 129
37 3300044712 Ga0453684_0027908 Ga0453684_0027908_3917_4312 129
38 3300045051 Ga0451576_0000835 Ga0451576_0000835_58607_59002 129
39 3300045051 Ga0451576_0003107 Ga0451576_0003107_15980_16372 129
40 3300045051 Ga0451576_0009419 Ga0451576_0009419_2347_2739 129
41 3300045051 Ga0451576_0196003 Ga0451576_0196003_896_1291 129
42 3300045051 Ga0451576_0448896 Ga0451576_0448896_919_1320 129
43 3300046459 Ga0495629_0121174 Ga0495629_0121174_778_1167 129
44 3300046462 Ga0495651_0500993 Ga0495651_0500993_108_497 129
45 3300046463 Ga0495653_0812578 Ga0495653_0812578_106_495 129
46 3300046492 Ga0495585_0001607 Ga0495585_0001607_3197_3586 129
47 3300046513 Ga0495616_0148772 Ga0495616_0148772_147_536 129
48 3300046518 Ga0495631_0240086 Ga0495631_0240086_56_445 129
49 3300046524 Ga0495648_0007028 Ga0495648_0007028_1146_1535 129
50 3300046530 Ga0495654_0099397 Ga0495654_0099397_738_1127 129
51 3300046538 Ga0495609_0002985 Ga0495609_0002985_1786_2175 129
52 3300046557 Ga0495622_0066925 Ga0495622_0066925_683_1072 129
53 3300046558 Ga0495633_0000295 Ga0495633_0000295_55334_55723 129
54 3300046616 Ga0495668_0000121 Ga0495668_0000121_4375_4764 129
55 3300046660 Ga0495625_0000316 Ga0495625_0000316_37936_38325 129
56 3300046663 Ga0495635_0935810 Ga0495635_0935810_131_520 129
57 3300046809 Ga0495600_0344552 Ga0495600_0344552_482_871 129
58 3300046810 Ga0495660_0089654 Ga0495660_0089654_1159_1548 129
59 3300048089 Ga0495614_0012346 Ga0495614_0012346_1262_1651 129
60 3300049663 Ga0501223_003582 Ga0501223_003582_2608_3000 129
61 3300053091 Ga0500647_0072279 Ga0500647_0072279_245_634 129
62 3300053133 Ga0500655_043043 Ga0500655_043043_420_809 129
63 3300053137 Ga0500561_0027880 Ga0500561_0027880_681_1070 129
64 3300002067 JGI24735J21928_10000007 JGI24735J21928_10000007147 130
65 3300002737 JGI25162J39368_1001130 JGI25162J39368_100113011 130
66 3300003214 JGI25165J46597_1001079 JGI25165J46597_10010796 130
67 3300003320 rootH2_10306871 rootH2_103068712 130
68 3300003323 rootH1_10007236 rootH1_1000723610 130
69 3300004799 Ga0058863_11132184 Ga0058863_111321841 130
70 3300004803 Ga0058862_11157795 Ga0058862_111577952 130
71 3300005327 Ga0070658_10156097 Ga0070658_101560972 130
72 3300005327 Ga0070658_10199513 Ga0070658_101995133 130
73 3300005327 Ga0070658_11340938 Ga0070658_113409381 130
74 3300005328 Ga0070676_10002416 Ga0070676_100024166 130
75 3300005329 Ga0070683_100106209 Ga0070683_1001062093 130
76 3300005336 Ga0070680_100050557 Ga0070680_1000505572 130
77 3300005338 Ga0068868_100031260 Ga0068868_1000312604 130
78 3300005339 Ga0070660_100190979 Ga0070660_1001909791 130
79 3300005340 Ga0070689_101888142 Ga0070689_1018881421 130
80 3300005354 Ga0070675_101026573 Ga0070675_1010265732 130
81 3300005355 Ga0070671_100017668 Ga0070671_1000176682 130
82 3300005356 Ga0070674_101007005 Ga0070674_1010070051 130
83 3300005364 Ga0070673_100003698 Ga0070673_1000036981 130
84 3300005364 Ga0070673_100785563 Ga0070673_1007855632 130
85 3300005366 Ga0070659_100000766 Ga0070659_10000076610 130
86 3300005366 Ga0070659_101160681 Ga0070659_1011606812 130
87 3300005439 Ga0070711_100280871 Ga0070711_1002808712 130
88 3300005456 Ga0070678_100072911 Ga0070678_1000729111 130
89 3300005456 Ga0070678_100135001 Ga0070678_1001350011 130
90 3300005457 Ga0070662_100000043 Ga0070662_10000004335 130
91 3300005458 Ga0070681_10002600 Ga0070681_1000260017 130
92 3300005459 Ga0068867_100086395 Ga0068867_1000863953 130
93 3300005459 Ga0068867_101427587 Ga0068867_1014275871 130
94 3300005530 Ga0070679_100005033 Ga0070679_10000503311 130
95 3300005535 Ga0070684_101023685 Ga0070684_1010236852 130
96 3300005539 Ga0068853_100026336 Ga0068853_1000263363 130
97 3300005548 Ga0070665_100000017 Ga0070665_100000017207 130
98 3300005548 Ga0070665_101087588 Ga0070665_1010875882 130
99 3300005563 Ga0068855_100000060 Ga0068855_10000006035 130
100 3300005563 Ga0068855_100005005 Ga0068855_1000050055 130
101 3300005563 Ga0068855_100093441 Ga0068855_1000934413 130
102 3300005563 Ga0068855_100269617 Ga0068855_1002696173 130
103 3300005563 Ga0068855_100490007 Ga0068855_1004900071 130
104 3300005578 Ga0068854_100172017 Ga0068854_1001720172 130
105 3300005614 Ga0068856_100015573 Ga0068856_1000155736 130
106 3300005614 Ga0068856_100310564 Ga0068856_1003105643 130
107 3300005614 Ga0068856_100403441 Ga0068856_1004034411 130
108 3300005614 Ga0068856_100440600 Ga0068856_1004406002 130
109 3300005616 Ga0068852_100001476 Ga0068852_10000147614 130
110 3300005616 Ga0068852_101612144 Ga0068852_1016121441 130
111 3300005617 Ga0068859_101365763 Ga0068859_1013657632 130
112 3300005718 Ga0068866_10092384 Ga0068866_100923843 130
113 3300005840 Ga0068870_10035732 Ga0068870_100357322 130
114 3300005841 Ga0068863_100170839 Ga0068863_1001708393 130
115 3300005842 Ga0068858_100220214 Ga0068858_1002202142 130
116 3300006195 Ga0075366_10003458 Ga0075366_100034586 130
117 3300006237 Ga0097621_100000099 Ga0097621_10000009919 130
118 3300006358 Ga0068871_100000290 Ga0068871_1000002905 130
119 3300006881 Ga0068865_100005903 Ga0068865_1000059034 130
120 3300006931 Ga0097620_101365379 Ga0097620_1013653792 130
121 3300009093 Ga0105240_10034592 Ga0105240_100345924 130
122 3300009093 Ga0105240_10120468 Ga0105240_101204683 130
123 3300009093 Ga0105240_10447706 Ga0105240_104477062 130
124 3300009093 Ga0105240_10511755 Ga0105240_105117552 130
125 3300009093 Ga0105240_10729843 Ga0105240_107298432 130
126 3300009093 Ga0105240_10839050 Ga0105240_108390501 130
127 3300009098 Ga0105245_10818515 Ga0105245_108185152 130
128 3300009148 Ga0105243_10049063 Ga0105243_100490633 130
129 3300009148 Ga0105243_10190265 Ga0105243_101902653 130
130 3300009174 Ga0105241_10001269 Ga0105241_100012693 130
131 3300009174 Ga0105241_10011955 Ga0105241_100119554 130
132 3300009174 Ga0105241_10022435 Ga0105241_100224356 130
133 3300009174 Ga0105241_10172944 Ga0105241_101729443 130
134 3300009174 Ga0105241_10849084 Ga0105241_108490842 130
135 3300009176 Ga0105242_10125659 Ga0105242_101256593 130
136 3300009176 Ga0105242_12868679 Ga0105242_128686791 130
137 3300009545 Ga0105237_10000935 Ga0105237_1000093511 130
138 3300009545 Ga0105237_10001359 Ga0105237_1000135923 130
139 3300009545 Ga0105237_10004303 Ga0105237_1000430315 130
140 3300009545 Ga0105237_10089329 Ga0105237_100893292 130
141 3300009545 Ga0105237_10121520 Ga0105237_101215202 130
142 3300009545 Ga0105237_10860750 Ga0105237_108607502 130
143 3300009551 Ga0105238_10096865 Ga0105238_100968652 130
144 3300009551 Ga0105238_10273348 Ga0105238_102733483 130
145 3300009551 Ga0105238_10316085 Ga0105238_103160853 130
146 3300009551 Ga0105238_10559830 Ga0105238_105598301 130
147 3300009551 Ga0105238_10630769 Ga0105238_106307692 130
148 3300009553 Ga0105249_10214518 Ga0105249_102145182 130
149 3300010375 Ga0105239_10000074 Ga0105239_10000074138 130
150 3300010375 Ga0105239_10004144 Ga0105239_1000414420 130
151 3300010375 Ga0105239_10004630 Ga0105239_100046302 130
152 3300010375 Ga0105239_10152189 Ga0105239_101521892 130
153 3300010375 Ga0105239_10153183 Ga0105239_101531835 130
154 3300010375 Ga0105239_10192263 Ga0105239_101922632 130
155 3300010375 Ga0105239_10591045 Ga0105239_105910452 130
156 3300011119 Ga0105246_10034040 Ga0105246_100340401 130
157 3300012513 Ga0157326_1076873 Ga0157326_10768731 130
158 3300013100 Ga0157373_10000090 Ga0157373_1000009050 130
159 3300013102 Ga0157371_10080148 Ga0157371_100801482 130
160 3300013104 Ga0157370_10953368 Ga0157370_109533682 130
161 3300013105 Ga0157369_10032151 Ga0157369_100321513 130
162 3300013105 Ga0157369_10178585 Ga0157369_101785852 130
163 3300013105 Ga0157369_11383589 Ga0157369_113835891 130
164 3300013105 Ga0157369_11825787 Ga0157369_118257871 130
165 3300013296 Ga0157374_10000360 Ga0157374_1000036038 130
166 3300013296 Ga0157374_10001750 Ga0157374_1000175012 130
167 3300013297 Ga0157378_10027617 Ga0157378_100276174 130
168 3300013297 Ga0157378_10033590 Ga0157378_100335901 130
169 3300013297 Ga0157378_10916692 Ga0157378_109166921 130
170 3300013297 Ga0157378_12013557 Ga0157378_120135571 130
171 3300013306 Ga0163162_10000051 Ga0163162_1000005183 130
172 3300013306 Ga0163162_10002853 Ga0163162_1000285314 130
173 3300013306 Ga0163162_10003445 Ga0163162_100034452 130
174 3300013306 Ga0163162_10828998 Ga0163162_108289982 130
175 3300013307 Ga0157372_10002344 Ga0157372_1000234423 130
176 3300013307 Ga0157372_10021408 Ga0157372_100214084 130
177 3300013308 Ga0157375_10580485 Ga0157375_105804852 130
178 3300013308 Ga0157375_12448513 Ga0157375_124485132 130
179 3300014326 Ga0157380_11748410 Ga0157380_117484101 130
180 3300014745 Ga0157377_10011833 Ga0157377_100118333 130
181 3300014969 Ga0157376_10115178 Ga0157376_101151783 130
182 3300014969 Ga0157376_11025479 Ga0157376_110254792 130
183 3300015262 Ga0182007_10207193 Ga0182007_102071932 130
184 3300025231 Ga0207427_100159 Ga0207427_10015973 130
185 3300025233 Ga0209437_100021 Ga0209437_10002193 130
186 3300025250 Ga0209026_1008965 Ga0209026_10089654 130
187 3300025250 Ga0209026_1041216 Ga0209026_10412161 130
188 3300025261 Ga0209233_1000035 Ga0209233_1000035544 130
189 3300025272 Ga0209455_1000854 Ga0209455_100085415 130
190 3300025904 Ga0207647_10000036 Ga0207647_1000003615 130
191 3300025904 Ga0207647_10137175 Ga0207647_101371752 130
192 3300025907 Ga0207645_10000312 Ga0207645_1000031236 130
193 3300025908 Ga0207643_10277759 Ga0207643_102777592 130
194 3300025909 Ga0207705_10152355 Ga0207705_101523551 130
195 3300025909 Ga0207705_10248913 Ga0207705_102489132 130
196 3300025909 Ga0207705_10804605 Ga0207705_108046052 130
197 3300025911 Ga0207654_10012162 Ga0207654_100121622 130
198 3300025911 Ga0207654_10066304 Ga0207654_100663043 130
199 3300025911 Ga0207654_10188108 Ga0207654_101881081 130
200 3300025911 Ga0207654_10509575 Ga0207654_105095751 130
201 3300025911 Ga0207654_10671750 Ga0207654_106717502 130
202 3300025912 Ga0207707_10090091 Ga0207707_100900914 130
203 3300025913 Ga0207695_10000197 Ga0207695_1000019759 130
204 3300025913 Ga0207695_10044337 Ga0207695_100443375 130
205 3300025913 Ga0207695_10048999 Ga0207695_100489995 130
206 3300025913 Ga0207695_10378920 Ga0207695_103789202 130
207 3300025913 Ga0207695_10460502 Ga0207695_104605022 130
208 3300025913 Ga0207695_10859376 Ga0207695_108593762 130
209 3300025914 Ga0207671_10000516 Ga0207671_1000051646 130
210 3300025914 Ga0207671_10008997 Ga0207671_100089972 130
211 3300025914 Ga0207671_10050514 Ga0207671_100505145 130
212 3300025914 Ga0207671_10320513 Ga0207671_103205132 130
213 3300025917 Ga0207660_10061068 Ga0207660_100610682 130
214 3300025919 Ga0207657_10131676 Ga0207657_101316761 130
215 3300025921 Ga0207652_10027483 Ga0207652_100274834 130
216 3300025924 Ga0207694_10129991 Ga0207694_101299912 130
217 3300025924 Ga0207694_10377887 Ga0207694_103778872 130
218 3300025931 Ga0207644_10004264 Ga0207644_100042645 130
219 3300025932 Ga0207690_10003074 Ga0207690_100030747 130
220 3300025932 Ga0207690_10105159 Ga0207690_101051592 130
221 3300025933 Ga0207706_10000466 Ga0207706_1000046636 130
222 3300025933 Ga0207706_10356900 Ga0207706_103569002 130
223 3300025934 Ga0207686_10184554 Ga0207686_101845543 130
224 3300025937 Ga0207669_10794542 Ga0207669_107945422 130
225 3300025938 Ga0207704_10000123 Ga0207704_100001233 130
226 3300025944 Ga0207661_10080160 Ga0207661_100801603 130
227 3300025949 Ga0207667_10000033 Ga0207667_10000033254 130
228 3300025949 Ga0207667_10013290 Ga0207667_100132908 130
229 3300025949 Ga0207667_10038475 Ga0207667_100384753 130
230 3300025949 Ga0207667_10097087 Ga0207667_100970873 130
231 3300025949 Ga0207667_10382533 Ga0207667_103825332 130
232 3300025949 Ga0207667_11333979 Ga0207667_113339792 130
233 3300025960 Ga0207651_10588222 Ga0207651_105882222 130
234 3300025960 Ga0207651_11507880 Ga0207651_115078801 130
235 3300025961 Ga0207712_10130332 Ga0207712_101303322 130
236 3300025981 Ga0207640_10333275 Ga0207640_103332752 130
237 3300026023 Ga0207677_10029951 Ga0207677_100299514 130
238 3300026023 Ga0207677_10039733 Ga0207677_100397333 130
239 3300026035 Ga0207703_10149657 Ga0207703_101496572 130
240 3300026041 Ga0207639_10008486 Ga0207639_100084865 130
241 3300026078 Ga0207702_10041295 Ga0207702_100412953 130
242 3300026078 Ga0207702_10143412 Ga0207702_101434122 130
243 3300026078 Ga0207702_10951974 Ga0207702_109519742 130
244 3300026078 Ga0207702_11047276 Ga0207702_110472762 130
245 3300026088 Ga0207641_10677779 Ga0207641_106777792 130
246 3300026089 Ga0207648_10000913 Ga0207648_100009135 130
247 3300026089 Ga0207648_11970823 Ga0207648_119708231 130
248 3300026121 Ga0207683_10042837 Ga0207683_100428375 130
249 3300026142 Ga0207698_10158689 Ga0207698_101586892 130
250 3300026142 Ga0207698_12407986 Ga0207698_124079861 130
251 3300026142 Ga0207698_12754545 Ga0207698_127545451 130
252 3300028379 Ga0268266_10000037 Ga0268266_10000037111 130
253 3300028654 Ga0265322_10051744 Ga0265322_100517442 130
254 3300028786 Ga0307517_10008846 Ga0307517_100088469 130
255 3300028800 Ga0265338_10000448 Ga0265338_1000044825 130
256 3300031251 Ga0265327_10029801 Ga0265327_100298014 130
257 3300031251 Ga0265327_10154410 Ga0265327_101544101 130
258 3300031507 Ga0307509_10117242 Ga0307509_101172421 130
259 3300031507 Ga0307509_10332984 Ga0307509_103329842 130
260 3300033180 Ga0307510_10001091 Ga0307510_1000109125 130
261 3300035115 Ga0373941_0003096 Ga0373941_0003096_1685_2083 130
262 3300037312 Ga0395899_0004206 Ga0395899_0004206_8008_8409 130
263 3300037418 Ga0395900_0001720 Ga0395900_0001720_17969_18370 130
264 3300037418 Ga0395900_0215864 Ga0395900_0215864_1106_1510 130
265 3300037466 Ga0395898_0057445 Ga0395898_0057445_2984_3385 130
266 3300037471 Ga0395905_0002686 Ga0395905_0002686_100_501 130
267 3300037471 Ga0395905_1052421 Ga0395905_1052421_294_695 130
268 3300038443 Ga0395901_0013694 Ga0395901_0013694_351_752 130
269 3300041511 Ga0451855_1553403 Ga0451855_1553403_677_1072 130
270 3300042876 Ga0451577_0057967 Ga0451577_0057967_1065_1481 130
271 3300042876 Ga0451577_0060018 Ga0451577_0060018_822_1223 130
272 3300042876 Ga0451577_0080184 Ga0451577_0080184_318_716 130
273 3300042876 Ga0451577_0435898 Ga0451577_0435898_699_1112 130
274 3300044673 Ga0453683_0000166 Ga0453683_0000166_30680_31078 130
275 3300044673 Ga0453683_0277755 Ga0453683_0277755_587_988 130
276 3300044712 Ga0453684_0201874 Ga0453684_0201874_1545_1958 130
277 3300044712 Ga0453684_0876731 Ga0453684_0876731_14_424 130
278 3300044712 Ga0453684_0883893 Ga0453684_0883893_97_498 130
279 3300045049 Ga0466959_0128403 Ga0466959_0128403_1006_1407 130
280 3300045051 Ga0451576_0167121 Ga0451576_0167121_1263_1658 130
281 3300045051 Ga0451576_0250882 Ga0451576_0250882_349_747 130
282 3300045051 Ga0451576_0349764 Ga0451576_0349764_268_669 130
283 3300046454 Ga0495592_0398711 Ga0495592_0398711_416_814 130
284 3300046460 Ga0495638_0091176 Ga0495638_0091176_456_848 130
285 3300046462 Ga0495651_0739583 Ga0495651_0739583_122_520 130
286 3300046471 Ga0495650_0000050 Ga0495650_0000050_62987_63379 130
287 3300046474 Ga0495605_0154218 Ga0495605_0154218_290_694 130
288 3300046492 Ga0495585_0000198 Ga0495585_0000198_2806_3198 130
289 3300046506 Ga0495583_0011473 Ga0495583_0011473_4156_4548 130
290 3300046507 Ga0495606_0000213 Ga0495606_0000213_83487_83879 130
291 3300046507 Ga0495606_0183159 Ga0495606_0183159_10_408 130
292 3300046507 Ga0495606_0430662 Ga0495606_0430662_250_654 130
293 3300046512 Ga0495610_0001134 Ga0495610_0001134_10253_10645 130
294 3300046513 Ga0495616_0022684 Ga0495616_0022684_36_428 130
295 3300046513 Ga0495616_0202795 Ga0495616_0202795_434_826 130
296 3300046514 Ga0495618_0355076 Ga0495618_0355076_176_574 130
297 3300046519 Ga0495632_0161917 Ga0495632_0161917_290_688 130
298 3300046520 Ga0495637_0024299 Ga0495637_0024299_183_575 130
299 3300046520 Ga0495637_0033328 Ga0495637_0033328_1606_1998 130
300 3300046528 Ga0495642_0176040 Ga0495642_0176040_165_563 130
301 3300046529 Ga0495652_0170280 Ga0495652_0170280_158_556 130
302 3300046558 Ga0495633_0004623 Ga0495633_0004623_2943_3335 130
303 3300046616 Ga0495668_0169339 Ga0495668_0169339_325_723 130
304 3300046616 Ga0495668_0483421 Ga0495668_0483421_13_405 130
305 3300046660 Ga0495625_0000105 Ga0495625_0000105_72929_73321 130
306 3300046660 Ga0495625_0438323 Ga0495625_0438323_201_599 130
307 3300046665 Ga0495661_0001116 Ga0495661_0001116_5176_5580 130
308 3300046665 Ga0495661_0004162 Ga0495661_0004162_554_946 130
309 3300046665 Ga0495661_0021682 Ga0495661_0021682_714_1118 130
310 3300046694 Ga0495649_0322160 Ga0495649_0322160_346_744 130
311 3300046810 Ga0495660_0014777 Ga0495660_0014777_1863_2264 130
312 3300047319 Ga0495674_1424345 Ga0495674_1424345_27_425 130
313 3300047323 Ga0495683_0071377 Ga0495683_0071377_1011_1409 130
314 3300047443 Ga0495687_000249 Ga0495687_000249_10172_10564 130
315 3300047469 Ga0495673_0017458 Ga0495673_0017458_1046_1438 130
316 3300047472 Ga0495686_0054555 Ga0495686_0054555_327_722 130
317 3300048908 Ga0496105_1222973 Ga0496105_1222973_33_431 130
318 3300050493 nmdc:mga0k408_20927_c1 nmdc:mga0k408_20927_c1_1406_1798 130
319 3300050493 nmdc:mga0k408_66_c1 nmdc:mga0k408_66_c1_17042_17455 130
320 3300053122 Ga0500608_000596 Ga0500608_000596_5233_5631 130
321 3300053130 Ga0500642_0144417 Ga0500642_0144417_261_659 130
322 3300053161 Ga0500634_0111127 Ga0500634_0111127_363_761 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

10

102

0.95

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

2

110

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p0t-assembly1.cif.gz_B crystal structure of an hit-like protein from mycobacterium paratuberculosis 0.9384 3 129
7mqw-assembly1.cif.gz_B histidine triad protein 0.9115 1 129
3p0t-assembly1.cif.gz_B crystal structure of an hit-like protein from mycobacterium paratuberculosis 0.911 3 129
2eo4-assembly1.cif.gz_A-2 crystal structure of hypothetical histidine triad nucleotide-binding protein st2152 from sulfolobus tokodaii strain7 0.9031 4 129
7mqw-assembly1.cif.gz_B histidine triad protein 0.8983 1 129
ID Description Score Start End Superfamily
af_P9WML3_1_133_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9583 1 129 3.30.428.10
af_P9WML3_1_133_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9441 1 129 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9279 15 98 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9235 2 103 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9079 36 101 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A497YNP7-F1-model_v4 deleted 1.005 1 130
AF-A0A5C1I6Y5-F1-model_v4 HIT family protein 1.005 1 130 GO:0003824
GO:0009117
AF-A0A642C457-F1-model_v4 HIT family protein 1.001 15 128 GO:0003824
GO:0009117
AF-A0A1G6U5L8-F1-model_v4 Histidine triad (HIT) family protein 0.9998 1 129 GO:0003824
GO:0009117
AF-A0A358M0E2-F1-model_v4 deleted 0.9998 1 126

Feature Viewer

pLDDT pTM Quality
94.77 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map