F406503
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 322 | 198 | 322 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10019339|Ga0265338_100193392 |
| Length | 401 |
| Sequence | MVGAIADGDRPTRAMSSDVAGSGHPRPGSQQTFATSLGDGEATSFGWLFSLLVAGPSRASCCDEEPSVKLGVVGLGRMGANMVRRLLGAGHECVVFDIHPQTALDVAKFGATATRSLSDLIAKLEPPRAIWIMLPAAVVDATLRDIAPLLGSDDAVIDGGNSYYHDDIRRAKMLRERGIHYVDVGTSGGVWGFERGYCQMIGGEDAIVKRLDGIFSALAPGLDDASKSPRDDKGTVQRGYIHCGPAGAGHFVKMVHNGIEYGMMAAYAEGLNILRHANVGASERTSDAETAPLRHPELYQYDLNLPDIVETWRHGSVIGSWLLDLTAAALKKSSDLKDFTGRVSDSGEGRWTLKAAIDEGVPAPVLSMALTQRFASRGDADFANKLLSALRYQFGGHEEKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 118 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 119 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 121 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 122 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 123 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 126 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 127 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 128 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 129 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 131 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 132 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 139 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 140 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 141 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 142 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 143 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 144 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 160 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 161 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 162 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 165 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 166 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 198 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.11 |
| Rhizosphere | 95.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10000018 | 3300001991 | Bacteria | 14441 |
| 2 | rootH2_10002489 | 3300003320 | Bacteria | 14463 |
| 3 | Ga0065704_10001221 | 3300005289 | Bacteria | 15987 |
| 4 | Ga0065715_10090415 | 3300005293 | Bacteria | 7056 |
| 5 | Ga0070676_10102382 | 3300005328 | Bacteria | 1771 |
| 6 | Ga0070683_100002813 | 3300005329 | Bacteria | 13919 |
| 7 | Ga0070670_100022025 | 3300005331 | Bacteria | 5483 |
| 8 | Ga0070677_10016857 | 3300005333 | Bacteria | 2607 |
| 9 | Ga0070689_100010985 | 3300005340 | Bacteria | 6472 |
| 10 | Ga0070691_10000215 | 3300005341 | Bacteria | 19539 |
| 11 | Ga0070691_10066429 | 3300005341 | Bacteria | 1743 |
| 12 | Ga0070661_100001932 | 3300005344 | Bacteria | 14337 |
| 13 | Ga0070661_100006153 | 3300005344 | Bacteria | 8270 |
| 14 | Ga0070661_100208309 | 3300005344 | Bacteria | 1496 |
| 15 | Ga0070675_100001289 | 3300005354 | Bacteria | 18320 |
| 16 | Ga0070671_100000666 | 3300005355 | Bacteria | 24595 |
| 17 | Ga0070673_100002795 | 3300005364 | Bacteria | 10728 |
| 18 | Ga0070709_10003388 | 3300005434 | Bacteria | 8563 |
| 19 | Ga0070714_100038147 | 3300005435 | Bacteria | 4040 |
| 20 | Ga0070714_100119736 | 3300005435 | Bacteria | 2340 |
| 21 | Ga0070714_100314977 | 3300005435 | Bacteria | 1462 |
| 22 | Ga0070713_100000122 | 3300005436 | Bacteria | 50640 |
| 23 | Ga0070713_100007429 | 3300005436 | Bacteria | 7690 |
| 24 | Ga0070713_100045029 | 3300005436 | Bacteria | 3614 |
| 25 | Ga0070713_100048750 | 3300005436 | Bacteria | 3490 |
| 26 | Ga0070694_100161761 | 3300005444 | Bacteria | 1643 |
| 27 | Ga0070708_100001379 | 3300005445 | Bacteria | 18549 |
| 28 | Ga0070678_100001820 | 3300005456 | Bacteria | 11497 |
| 29 | Ga0070662_100036092 | 3300005457 | Bacteria | 3495 |
| 30 | Ga0070681_10039168 | 3300005458 | Bacteria | 4752 |
| 31 | Ga0070681_10170417 | 3300005458 | Bacteria | 2099 |
| 32 | Ga0070681_10556713 | 3300005458 | Bacteria | 1061 |
| 33 | Ga0068867_100006321 | 3300005459 | Bacteria | 8382 |
| 34 | Ga0070706_100003762 | 3300005467 | Bacteria | 14810 |
| 35 | Ga0070706_100026994 | 3300005467 | Bacteria | 5283 |
| 36 | Ga0070707_100006179 | 3300005468 | Bacteria | 11156 |
| 37 | Ga0070707_100032668 | 3300005468 | Bacteria | 4958 |
| 38 | Ga0070707_100167629 | 3300005468 | Bacteria | 2141 |
| 39 | Ga0070698_100062206 | 3300005471 | Bacteria | 3766 |
| 40 | Ga0070698_100121977 | 3300005471 | Bacteria | 2565 |
| 41 | Ga0070699_100002084 | 3300005518 | Bacteria | 18104 |
| 42 | Ga0070699_100174967 | 3300005518 | Bacteria | 1903 |
| 43 | Ga0070699_100289649 | 3300005518 | Bacteria | 1468 |
| 44 | Ga0070679_100017243 | 3300005530 | Bacteria | 6986 |
| 45 | Ga0070679_100282024 | 3300005530 | Bacteria | 1614 |
| 46 | Ga0070684_100068759 | 3300005535 | Bacteria | 3113 |
| 47 | Ga0070684_100111876 | 3300005535 | Bacteria | 2449 |
| 48 | Ga0070697_100003470 | 3300005536 | Bacteria | 12123 |
| 49 | Ga0070697_100006903 | 3300005536 | Bacteria | 8825 |
| 50 | Ga0068853_100006000 | 3300005539 | Bacteria | 9607 |
| 51 | Ga0070672_100000294 | 3300005543 | Bacteria | 28190 |
| 52 | Ga0070695_100095303 | 3300005545 | Bacteria | 1994 |
| 53 | Ga0070693_100072210 | 3300005547 | Bacteria | 2035 |
| 54 | Ga0070665_100087319 | 3300005548 | Bacteria | 3124 |
| 55 | Ga0068855_100059230 | 3300005563 | Bacteria | 4481 |
| 56 | Ga0068855_100067392 | 3300005563 | Bacteria | 4170 |
| 57 | Ga0068855_100129517 | 3300005563 | Bacteria | 2883 |
| 58 | Ga0070664_100001493 | 3300005564 | Bacteria | 18627 |
| 59 | Ga0070664_100031135 | 3300005564 | Bacteria | 4454 |
| 60 | Ga0068857_100000408 | 3300005577 | Bacteria | 30304 |
| 61 | Ga0068857_100009498 | 3300005577 | Bacteria | 8445 |
| 62 | Ga0068854_100024223 | 3300005578 | Bacteria | 4153 |
| 63 | Ga0068856_100000251 | 3300005614 | Bacteria | 58356 |
| 64 | Ga0068856_100002153 | 3300005614 | Bacteria | 20400 |
| 65 | Ga0068856_100019350 | 3300005614 | Bacteria | 6610 |
| 66 | Ga0068852_100001267 | 3300005616 | Bacteria | 16860 |
| 67 | Ga0068852_100006673 | 3300005616 | Bacteria | 8365 |
| 68 | Ga0068852_100029352 | 3300005616 | Bacteria | 4518 |
| 69 | Ga0068864_100035876 | 3300005618 | Bacteria | 4223 |
| 70 | Ga0068866_10030189 | 3300005718 | Bacteria | 2599 |
| 71 | Ga0068858_100094368 | 3300005842 | Bacteria | 2787 |
| 72 | Ga0068858_100103197 | 3300005842 | Bacteria | 2660 |
| 73 | Ga0068860_100055911 | 3300005843 | Bacteria | 3752 |
| 74 | Ga0070717_10064805 | 3300006028 | Bacteria | 3036 |
| 75 | Ga0070716_100000755 | 3300006173 | Bacteria | 13856 |
| 76 | Ga0070716_100003573 | 3300006173 | Bacteria | 7341 |
| 77 | Ga0070712_100000019 | 3300006175 | Bacteria | 89020 |
| 78 | Ga0070712_100052342 | 3300006175 | Bacteria | 2847 |
| 79 | Ga0097621_100001516 | 3300006237 | Bacteria | 15907 |
| 80 | Ga0068871_100003912 | 3300006358 | Bacteria | 10265 |
| 81 | Ga0068871_100013898 | 3300006358 | Bacteria | 5986 |
| 82 | Ga0075434_100071315 | 3300006871 | Bacteria | 3466 |
| 83 | Ga0075436_100000102 | 3300006914 | Bacteria | 50389 |
| 84 | Ga0075436_100072281 | 3300006914 | Bacteria | 2386 |
| 85 | Ga0075436_100099935 | 3300006914 | Bacteria | 2020 |
| 86 | Ga0075436_100119975 | 3300006914 | Bacteria | 1839 |
| 87 | Ga0105240_10000482 | 3300009093 | Bacteria | 73610 |
| 88 | Ga0105240_10027710 | 3300009093 | Bacteria | 7414 |
| 89 | Ga0105240_10140947 | 3300009093 | Bacteria | 2882 |
| 90 | Ga0105240_10209401 | 3300009093 | Bacteria | 2279 |
| 91 | Ga0105240_10258940 | 3300009093 | Bacteria | 2008 |
| 92 | Ga0105245_10004598 | 3300009098 | Bacteria | 12184 |
| 93 | Ga0114129_10240073 | 3300009147 | Bacteria | 2436 |
| 94 | Ga0105241_10023267 | 3300009174 | Bacteria | 4594 |
| 95 | Ga0105241_10026395 | 3300009174 | Bacteria | 4321 |
| 96 | Ga0105248_10084009 | 3300009177 | Bacteria | 3581 |
| 97 | Ga0105237_10021705 | 3300009545 | Bacteria | 6597 |
| 98 | Ga0105239_10004824 | 3300010375 | Bacteria | 15973 |
| 99 | Ga0105239_10024414 | 3300010375 | Bacteria | 6661 |
| 100 | Ga0105239_10441691 | 3300010375 | Bacteria | 1475 |
| 101 | Ga0105246_10423751 | 3300011119 | Bacteria | 1111 |
| 102 | Ga0157373_10010371 | 3300013100 | Bacteria | 6859 |
| 103 | Ga0157370_10007658 | 3300013104 | Bacteria | 11722 |
| 104 | Ga0157370_10011743 | 3300013104 | Bacteria | 9146 |
| 105 | Ga0157369_10028611 | 3300013105 | Bacteria | 6167 |
| 106 | Ga0157369_10035058 | 3300013105 | Bacteria | 5503 |
| 107 | Ga0157369_10046244 | 3300013105 | Bacteria | 4731 |
| 108 | Ga0157374_10001133 | 3300013296 | Bacteria | 22835 |
| 109 | Ga0157374_10013519 | 3300013296 | Bacteria | 7125 |
| 110 | Ga0157374_10027605 | 3300013296 | Bacteria | 5124 |
| 111 | Ga0157374_10103334 | 3300013296 | Bacteria | 2734 |
| 112 | Ga0157378_10001185 | 3300013297 | Bacteria | 23694 |
| 113 | Ga0157378_10006905 | 3300013297 | Bacteria | 9910 |
| 114 | Ga0157378_10024648 | 3300013297 | Bacteria | 5296 |
| 115 | Ga0157378_10164126 | 3300013297 | Bacteria | 2079 |
| 116 | Ga0157372_10017758 | 3300013307 | Bacteria | 7637 |
| 117 | Ga0157372_10448958 | 3300013307 | Bacteria | 1503 |
| 118 | Ga0157375_10000942 | 3300013308 | Bacteria | 25237 |
| 119 | Ga0157375_10177986 | 3300013308 | Bacteria | 2278 |
| 120 | Ga0157379_10003644 | 3300014968 | Bacteria | 13075 |
| 121 | Ga0157379_10069417 | 3300014968 | Bacteria | 3152 |
| 122 | Ga0157376_10008465 | 3300014969 | Bacteria | 7426 |
| 123 | Ga0157376_10016880 | 3300014969 | Bacteria | 5554 |
| 124 | Ga0207697_10045803 | 3300025315 | Bacteria | 1801 |
| 125 | Ga0207682_10020288 | 3300025893 | Bacteria | 2608 |
| 126 | Ga0207642_10054537 | 3300025899 | Bacteria | 1824 |
| 127 | Ga0207699_10000238 | 3300025906 | Bacteria | 30877 |
| 128 | Ga0207684_10000975 | 3300025910 | Bacteria | 32051 |
| 129 | Ga0207684_10009310 | 3300025910 | Bacteria | 8679 |
| 130 | Ga0207654_10014406 | 3300025911 | Bacteria | 4085 |
| 131 | Ga0207707_10000894 | 3300025912 | Bacteria | 29148 |
| 132 | Ga0207695_10003354 | 3300025913 | Bacteria | 22633 |
| 133 | Ga0207695_10039741 | 3300025913 | Bacteria | 5053 |
| 134 | Ga0207695_10069512 | 3300025913 | Bacteria | 3603 |
| 135 | Ga0207695_10109226 | 3300025913 | Bacteria | 2748 |
| 136 | Ga0207671_10041890 | 3300025914 | Bacteria | 3390 |
| 137 | Ga0207671_10274365 | 3300025914 | Bacteria | 1329 |
| 138 | Ga0207693_10002009 | 3300025915 | Bacteria | 17864 |
| 139 | Ga0207662_10142770 | 3300025918 | Unclassified | 1518 |
| 140 | Ga0207657_10059519 | 3300025919 | Bacteria | 3281 |
| 141 | Ga0207649_10001275 | 3300025920 | Bacteria | 15037 |
| 142 | Ga0207649_10007317 | 3300025920 | Bacteria | 6008 |
| 143 | Ga0207652_10037874 | 3300025921 | Bacteria | 4084 |
| 144 | Ga0207646_10010390 | 3300025922 | Bacteria | 9104 |
| 145 | Ga0207646_10012319 | 3300025922 | Bacteria | 8223 |
| 146 | Ga0207646_10093198 | 3300025922 | Bacteria | 2697 |
| 147 | Ga0207694_10009283 | 3300025924 | Bacteria | 7422 |
| 148 | Ga0207659_10002917 | 3300025926 | Bacteria | 10184 |
| 149 | Ga0207700_10000088 | 3300025928 | Bacteria | 57845 |
| 150 | Ga0207700_10042567 | 3300025928 | Bacteria | 3330 |
| 151 | Ga0207700_10048150 | 3300025928 | Bacteria | 3164 |
| 152 | Ga0207664_10010274 | 3300025929 | Bacteria | 6610 |
| 153 | Ga0207664_10010477 | 3300025929 | Bacteria | 6546 |
| 154 | Ga0207664_10062691 | 3300025929 | Bacteria | 2969 |
| 155 | Ga0207664_10319650 | 3300025929 | Bacteria | 1369 |
| 156 | Ga0207664_10389872 | 3300025929 | Bacteria | 1237 |
| 157 | Ga0207644_10007815 | 3300025931 | Bacteria | 6986 |
| 158 | Ga0207706_10237472 | 3300025933 | Bacteria | 1594 |
| 159 | Ga0207706_10367829 | 3300025933 | Bacteria | 1249 |
| 160 | Ga0207670_10006519 | 3300025936 | Bacteria | 6480 |
| 161 | Ga0207665_10002914 | 3300025939 | Bacteria | 11473 |
| 162 | Ga0207665_10023396 | 3300025939 | Bacteria | 4071 |
| 163 | Ga0207665_10048615 | 3300025939 | Bacteria | 2848 |
| 164 | Ga0207691_10001349 | 3300025940 | Bacteria | 24461 |
| 165 | Ga0207711_10070843 | 3300025941 | Bacteria | 3024 |
| 166 | Ga0207661_10018457 | 3300025944 | Bacteria | 5181 |
| 167 | Ga0207679_10015833 | 3300025945 | Bacteria | 4996 |
| 168 | Ga0207667_10000972 | 3300025949 | Bacteria | 36552 |
| 169 | Ga0207667_10072890 | 3300025949 | Bacteria | 3569 |
| 170 | Ga0207667_10239590 | 3300025949 | Bacteria | 1857 |
| 171 | Ga0207651_10003376 | 3300025960 | Bacteria | 7840 |
| 172 | Ga0207640_10055329 | 3300025981 | Bacteria | 2598 |
| 173 | Ga0207703_10131841 | 3300026035 | Bacteria | 2159 |
| 174 | Ga0207639_10001449 | 3300026041 | Bacteria | 15976 |
| 175 | Ga0207702_10000238 | 3300026078 | Bacteria | 63877 |
| 176 | Ga0207702_10000359 | 3300026078 | Bacteria | 52081 |
| 177 | Ga0207641_10566778 | 3300026088 | Bacteria | 1109 |
| 178 | Ga0207648_10016133 | 3300026089 | Bacteria | 6839 |
| 179 | Ga0207674_10000127 | 3300026116 | Bacteria | 88956 |
| 180 | Ga0207674_10009368 | 3300026116 | Bacteria | 11201 |
| 181 | Ga0207674_10127839 | 3300026116 | Bacteria | 2505 |
| 182 | Ga0207683_10000367 | 3300026121 | Bacteria | 41412 |
| 183 | Ga0207683_10316165 | 3300026121 | Bacteria | 1430 |
| 184 | Ga0207698_10000805 | 3300026142 | Bacteria | 18253 |
| 185 | Ga0207698_10037451 | 3300026142 | Bacteria | 3573 |
| 186 | Ga0265355_1000054 | 3300028036 | Bacteria | 3746 |
| 187 | Ga0268266_10113677 | 3300028379 | Bacteria | 2401 |
| 188 | Ga0265334_10056952 | 3300028573 | Bacteria | 1483 |
| 189 | Ga0265323_10007471 | 3300028653 | Bacteria | 4539 |
| 190 | Ga0265338_10019339 | 3300028800 | Bacteria | 7231 |
| 191 | Ga0265760_10000797 | 3300031090 | Bacteria | 9073 |
| 192 | Ga0265330_10030825 | 3300031235 | Bacteria | 2405 |
| 193 | Ga0265332_10010516 | 3300031238 | Bacteria | 4120 |
| 194 | Ga0265328_10033534 | 3300031239 | Bacteria | 1904 |
| 195 | Ga0265325_10004893 | 3300031241 | Bacteria | 8367 |
| 196 | Ga0265325_10006671 | 3300031241 | Bacteria | 6984 |
| 197 | Ga0265340_10012465 | 3300031247 | Bacteria | 4490 |
| 198 | Ga0265340_10014656 | 3300031247 | Bacteria | 4088 |
| 199 | Ga0265340_10020145 | 3300031247 | Bacteria | 3432 |
| 200 | Ga0265340_10074600 | 3300031247 | Bacteria | 1604 |
| 201 | Ga0265331_10011517 | 3300031250 | Bacteria | 4840 |
| 202 | Ga0265316_10011615 | 3300031344 | Bacteria | 7931 |
| 203 | Ga0265316_10020774 | 3300031344 | Bacteria | 5579 |
| 204 | Ga0265316_10040014 | 3300031344 | Bacteria | 3761 |
| 205 | Ga0307513_10014136 | 3300031456 | Bacteria | 9768 |
| 206 | Ga0307513_10051467 | 3300031456 | Bacteria | 4443 |
| 207 | Ga0265313_10007076 | 3300031595 | Bacteria | 7751 |
| 208 | Ga0265314_10001130 | 3300031711 | Bacteria | 30899 |
| 209 | Ga0265342_10003262 | 3300031712 | Bacteria | 13442 |
| 210 | Ga0265342_10005778 | 3300031712 | Bacteria | 9351 |
| 211 | Ga0265342_10010809 | 3300031712 | Bacteria | 6289 |
| 212 | Ga0265342_10090302 | 3300031712 | Bacteria | 1757 |
| 213 | Ga0307409_100160824 | 3300031995 | Bacteria | 1964 |
| 214 | Ga0373928_0001734 | 3300035084 | Bacteria | 4234 |
| 215 | Ga0373944_0027886 | 3300035089 | Bacteria | 1678 |
| 216 | Ga0373923_0012978 | 3300035111 | Bacteria | 3095 |
| 217 | Ga0373932_0010429 | 3300035112 | Bacteria | 2248 |
| 218 | Ga0373954_0004691 | 3300035118 | Bacteria | 5895 |
| 219 | Ga0373956_0002118 | 3300035119 | Bacteria | 8225 |
| 220 | Ga0373955_0014314 | 3300035172 | Bacteria | 3856 |
| 221 | Ga0373931_0146274 | 3300035691 | Bacteria | 1374 |
| 222 | Ga0373935_0233873 | 3300035692 | Bacteria | 1281 |
| 223 | Ga0373935_0234680 | 3300035692 | Bacteria | 1278 |
| 224 | Ga0373947_0020056 | 3300035725 | Bacteria | 3858 |
| 225 | Ga0373937_0030150 | 3300036401 | Bacteria | 4913 |
| 226 | Ga0373937_0058253 | 3300036401 | Bacteria | 3548 |
| 227 | Ga0373925_0012539 | 3300037068 | Bacteria | 6142 |
| 228 | Ga0373925_0157330 | 3300037068 | Bacteria | 1788 |
| 229 | Ga0436364_1106984 | 3300037853 | Bacteria | 1908 |
| 230 | Ga0451577_0001184 | 3300042876 | Bacteria | 36620 |
| 231 | Ga0453683_0035935 | 3300044673 | Unclassified | 3120 |
| 232 | Ga0453683_0069083 | 3300044673 | Bacteria | 2209 |
| 233 | Ga0453684_0000930 | 3300044712 | Bacteria | 96857 |
| 234 | Ga0466971_0000075 | 3300044719 | Bacteria | 36467 |
| 235 | Ga0451576_0034864 | 3300045051 | Bacteria | 5343 |
| 236 | Ga0495592_0000182 | 3300046454 | Bacteria | 55441 |
| 237 | Ga0495651_0030025 | 3300046462 | Bacteria | 4238 |
| 238 | Ga0495580_0084383 | 3300046472 | Bacteria | 2213 |
| 239 | Ga0495618_0112338 | 3300046514 | Bacteria | 1745 |
| 240 | Ga0495630_0038528 | 3300046517 | Bacteria | 3575 |
| 241 | Ga0495587_0144669 | 3300046536 | Bacteria | 1356 |
| 242 | Ga0495645_0084442 | 3300046543 | Bacteria | 2274 |
| 243 | Ga0495635_0157105 | 3300046663 | Bacteria | 1548 |
| 244 | Ga0495658_0069745 | 3300046683 | Bacteria | 2038 |
| 245 | Ga0495669_0005798 | 3300046684 | Bacteria | 5150 |
| 246 | Ga0495613_0097351 | 3300046689 | Bacteria | 2127 |
| 247 | Ga0495589_0045820 | 3300046794 | Bacteria | 2172 |
| 248 | Ga0495600_0145406 | 3300046809 | Bacteria | 1537 |
| 249 | Ga0495684_0008556 | 3300047471 | Bacteria | 7924 |
| 250 | Ga0496101_0228118 | 3300048904 | Bacteria | 1447 |
| 251 | Ga0496102_0231542 | 3300048905 | Bacteria | 1742 |
| 252 | Ga0496102_0340579 | 3300048905 | Bacteria | 1412 |
| 253 | Ga0496104_0339292 | 3300048907 | Bacteria | 1416 |
| 254 | Ga0496104_0354172 | 3300048907 | Bacteria | 1380 |
| 255 | Ga0496107_0061500 | 3300048910 | Bacteria | 2719 |
| 256 | Ga0496108_0000202 | 3300048911 | Bacteria | 55115 |
| 257 | Ga0496109_0000131 | 3300048912 | Bacteria | 76860 |
| 258 | Ga0496111_0011257 | 3300048914 | Bacteria | 6022 |
| 259 | Ga0496112_0282661 | 3300048915 | Bacteria | 1606 |
| 260 | Ga0501032_0001199 | 3300049569 | Bacteria | 20723 |
| 261 | Ga0501032_0012082 | 3300049569 | Bacteria | 6183 |
| 262 | Ga0501032_0041535 | 3300049569 | Bacteria | 3122 |
| 263 | Ga0501033_0000002 | 3300049570 | Bacteria | 668574 |
| 264 | Ga0501033_0000057 | 3300049570 | Bacteria | 107439 |
| 265 | Ga0501033_0057388 | 3300049570 | Bacteria | 2878 |
| 266 | Ga0501036_0097856 | 3300049572 | Bacteria | 2480 |
| 267 | Ga0501037_0002372 | 3300049573 | Bacteria | 13598 |
| 268 | Ga0501038_0000020 | 3300049574 | Bacteria | 152738 |
| 269 | Ga0501038_0003279 | 3300049574 | Bacteria | 15078 |
| 270 | Ga0501038_0008016 | 3300049574 | Bacteria | 9731 |
| 271 | Ga0501038_0032289 | 3300049574 | Bacteria | 4621 |
| 272 | Ga0501039_0004895 | 3300049575 | Bacteria | 10147 |
| 273 | Ga0501040_0016813 | 3300049576 | Bacteria | 4850 |
| 274 | Ga0501040_0172321 | 3300049576 | Bacteria | 1532 |
| 275 | Ga0501041_0024412 | 3300049577 | Bacteria | 3629 |
| 276 | Ga0501042_0000699 | 3300049578 | Bacteria | 18216 |
| 277 | Ga0501043_0001680 | 3300049579 | Bacteria | 19212 |
| 278 | Ga0501043_0004397 | 3300049579 | Bacteria | 11449 |
| 279 | Ga0501046_0000026 | 3300049580 | Bacteria | 197226 |
| 280 | Ga0501046_0003955 | 3300049580 | Bacteria | 13532 |
| 281 | Ga0501046_0007080 | 3300049580 | Bacteria | 9875 |
| 282 | Ga0501047_0002039 | 3300049581 | Bacteria | 19304 |
| 283 | Ga0501047_0195271 | 3300049581 | Bacteria | 1886 |
| 284 | Ga0501048_0000087 | 3300049582 | Bacteria | 48546 |
| 285 | Ga0501048_0000956 | 3300049582 | Bacteria | 21343 |
| 286 | Ga0501048_0069944 | 3300049582 | Bacteria | 2479 |
| 287 | Ga0501070_0051846 | 3300049586 | Bacteria | 3405 |
| 288 | Ga0501070_0086765 | 3300049586 | Bacteria | 2591 |
| 289 | Ga0501072_0001904 | 3300049588 | Bacteria | 15553 |
| 290 | Ga0501072_0025383 | 3300049588 | Bacteria | 4617 |
| 291 | Ga0501073_0248263 | 3300049589 | Bacteria | 1228 |
| 292 | Ga0501074_0030064 | 3300049590 | Bacteria | 3936 |
| 293 | Ga0501074_0034214 | 3300049590 | Bacteria | 3684 |
| 294 | Ga0501075_0002741 | 3300049591 | Bacteria | 11795 |
| 295 | Ga0501075_0032952 | 3300049591 | Bacteria | 3853 |
| 296 | Ga0501076_0000626 | 3300049592 | Bacteria | 22547 |
| 297 | Ga0501076_0462748 | 3300049592 | Bacteria | 1044 |
| 298 | Ga0501077_0001981 | 3300049593 | Bacteria | 12376 |
| 299 | Ga0501079_0000083 | 3300049741 | Bacteria | 45025 |
| 300 | Ga0501079_0046950 | 3300049741 | Bacteria | 3332 |
| 301 | Ga0501080_0108736 | 3300049742 | Bacteria | 2570 |
| 302 | Ga0501081_0004414 | 3300049743 | Bacteria | 9020 |
| 303 | Ga0501081_0091413 | 3300049743 | Bacteria | 2140 |
| 304 | Ga0501083_0000006 | 3300049744 | Bacteria | 199638 |
| 305 | Ga0501035_0150824 | 3300049822 | Bacteria | 2017 |
| 306 | Ga0501044_0166035 | 3300049823 | Bacteria | 2182 |
| 307 | Ga0501045_0003257 | 3300049824 | Bacteria | 11090 |
| 308 | Ga0501045_0194149 | 3300049824 | Bacteria | 1513 |
| 309 | Ga0501045_0312539 | 3300049824 | Bacteria | 1169 |
| 310 | nmdc:mga0n895_105078_c1 | 3300050512 | Bacteria | 2836 |
| 311 | nmdc:mga0n895_129355_c1 | 3300050512 | Bacteria | 2549 |
| 312 | nmdc:mga0n895_18938_c1 | 3300050512 | Bacteria | 6385 |
| 313 | nmdc:mga08x19_159980_c1 | 3300050514 | Bacteria | 1529 |
| 314 | nmdc:mga08x19_9085_c1 | 3300050514 | Bacteria | 5934 |
| 315 | nmdc:mga08x19_91_c1 | 3300050514 | Bacteria | 81177 |
| 316 | Ga0501084_0002472 | 3300054114 | Bacteria | 14886 |
| 317 | Ga0501084_0061462 | 3300054114 | Bacteria | 3145 |
| 318 | Ga0501082_0001978 | 3300060353 | Bacteria | 18035 |
| 319 | Ga0501082_0004234 | 3300060353 | Bacteria | 12535 |
| 320 | Ga0466962_0000010 | 3300061719 | Bacteria | 130694 |
| 321 | Ga0530510_0005357 | 3300061734 | Bacteria | 8876 |
| 322 | Ga0530510_0017661 | 3300061734 | Bacteria | 5055 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_10164126 | Ga0157378_101641262 | 257 |
| 2 | 3300049822 | Ga0501035_0150824 | Ga0501035_0150824_1098_1937 | 270 |
| 3 | 3300013296 | Ga0157374_10103334 | Ga0157374_101033343 | 301 |
| 4 | 3300013297 | Ga0157378_10001185 | Ga0157378_100011851 | 301 |
| 5 | 3300013308 | Ga0157375_10177986 | Ga0157375_101779863 | 301 |
| 6 | 3300046536 | Ga0495587_0144669 | Ga0495587_0144669_419_1342 | 301 |
| 7 | 3300049569 | Ga0501032_0041535 | Ga0501032_0041535_802_1770 | 301 |
| 8 | 3300049570 | Ga0501033_0000057 | Ga0501033_0000057_95349_96317 | 301 |
| 9 | 3300049574 | Ga0501038_0003279 | Ga0501038_0003279_10767_11735 | 301 |
| 10 | 3300035692 | Ga0373935_0234680 | Ga0373935_0234680_130_1047 | 303 |
| 11 | 3300037068 | Ga0373925_0157330 | Ga0373925_0157330_328_1245 | 303 |
| 12 | 3300014968 | Ga0157379_10069417 | Ga0157379_100694172 | 312 |
| 13 | 3300048905 | Ga0496102_0231542 | Ga0496102_0231542_468_1412 | 312 |
| 14 | 3300050512 | nmdc:mga0n895_105078_c1 | nmdc:mga0n895_105078_c1_1468_2412 | 312 |
| 15 | 3300050512 | nmdc:mga0n895_18938_c1 | nmdc:mga0n895_18938_c1_1122_2066 | 312 |
| 16 | 3300050514 | nmdc:mga08x19_91_c1 | nmdc:mga08x19_91_c1_76865_77809 | 312 |
| 17 | 3300049570 | Ga0501033_0057388 | Ga0501033_0057388_1610_2575 | 314 |
| 18 | 3300049572 | Ga0501036_0097856 | Ga0501036_0097856_327_1292 | 314 |
| 19 | 3300049573 | Ga0501037_0002372 | Ga0501037_0002372_7748_8728 | 314 |
| 20 | 3300049574 | Ga0501038_0032289 | Ga0501038_0032289_3232_4197 | 314 |
| 21 | 3300049576 | Ga0501040_0172321 | Ga0501040_0172321_342_1307 | 314 |
| 22 | 3300049577 | Ga0501041_0024412 | Ga0501041_0024412_2212_3177 | 314 |
| 23 | 3300049580 | Ga0501046_0007080 | Ga0501046_0007080_2716_3681 | 314 |
| 24 | 3300049582 | Ga0501048_0069944 | Ga0501048_0069944_1204_2169 | 314 |
| 25 | 3300049588 | Ga0501072_0025383 | Ga0501072_0025383_3205_4170 | 314 |
| 26 | 3300049590 | Ga0501074_0034214 | Ga0501074_0034214_2405_3370 | 314 |
| 27 | 3300049591 | Ga0501075_0032952 | Ga0501075_0032952_1659_2624 | 314 |
| 28 | 3300049592 | Ga0501076_0462748 | Ga0501076_0462748_42_1007 | 314 |
| 29 | 3300049741 | Ga0501079_0046950 | Ga0501079_0046950_16_981 | 314 |
| 30 | 3300049742 | Ga0501080_0108736 | Ga0501080_0108736_1047_2012 | 314 |
| 31 | 3300049743 | Ga0501081_0091413 | Ga0501081_0091413_220_1185 | 314 |
| 32 | 3300049824 | Ga0501045_0003257 | Ga0501045_0003257_6045_7010 | 314 |
| 33 | 3300049824 | Ga0501045_0194149 | Ga0501045_0194149_512_1492 | 314 |
| 34 | 3300054114 | Ga0501084_0061462 | Ga0501084_0061462_1233_2198 | 314 |
| 35 | 3300060353 | Ga0501082_0004234 | Ga0501082_0004234_5993_6958 | 314 |
| 36 | 3300061734 | Ga0530510_0017661 | Ga0530510_0017661_3499_4464 | 314 |
| 37 | 3300042876 | Ga0451577_0001184 | Ga0451577_0001184_1134_2177 | 318 |
| 38 | 3300005341 | Ga0070691_10000215 | Ga0070691_100002154 | 322 |
| 39 | 3300005434 | Ga0070709_10003388 | Ga0070709_100033884 | 322 |
| 40 | 3300005436 | Ga0070713_100000122 | Ga0070713_10000012244 | 322 |
| 41 | 3300005458 | Ga0070681_10170417 | Ga0070681_101704172 | 322 |
| 42 | 3300005539 | Ga0068853_100006000 | Ga0068853_10000600011 | 322 |
| 43 | 3300005545 | Ga0070695_100095303 | Ga0070695_1000953032 | 322 |
| 44 | 3300005577 | Ga0068857_100000408 | Ga0068857_1000004083 | 322 |
| 45 | 3300005614 | Ga0068856_100000251 | Ga0068856_10000025124 | 322 |
| 46 | 3300005614 | Ga0068856_100002153 | Ga0068856_1000021533 | 322 |
| 47 | 3300005616 | Ga0068852_100029352 | Ga0068852_1000293522 | 322 |
| 48 | 3300006173 | Ga0070716_100003573 | Ga0070716_1000035732 | 322 |
| 49 | 3300006175 | Ga0070712_100000019 | Ga0070712_10000001924 | 322 |
| 50 | 3300006871 | Ga0075434_100071315 | Ga0075434_1000713154 | 322 |
| 51 | 3300006914 | Ga0075436_100000102 | Ga0075436_10000010245 | 322 |
| 52 | 3300006914 | Ga0075436_100119975 | Ga0075436_1001199753 | 322 |
| 53 | 3300009093 | Ga0105240_10000482 | Ga0105240_1000048268 | 322 |
| 54 | 3300009174 | Ga0105241_10023267 | Ga0105241_100232673 | 322 |
| 55 | 3300009545 | Ga0105237_10021705 | Ga0105237_100217053 | 322 |
| 56 | 3300010375 | Ga0105239_10004824 | Ga0105239_1000482411 | 322 |
| 57 | 3300013100 | Ga0157373_10010371 | Ga0157373_100103713 | 322 |
| 58 | 3300013104 | Ga0157370_10011743 | Ga0157370_1001174310 | 322 |
| 59 | 3300013105 | Ga0157369_10028611 | Ga0157369_100286116 | 322 |
| 60 | 3300013296 | Ga0157374_10027605 | Ga0157374_100276052 | 322 |
| 61 | 3300013307 | Ga0157372_10017758 | Ga0157372_1001775810 | 322 |
| 62 | 3300014968 | Ga0157379_10003644 | Ga0157379_100036448 | 322 |
| 63 | 3300025906 | Ga0207699_10000238 | Ga0207699_100002389 | 322 |
| 64 | 3300025914 | Ga0207671_10041890 | Ga0207671_100418903 | 322 |
| 65 | 3300025915 | Ga0207693_10002009 | Ga0207693_1000200910 | 322 |
| 66 | 3300025928 | Ga0207700_10000088 | Ga0207700_1000008814 | 322 |
| 67 | 3300025939 | Ga0207665_10023396 | Ga0207665_100233962 | 322 |
| 68 | 3300025949 | Ga0207667_10072890 | Ga0207667_100728903 | 322 |
| 69 | 3300026035 | Ga0207703_10131841 | Ga0207703_101318412 | 322 |
| 70 | 3300026041 | Ga0207639_10001449 | Ga0207639_100014493 | 322 |
| 71 | 3300026078 | Ga0207702_10000238 | Ga0207702_1000023857 | 322 |
| 72 | 3300026078 | Ga0207702_10000359 | Ga0207702_100003596 | 322 |
| 73 | 3300026116 | Ga0207674_10000127 | Ga0207674_1000012786 | 322 |
| 74 | 3300036401 | Ga0373937_0030150 | Ga0373937_0030150_3563_4573 | 322 |
| 75 | 3300046472 | Ga0495580_0084383 | Ga0495580_0084383_940_1941 | 322 |
| 76 | 3300005340 | Ga0070689_100010985 | Ga0070689_1000109851 | 326 |
| 77 | 3300005435 | Ga0070714_100119736 | Ga0070714_1001197362 | 326 |
| 78 | 3300009093 | Ga0105240_10140947 | Ga0105240_101409472 | 326 |
| 79 | 3300009098 | Ga0105245_10004598 | Ga0105245_1000459813 | 326 |
| 80 | 3300025929 | Ga0207664_10389872 | Ga0207664_103898722 | 326 |
| 81 | 3300026121 | Ga0207683_10316165 | Ga0207683_103161652 | 326 |
| 82 | 3300035089 | Ga0373944_0027886 | Ga0373944_0027886_320_1306 | 326 |
| 83 | 3300035692 | Ga0373935_0233873 | Ga0373935_0233873_61_1047 | 326 |
| 84 | 3300044719 | Ga0466971_0000075 | Ga0466971_0000075_11532_12512 | 326 |
| 85 | 3300046462 | Ga0495651_0030025 | Ga0495651_0030025_1496_2482 | 326 |
| 86 | 3300046663 | Ga0495635_0157105 | Ga0495635_0157105_238_1224 | 326 |
| 87 | 3300046684 | Ga0495669_0005798 | Ga0495669_0005798_103_1089 | 326 |
| 88 | 3300046794 | Ga0495589_0045820 | Ga0495589_0045820_779_1771 | 326 |
| 89 | 3300046809 | Ga0495600_0145406 | Ga0495600_0145406_129_1115 | 326 |
| 90 | 3300048907 | Ga0496104_0339292 | Ga0496104_0339292_60_1046 | 326 |
| 91 | 3300049574 | Ga0501038_0000020 | Ga0501038_0000020_85526_86506 | 326 |
| 92 | 3300049586 | Ga0501070_0086765 | Ga0501070_0086765_131_1111 | 326 |
| 93 | 3300049589 | Ga0501073_0248263 | Ga0501073_0248263_159_1142 | 326 |
| 94 | 3300061719 | Ga0466962_0000010 | Ga0466962_0000010_109863_110843 | 326 |
| 95 | 3300005444 | Ga0070694_100161761 | Ga0070694_1001617611 | 327 |
| 96 | 3300005548 | Ga0070665_100087319 | Ga0070665_1000873193 | 329 |
| 97 | 3300028379 | Ga0268266_10113677 | Ga0268266_101136772 | 329 |
| 98 | 3300031456 | Ga0307513_10014136 | Ga0307513_100141363 | 330 |
| 99 | 3300031456 | Ga0307513_10051467 | Ga0307513_100514672 | 331 |
| 100 | 3300035172 | Ga0373955_0014314 | Ga0373955_0014314_916_1914 | 331 |
| 101 | 3300036401 | Ga0373937_0058253 | Ga0373937_0058253_220_1218 | 331 |
| 102 | 3300044673 | Ga0453683_0035935 | Ga0453683_0035935_1863_2861 | 331 |
| 103 | 3300005436 | Ga0070713_100045029 | Ga0070713_1000450292 | 332 |
| 104 | 3300005458 | Ga0070681_10556713 | Ga0070681_105567131 | 332 |
| 105 | 3300005468 | Ga0070707_100006179 | Ga0070707_1000061794 | 332 |
| 106 | 3300005536 | Ga0070697_100003470 | Ga0070697_1000034704 | 332 |
| 107 | 3300005563 | Ga0068855_100129517 | Ga0068855_1001295172 | 332 |
| 108 | 3300005842 | Ga0068858_100103197 | Ga0068858_1001031972 | 332 |
| 109 | 3300005843 | Ga0068860_100055911 | Ga0068860_1000559111 | 332 |
| 110 | 3300013104 | Ga0157370_10007658 | Ga0157370_100076582 | 332 |
| 111 | 3300025913 | Ga0207695_10069512 | Ga0207695_100695122 | 332 |
| 112 | 3300025918 | Ga0207662_10142770 | Ga0207662_101427702 | 332 |
| 113 | 3300025928 | Ga0207700_10048150 | Ga0207700_100481502 | 332 |
| 114 | 3300025929 | Ga0207664_10010274 | Ga0207664_100102743 | 332 |
| 115 | 3300025949 | Ga0207667_10239590 | Ga0207667_102395902 | 332 |
| 116 | 3300026088 | Ga0207641_10566778 | Ga0207641_105667781 | 332 |
| 117 | 3300046514 | Ga0495618_0112338 | Ga0495618_0112338_629_1633 | 332 |
| 118 | 3300050514 | nmdc:mga08x19_9085_c1 | nmdc:mga08x19_9085_c1_530_1531 | 332 |
| 119 | 3300005344 | Ga0070661_100208309 | Ga0070661_1002083092 | 333 |
| 120 | 3300005564 | Ga0070664_100031135 | Ga0070664_1000311354 | 333 |
| 121 | 3300025945 | Ga0207679_10015833 | Ga0207679_100158334 | 333 |
| 122 | 3300028653 | Ga0265323_10007471 | Ga0265323_100074712 | 333 |
| 123 | 3300028800 | Ga0265338_10019339 | Ga0265338_100193392 | 333 |
| 124 | 3300031235 | Ga0265330_10030825 | Ga0265330_100308252 | 333 |
| 125 | 3300031238 | Ga0265332_10010516 | Ga0265332_100105163 | 333 |
| 126 | 3300031239 | Ga0265328_10033534 | Ga0265328_100335342 | 333 |
| 127 | 3300031241 | Ga0265325_10004893 | Ga0265325_100048932 | 333 |
| 128 | 3300031250 | Ga0265331_10011517 | Ga0265331_100115173 | 333 |
| 129 | 3300031344 | Ga0265316_10020774 | Ga0265316_100207743 | 333 |
| 130 | 3300031711 | Ga0265314_10001130 | Ga0265314_1000113018 | 333 |
| 131 | 3300031712 | Ga0265342_10005778 | Ga0265342_100057783 | 333 |
| 132 | 3300044712 | Ga0453684_0000930 | Ga0453684_0000930_26443_27462 | 334 |
| 133 | 3300005289 | Ga0065704_10001221 | Ga0065704_100012214 | 335 |
| 134 | 3300031247 | Ga0265340_10074600 | Ga0265340_100746001 | 335 |
| 135 | 3300035111 | Ga0373923_0012978 | Ga0373923_0012978_691_1701 | 335 |
| 136 | 3300035118 | Ga0373954_0004691 | Ga0373954_0004691_3425_4435 | 335 |
| 137 | 3300035119 | Ga0373956_0002118 | Ga0373956_0002118_172_1182 | 335 |
| 138 | 3300046683 | Ga0495658_0069745 | Ga0495658_0069745_305_1315 | 335 |
| 139 | 3300046689 | Ga0495613_0097351 | Ga0495613_0097351_636_1646 | 335 |
| 140 | 3300049579 | Ga0501043_0001680 | Ga0501043_0001680_4024_5058 | 335 |
| 141 | 3300049580 | Ga0501046_0000026 | Ga0501046_0000026_120020_121054 | 335 |
| 142 | 3300049581 | Ga0501047_0002039 | Ga0501047_0002039_10856_11890 | 335 |
| 143 | 3300049582 | Ga0501048_0000956 | Ga0501048_0000956_7034_8068 | 335 |
| 144 | 3300049744 | Ga0501083_0000006 | Ga0501083_0000006_176381_177415 | 335 |
| 145 | 3300049824 | Ga0501045_0312539 | Ga0501045_0312539_35_1069 | 335 |
| 146 | 3300001991 | JGI24743J22301_10000018 | JGI24743J22301_100000188 | 336 |
| 147 | 3300003320 | rootH2_10002489 | rootH2_100024896 | 336 |
| 148 | 3300005293 | Ga0065715_10090415 | Ga0065715_100904154 | 336 |
| 149 | 3300005328 | Ga0070676_10102382 | Ga0070676_101023822 | 336 |
| 150 | 3300005329 | Ga0070683_100002813 | Ga0070683_1000028135 | 336 |
| 151 | 3300005331 | Ga0070670_100022025 | Ga0070670_1000220256 | 336 |
| 152 | 3300005333 | Ga0070677_10016857 | Ga0070677_100168572 | 336 |
| 153 | 3300005341 | Ga0070691_10066429 | Ga0070691_100664292 | 336 |
| 154 | 3300005344 | Ga0070661_100001932 | Ga0070661_10000193211 | 336 |
| 155 | 3300005344 | Ga0070661_100006153 | Ga0070661_1000061535 | 336 |
| 156 | 3300005354 | Ga0070675_100001289 | Ga0070675_1000012895 | 336 |
| 157 | 3300005355 | Ga0070671_100000666 | Ga0070671_1000006665 | 336 |
| 158 | 3300005364 | Ga0070673_100002795 | Ga0070673_1000027955 | 336 |
| 159 | 3300005435 | Ga0070714_100038147 | Ga0070714_1000381472 | 336 |
| 160 | 3300005435 | Ga0070714_100314977 | Ga0070714_1003149772 | 336 |
| 161 | 3300005436 | Ga0070713_100007429 | Ga0070713_1000074296 | 336 |
| 162 | 3300005436 | Ga0070713_100048750 | Ga0070713_1000487502 | 336 |
| 163 | 3300005445 | Ga0070708_100001379 | Ga0070708_1000013797 | 336 |
| 164 | 3300005456 | Ga0070678_100001820 | Ga0070678_1000018209 | 336 |
| 165 | 3300005457 | Ga0070662_100036092 | Ga0070662_1000360922 | 336 |
| 166 | 3300005458 | Ga0070681_10039168 | Ga0070681_100391685 | 336 |
| 167 | 3300005459 | Ga0068867_100006321 | Ga0068867_1000063214 | 336 |
| 168 | 3300005467 | Ga0070706_100003762 | Ga0070706_1000037623 | 336 |
| 169 | 3300005467 | Ga0070706_100026994 | Ga0070706_1000269946 | 336 |
| 170 | 3300005468 | Ga0070707_100032668 | Ga0070707_1000326686 | 336 |
| 171 | 3300005468 | Ga0070707_100167629 | Ga0070707_1001676292 | 336 |
| 172 | 3300005471 | Ga0070698_100062206 | Ga0070698_1000622063 | 336 |
| 173 | 3300005471 | Ga0070698_100121977 | Ga0070698_1001219772 | 336 |
| 174 | 3300005518 | Ga0070699_100002084 | Ga0070699_1000020848 | 336 |
| 175 | 3300005518 | Ga0070699_100174967 | Ga0070699_1001749673 | 336 |
| 176 | 3300005518 | Ga0070699_100289649 | Ga0070699_1002896492 | 336 |
| 177 | 3300005530 | Ga0070679_100017243 | Ga0070679_1000172435 | 336 |
| 178 | 3300005530 | Ga0070679_100282024 | Ga0070679_1002820242 | 336 |
| 179 | 3300005535 | Ga0070684_100068759 | Ga0070684_1000687592 | 336 |
| 180 | 3300005535 | Ga0070684_100111876 | Ga0070684_1001118762 | 336 |
| 181 | 3300005536 | Ga0070697_100006903 | Ga0070697_1000069032 | 336 |
| 182 | 3300005543 | Ga0070672_100000294 | Ga0070672_1000002948 | 336 |
| 183 | 3300005547 | Ga0070693_100072210 | Ga0070693_1000722102 | 336 |
| 184 | 3300005563 | Ga0068855_100059230 | Ga0068855_1000592304 | 336 |
| 185 | 3300005563 | Ga0068855_100067392 | Ga0068855_1000673922 | 336 |
| 186 | 3300005564 | Ga0070664_100001493 | Ga0070664_1000014935 | 336 |
| 187 | 3300005577 | Ga0068857_100009498 | Ga0068857_1000094987 | 336 |
| 188 | 3300005578 | Ga0068854_100024223 | Ga0068854_1000242234 | 336 |
| 189 | 3300005614 | Ga0068856_100019350 | Ga0068856_1000193502 | 336 |
| 190 | 3300005616 | Ga0068852_100001267 | Ga0068852_1000012674 | 336 |
| 191 | 3300005616 | Ga0068852_100006673 | Ga0068852_1000066736 | 336 |
| 192 | 3300005618 | Ga0068864_100035876 | Ga0068864_1000358763 | 336 |
| 193 | 3300005718 | Ga0068866_10030189 | Ga0068866_100301892 | 336 |
| 194 | 3300005842 | Ga0068858_100094368 | Ga0068858_1000943683 | 336 |
| 195 | 3300006028 | Ga0070717_10064805 | Ga0070717_100648052 | 336 |
| 196 | 3300006173 | Ga0070716_100000755 | Ga0070716_1000007554 | 336 |
| 197 | 3300006175 | Ga0070712_100052342 | Ga0070712_1000523423 | 336 |
| 198 | 3300006237 | Ga0097621_100001516 | Ga0097621_1000015164 | 336 |
| 199 | 3300006358 | Ga0068871_100003912 | Ga0068871_1000039124 | 336 |
| 200 | 3300006358 | Ga0068871_100013898 | Ga0068871_1000138985 | 336 |
| 201 | 3300006914 | Ga0075436_100072281 | Ga0075436_1000722812 | 336 |
| 202 | 3300006914 | Ga0075436_100099935 | Ga0075436_1000999352 | 336 |
| 203 | 3300009093 | Ga0105240_10027710 | Ga0105240_100277102 | 336 |
| 204 | 3300009093 | Ga0105240_10209401 | Ga0105240_102094012 | 336 |
| 205 | 3300009093 | Ga0105240_10258940 | Ga0105240_102589403 | 336 |
| 206 | 3300009147 | Ga0114129_10240073 | Ga0114129_102400732 | 336 |
| 207 | 3300009174 | Ga0105241_10026395 | Ga0105241_100263954 | 336 |
| 208 | 3300009177 | Ga0105248_10084009 | Ga0105248_100840092 | 336 |
| 209 | 3300010375 | Ga0105239_10024414 | Ga0105239_100244145 | 336 |
| 210 | 3300010375 | Ga0105239_10441691 | Ga0105239_104416912 | 336 |
| 211 | 3300011119 | Ga0105246_10423751 | Ga0105246_104237511 | 336 |
| 212 | 3300013105 | Ga0157369_10035058 | Ga0157369_100350584 | 336 |
| 213 | 3300013105 | Ga0157369_10046244 | Ga0157369_100462443 | 336 |
| 214 | 3300013296 | Ga0157374_10001133 | Ga0157374_100011334 | 336 |
| 215 | 3300013296 | Ga0157374_10013519 | Ga0157374_100135194 | 336 |
| 216 | 3300013297 | Ga0157378_10006905 | Ga0157378_100069055 | 336 |
| 217 | 3300013297 | Ga0157378_10024648 | Ga0157378_100246482 | 336 |
| 218 | 3300013307 | Ga0157372_10448958 | Ga0157372_104489581 | 336 |
| 219 | 3300013308 | Ga0157375_10000942 | Ga0157375_1000094223 | 336 |
| 220 | 3300014969 | Ga0157376_10008465 | Ga0157376_100084659 | 336 |
| 221 | 3300014969 | Ga0157376_10016880 | Ga0157376_100168802 | 336 |
| 222 | 3300025315 | Ga0207697_10045803 | Ga0207697_100458032 | 336 |
| 223 | 3300025893 | Ga0207682_10020288 | Ga0207682_100202882 | 336 |
| 224 | 3300025899 | Ga0207642_10054537 | Ga0207642_100545372 | 336 |
| 225 | 3300025910 | Ga0207684_10000975 | Ga0207684_1000097524 | 336 |
| 226 | 3300025910 | Ga0207684_10009310 | Ga0207684_100093105 | 336 |
| 227 | 3300025911 | Ga0207654_10014406 | Ga0207654_100144064 | 336 |
| 228 | 3300025912 | Ga0207707_10000894 | Ga0207707_100008949 | 336 |
| 229 | 3300025913 | Ga0207695_10003354 | Ga0207695_1000335415 | 336 |
| 230 | 3300025913 | Ga0207695_10039741 | Ga0207695_100397412 | 336 |
| 231 | 3300025913 | Ga0207695_10109226 | Ga0207695_101092262 | 336 |
| 232 | 3300025914 | Ga0207671_10274365 | Ga0207671_102743652 | 336 |
| 233 | 3300025919 | Ga0207657_10059519 | Ga0207657_100595193 | 336 |
| 234 | 3300025920 | Ga0207649_10001275 | Ga0207649_100012759 | 336 |
| 235 | 3300025920 | Ga0207649_10007317 | Ga0207649_100073173 | 336 |
| 236 | 3300025921 | Ga0207652_10037874 | Ga0207652_100378742 | 336 |
| 237 | 3300025922 | Ga0207646_10010390 | Ga0207646_1001039010 | 336 |
| 238 | 3300025922 | Ga0207646_10012319 | Ga0207646_100123192 | 336 |
| 239 | 3300025922 | Ga0207646_10093198 | Ga0207646_100931982 | 336 |
| 240 | 3300025924 | Ga0207694_10009283 | Ga0207694_100092836 | 336 |
| 241 | 3300025926 | Ga0207659_10002917 | Ga0207659_100029175 | 336 |
| 242 | 3300025928 | Ga0207700_10042567 | Ga0207700_100425673 | 336 |
| 243 | 3300025929 | Ga0207664_10010477 | Ga0207664_100104775 | 336 |
| 244 | 3300025929 | Ga0207664_10062691 | Ga0207664_100626911 | 336 |
| 245 | 3300025929 | Ga0207664_10319650 | Ga0207664_103196502 | 336 |
| 246 | 3300025931 | Ga0207644_10007815 | Ga0207644_100078153 | 336 |
| 247 | 3300025933 | Ga0207706_10237472 | Ga0207706_102374722 | 336 |
| 248 | 3300025933 | Ga0207706_10367829 | Ga0207706_103678291 | 336 |
| 249 | 3300025936 | Ga0207670_10006519 | Ga0207670_100065192 | 336 |
| 250 | 3300025939 | Ga0207665_10002914 | Ga0207665_100029143 | 336 |
| 251 | 3300025939 | Ga0207665_10048615 | Ga0207665_100486152 | 336 |
| 252 | 3300025940 | Ga0207691_10001349 | Ga0207691_100013497 | 336 |
| 253 | 3300025941 | Ga0207711_10070843 | Ga0207711_100708432 | 336 |
| 254 | 3300025944 | Ga0207661_10018457 | Ga0207661_100184574 | 336 |
| 255 | 3300025949 | Ga0207667_10000972 | Ga0207667_1000097229 | 336 |
| 256 | 3300025960 | Ga0207651_10003376 | Ga0207651_100033765 | 336 |
| 257 | 3300025981 | Ga0207640_10055329 | Ga0207640_100553291 | 336 |
| 258 | 3300026089 | Ga0207648_10016133 | Ga0207648_100161332 | 336 |
| 259 | 3300026116 | Ga0207674_10009368 | Ga0207674_100093687 | 336 |
| 260 | 3300026116 | Ga0207674_10127839 | Ga0207674_101278393 | 336 |
| 261 | 3300026121 | Ga0207683_10000367 | Ga0207683_1000036713 | 336 |
| 262 | 3300026142 | Ga0207698_10000805 | Ga0207698_100008053 | 336 |
| 263 | 3300026142 | Ga0207698_10037451 | Ga0207698_100374512 | 336 |
| 264 | 3300028036 | Ga0265355_1000054 | Ga0265355_10000541 | 336 |
| 265 | 3300028573 | Ga0265334_10056952 | Ga0265334_100569522 | 336 |
| 266 | 3300031090 | Ga0265760_10000797 | Ga0265760_100007976 | 336 |
| 267 | 3300031241 | Ga0265325_10006671 | Ga0265325_100066718 | 336 |
| 268 | 3300031247 | Ga0265340_10012465 | Ga0265340_100124653 | 336 |
| 269 | 3300031247 | Ga0265340_10014656 | Ga0265340_100146562 | 336 |
| 270 | 3300031247 | Ga0265340_10020145 | Ga0265340_100201452 | 336 |
| 271 | 3300031344 | Ga0265316_10011615 | Ga0265316_100116155 | 336 |
| 272 | 3300031344 | Ga0265316_10040014 | Ga0265316_100400143 | 336 |
| 273 | 3300031595 | Ga0265313_10007076 | Ga0265313_100070768 | 336 |
| 274 | 3300031712 | Ga0265342_10003262 | Ga0265342_100032623 | 336 |
| 275 | 3300031712 | Ga0265342_10010809 | Ga0265342_100108092 | 336 |
| 276 | 3300031712 | Ga0265342_10090302 | Ga0265342_100903023 | 336 |
| 277 | 3300031995 | Ga0307409_100160824 | Ga0307409_1001608242 | 336 |
| 278 | 3300035084 | Ga0373928_0001734 | Ga0373928_0001734_2654_3679 | 336 |
| 279 | 3300035112 | Ga0373932_0010429 | Ga0373932_0010429_144_1169 | 336 |
| 280 | 3300035691 | Ga0373931_0146274 | Ga0373931_0146274_62_1084 | 336 |
| 281 | 3300035725 | Ga0373947_0020056 | Ga0373947_0020056_960_1976 | 336 |
| 282 | 3300037068 | Ga0373925_0012539 | Ga0373925_0012539_2052_3095 | 336 |
| 283 | 3300037853 | Ga0436364_1106984 | Ga0436364_1106984_180_1265 | 336 |
| 284 | 3300044673 | Ga0453683_0069083 | Ga0453683_0069083_44_1057 | 336 |
| 285 | 3300045051 | Ga0451576_0034864 | Ga0451576_0034864_4182_5195 | 336 |
| 286 | 3300046454 | Ga0495592_0000182 | Ga0495592_0000182_10229_11272 | 336 |
| 287 | 3300046517 | Ga0495630_0038528 | Ga0495630_0038528_1043_2059 | 336 |
| 288 | 3300046543 | Ga0495645_0084442 | Ga0495645_0084442_268_1311 | 336 |
| 289 | 3300047471 | Ga0495684_0008556 | Ga0495684_0008556_1775_2791 | 336 |
| 290 | 3300048904 | Ga0496101_0228118 | Ga0496101_0228118_188_1213 | 336 |
| 291 | 3300048905 | Ga0496102_0340579 | Ga0496102_0340579_367_1392 | 336 |
| 292 | 3300048907 | Ga0496104_0354172 | Ga0496104_0354172_145_1167 | 336 |
| 293 | 3300048910 | Ga0496107_0061500 | Ga0496107_0061500_804_1826 | 336 |
| 294 | 3300048911 | Ga0496108_0000202 | Ga0496108_0000202_24974_25990 | 336 |
| 295 | 3300048912 | Ga0496109_0000131 | Ga0496109_0000131_60412_61428 | 336 |
| 296 | 3300048914 | Ga0496111_0011257 | Ga0496111_0011257_868_1890 | 336 |
| 297 | 3300048915 | Ga0496112_0282661 | Ga0496112_0282661_499_1524 | 336 |
| 298 | 3300049569 | Ga0501032_0001199 | Ga0501032_0001199_4445_5455 | 336 |
| 299 | 3300049569 | Ga0501032_0012082 | Ga0501032_0012082_4310_5329 | 336 |
| 300 | 3300049570 | Ga0501033_0000002 | Ga0501033_0000002_15297_16307 | 336 |
| 301 | 3300049574 | Ga0501038_0008016 | Ga0501038_0008016_2240_3259 | 336 |
| 302 | 3300049575 | Ga0501039_0004895 | Ga0501039_0004895_1704_2723 | 336 |
| 303 | 3300049576 | Ga0501040_0016813 | Ga0501040_0016813_3808_4827 | 336 |
| 304 | 3300049578 | Ga0501042_0000699 | Ga0501042_0000699_11430_12449 | 336 |
| 305 | 3300049579 | Ga0501043_0004397 | Ga0501043_0004397_7611_8630 | 336 |
| 306 | 3300049580 | Ga0501046_0003955 | Ga0501046_0003955_9661_10680 | 336 |
| 307 | 3300049581 | Ga0501047_0195271 | Ga0501047_0195271_761_1780 | 336 |
| 308 | 3300049582 | Ga0501048_0000087 | Ga0501048_0000087_40466_41485 | 336 |
| 309 | 3300049586 | Ga0501070_0051846 | Ga0501070_0051846_563_1582 | 336 |
| 310 | 3300049588 | Ga0501072_0001904 | Ga0501072_0001904_12179_13198 | 336 |
| 311 | 3300049590 | Ga0501074_0030064 | Ga0501074_0030064_2043_3062 | 336 |
| 312 | 3300049591 | Ga0501075_0002741 | Ga0501075_0002741_8250_9269 | 336 |
| 313 | 3300049592 | Ga0501076_0000626 | Ga0501076_0000626_11233_12252 | 336 |
| 314 | 3300049593 | Ga0501077_0001981 | Ga0501077_0001981_7780_8799 | 336 |
| 315 | 3300049741 | Ga0501079_0000083 | Ga0501079_0000083_1705_2724 | 336 |
| 316 | 3300049743 | Ga0501081_0004414 | Ga0501081_0004414_3438_4457 | 336 |
| 317 | 3300049823 | Ga0501044_0166035 | Ga0501044_0166035_935_1954 | 336 |
| 318 | 3300050512 | nmdc:mga0n895_129355_c1 | nmdc:mga0n895_129355_c1_174_1193 | 336 |
| 319 | 3300050514 | nmdc:mga08x19_159980_c1 | nmdc:mga08x19_159980_c1_269_1285 | 336 |
| 320 | 3300054114 | Ga0501084_0002472 | Ga0501084_0002472_8376_9395 | 336 |
| 321 | 3300060353 | Ga0501082_0001978 | Ga0501082_0001978_11870_12889 | 336 |
| 322 | 3300061734 | Ga0530510_0005357 | Ga0530510_0005357_4886_5905 | 336 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pvj-assembly1.cif.gz_A | crystal structure of phqk in complex with malbrancheamide c | 0.9492 | 2 | 32 |
| 4j33-assembly1.cif.gz_A | crystal structure of kynurenine 3-monooxygenase (kmo-394) | 0.936 | 2 | 30 |
| 7ctq-assembly2.cif.gz_B | peptidyl tryptophan dihydroxylase qhpg essential for tryptophylquinone cofactor biogenesis | 0.9359 | 3 | 30 |
| 4j31-assembly1.cif.gz_A | crystal structure of kynurenine 3-monooxygenase (kmo-396prot) | 0.932 | 2 | 30 |
| 6fp1-assembly1.cif.gz_A | the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1 | 0.9318 | 1 | 28 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4e21B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9784 | 1 | 179 | 3.40.50.720 |
| 4e21B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9728 | 1 | 179 | 3.40.50.720 |
| af_P75728_4_256_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9462 | 2 | 28 | 3.50.50.60 |
| af_Q4DU92_1_145_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9286 | 1 | 136 | 3.40.50.720 |
| 3i3lA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.921 | 2 | 30 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A434GE67-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9989 | 13 | 151 |
GO:0004616
GO:0050661 |
| AF-A0A2M7WZ84-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9963 | 1 | 152 |
GO:0004616
GO:0050661 |
| AF-A0A534C3M2-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9954 | 1 | 143 |
GO:0004616
GO:0050661 |
| AF-A0A520J4Q4-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9928 | 1 | 114 |
GO:0004616
GO:0050661 |
| AF-A0A3L7N5A4-F1-model_v4 | 6-phosphogluconate dehydrogenase (Decarboxylating) | 0.9924 | 1 | 85 |
GO:0004616
GO:0050661 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar