F406503

General Info

Members Datasets Scaffolds Average Seq Length
322 198 322 335

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10019339|Ga0265338_100193392
Length 401
Sequence MVGAIADGDRPTRAMSSDVAGSGHPRPGSQQTFATSLGDGEATSFGWLFSLLVAGPSRASCCDEEPSVKLGVVGLGRMGANMVRRLLGAGHECVVFDIHPQTALDVAKFGATATRSLSDLIAKLEPPRAIWIMLPAAVVDATLRDIAPLLGSDDAVIDGGNSYYHDDIRRAKMLRERGIHYVDVGTSGGVWGFERGYCQMIGGEDAIVKRLDGIFSALAPGLDDASKSPRDDKGTVQRGYIHCGPAGAGHFVKMVHNGIEYGMMAAYAEGLNILRHANVGASERTSDAETAPLRHPELYQYDLNLPDIVETWRHGSVIGSWLLDLTAAALKKSSDLKDFTGRVSDSGEGRWTLKAAIDEGVPAPVLSMALTQRFASRGDADFANKLLSALRYQFGGHEEKP

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.11
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10000018 3300001991 Bacteria 14441
2 rootH2_10002489 3300003320 Bacteria 14463
3 Ga0065704_10001221 3300005289 Bacteria 15987
4 Ga0065715_10090415 3300005293 Bacteria 7056
5 Ga0070676_10102382 3300005328 Bacteria 1771
6 Ga0070683_100002813 3300005329 Bacteria 13919
7 Ga0070670_100022025 3300005331 Bacteria 5483
8 Ga0070677_10016857 3300005333 Bacteria 2607
9 Ga0070689_100010985 3300005340 Bacteria 6472
10 Ga0070691_10000215 3300005341 Bacteria 19539
11 Ga0070691_10066429 3300005341 Bacteria 1743
12 Ga0070661_100001932 3300005344 Bacteria 14337
13 Ga0070661_100006153 3300005344 Bacteria 8270
14 Ga0070661_100208309 3300005344 Bacteria 1496
15 Ga0070675_100001289 3300005354 Bacteria 18320
16 Ga0070671_100000666 3300005355 Bacteria 24595
17 Ga0070673_100002795 3300005364 Bacteria 10728
18 Ga0070709_10003388 3300005434 Bacteria 8563
19 Ga0070714_100038147 3300005435 Bacteria 4040
20 Ga0070714_100119736 3300005435 Bacteria 2340
21 Ga0070714_100314977 3300005435 Bacteria 1462
22 Ga0070713_100000122 3300005436 Bacteria 50640
23 Ga0070713_100007429 3300005436 Bacteria 7690
24 Ga0070713_100045029 3300005436 Bacteria 3614
25 Ga0070713_100048750 3300005436 Bacteria 3490
26 Ga0070694_100161761 3300005444 Bacteria 1643
27 Ga0070708_100001379 3300005445 Bacteria 18549
28 Ga0070678_100001820 3300005456 Bacteria 11497
29 Ga0070662_100036092 3300005457 Bacteria 3495
30 Ga0070681_10039168 3300005458 Bacteria 4752
31 Ga0070681_10170417 3300005458 Bacteria 2099
32 Ga0070681_10556713 3300005458 Bacteria 1061
33 Ga0068867_100006321 3300005459 Bacteria 8382
34 Ga0070706_100003762 3300005467 Bacteria 14810
35 Ga0070706_100026994 3300005467 Bacteria 5283
36 Ga0070707_100006179 3300005468 Bacteria 11156
37 Ga0070707_100032668 3300005468 Bacteria 4958
38 Ga0070707_100167629 3300005468 Bacteria 2141
39 Ga0070698_100062206 3300005471 Bacteria 3766
40 Ga0070698_100121977 3300005471 Bacteria 2565
41 Ga0070699_100002084 3300005518 Bacteria 18104
42 Ga0070699_100174967 3300005518 Bacteria 1903
43 Ga0070699_100289649 3300005518 Bacteria 1468
44 Ga0070679_100017243 3300005530 Bacteria 6986
45 Ga0070679_100282024 3300005530 Bacteria 1614
46 Ga0070684_100068759 3300005535 Bacteria 3113
47 Ga0070684_100111876 3300005535 Bacteria 2449
48 Ga0070697_100003470 3300005536 Bacteria 12123
49 Ga0070697_100006903 3300005536 Bacteria 8825
50 Ga0068853_100006000 3300005539 Bacteria 9607
51 Ga0070672_100000294 3300005543 Bacteria 28190
52 Ga0070695_100095303 3300005545 Bacteria 1994
53 Ga0070693_100072210 3300005547 Bacteria 2035
54 Ga0070665_100087319 3300005548 Bacteria 3124
55 Ga0068855_100059230 3300005563 Bacteria 4481
56 Ga0068855_100067392 3300005563 Bacteria 4170
57 Ga0068855_100129517 3300005563 Bacteria 2883
58 Ga0070664_100001493 3300005564 Bacteria 18627
59 Ga0070664_100031135 3300005564 Bacteria 4454
60 Ga0068857_100000408 3300005577 Bacteria 30304
61 Ga0068857_100009498 3300005577 Bacteria 8445
62 Ga0068854_100024223 3300005578 Bacteria 4153
63 Ga0068856_100000251 3300005614 Bacteria 58356
64 Ga0068856_100002153 3300005614 Bacteria 20400
65 Ga0068856_100019350 3300005614 Bacteria 6610
66 Ga0068852_100001267 3300005616 Bacteria 16860
67 Ga0068852_100006673 3300005616 Bacteria 8365
68 Ga0068852_100029352 3300005616 Bacteria 4518
69 Ga0068864_100035876 3300005618 Bacteria 4223
70 Ga0068866_10030189 3300005718 Bacteria 2599
71 Ga0068858_100094368 3300005842 Bacteria 2787
72 Ga0068858_100103197 3300005842 Bacteria 2660
73 Ga0068860_100055911 3300005843 Bacteria 3752
74 Ga0070717_10064805 3300006028 Bacteria 3036
75 Ga0070716_100000755 3300006173 Bacteria 13856
76 Ga0070716_100003573 3300006173 Bacteria 7341
77 Ga0070712_100000019 3300006175 Bacteria 89020
78 Ga0070712_100052342 3300006175 Bacteria 2847
79 Ga0097621_100001516 3300006237 Bacteria 15907
80 Ga0068871_100003912 3300006358 Bacteria 10265
81 Ga0068871_100013898 3300006358 Bacteria 5986
82 Ga0075434_100071315 3300006871 Bacteria 3466
83 Ga0075436_100000102 3300006914 Bacteria 50389
84 Ga0075436_100072281 3300006914 Bacteria 2386
85 Ga0075436_100099935 3300006914 Bacteria 2020
86 Ga0075436_100119975 3300006914 Bacteria 1839
87 Ga0105240_10000482 3300009093 Bacteria 73610
88 Ga0105240_10027710 3300009093 Bacteria 7414
89 Ga0105240_10140947 3300009093 Bacteria 2882
90 Ga0105240_10209401 3300009093 Bacteria 2279
91 Ga0105240_10258940 3300009093 Bacteria 2008
92 Ga0105245_10004598 3300009098 Bacteria 12184
93 Ga0114129_10240073 3300009147 Bacteria 2436
94 Ga0105241_10023267 3300009174 Bacteria 4594
95 Ga0105241_10026395 3300009174 Bacteria 4321
96 Ga0105248_10084009 3300009177 Bacteria 3581
97 Ga0105237_10021705 3300009545 Bacteria 6597
98 Ga0105239_10004824 3300010375 Bacteria 15973
99 Ga0105239_10024414 3300010375 Bacteria 6661
100 Ga0105239_10441691 3300010375 Bacteria 1475
101 Ga0105246_10423751 3300011119 Bacteria 1111
102 Ga0157373_10010371 3300013100 Bacteria 6859
103 Ga0157370_10007658 3300013104 Bacteria 11722
104 Ga0157370_10011743 3300013104 Bacteria 9146
105 Ga0157369_10028611 3300013105 Bacteria 6167
106 Ga0157369_10035058 3300013105 Bacteria 5503
107 Ga0157369_10046244 3300013105 Bacteria 4731
108 Ga0157374_10001133 3300013296 Bacteria 22835
109 Ga0157374_10013519 3300013296 Bacteria 7125
110 Ga0157374_10027605 3300013296 Bacteria 5124
111 Ga0157374_10103334 3300013296 Bacteria 2734
112 Ga0157378_10001185 3300013297 Bacteria 23694
113 Ga0157378_10006905 3300013297 Bacteria 9910
114 Ga0157378_10024648 3300013297 Bacteria 5296
115 Ga0157378_10164126 3300013297 Bacteria 2079
116 Ga0157372_10017758 3300013307 Bacteria 7637
117 Ga0157372_10448958 3300013307 Bacteria 1503
118 Ga0157375_10000942 3300013308 Bacteria 25237
119 Ga0157375_10177986 3300013308 Bacteria 2278
120 Ga0157379_10003644 3300014968 Bacteria 13075
121 Ga0157379_10069417 3300014968 Bacteria 3152
122 Ga0157376_10008465 3300014969 Bacteria 7426
123 Ga0157376_10016880 3300014969 Bacteria 5554
124 Ga0207697_10045803 3300025315 Bacteria 1801
125 Ga0207682_10020288 3300025893 Bacteria 2608
126 Ga0207642_10054537 3300025899 Bacteria 1824
127 Ga0207699_10000238 3300025906 Bacteria 30877
128 Ga0207684_10000975 3300025910 Bacteria 32051
129 Ga0207684_10009310 3300025910 Bacteria 8679
130 Ga0207654_10014406 3300025911 Bacteria 4085
131 Ga0207707_10000894 3300025912 Bacteria 29148
132 Ga0207695_10003354 3300025913 Bacteria 22633
133 Ga0207695_10039741 3300025913 Bacteria 5053
134 Ga0207695_10069512 3300025913 Bacteria 3603
135 Ga0207695_10109226 3300025913 Bacteria 2748
136 Ga0207671_10041890 3300025914 Bacteria 3390
137 Ga0207671_10274365 3300025914 Bacteria 1329
138 Ga0207693_10002009 3300025915 Bacteria 17864
139 Ga0207662_10142770 3300025918 Unclassified 1518
140 Ga0207657_10059519 3300025919 Bacteria 3281
141 Ga0207649_10001275 3300025920 Bacteria 15037
142 Ga0207649_10007317 3300025920 Bacteria 6008
143 Ga0207652_10037874 3300025921 Bacteria 4084
144 Ga0207646_10010390 3300025922 Bacteria 9104
145 Ga0207646_10012319 3300025922 Bacteria 8223
146 Ga0207646_10093198 3300025922 Bacteria 2697
147 Ga0207694_10009283 3300025924 Bacteria 7422
148 Ga0207659_10002917 3300025926 Bacteria 10184
149 Ga0207700_10000088 3300025928 Bacteria 57845
150 Ga0207700_10042567 3300025928 Bacteria 3330
151 Ga0207700_10048150 3300025928 Bacteria 3164
152 Ga0207664_10010274 3300025929 Bacteria 6610
153 Ga0207664_10010477 3300025929 Bacteria 6546
154 Ga0207664_10062691 3300025929 Bacteria 2969
155 Ga0207664_10319650 3300025929 Bacteria 1369
156 Ga0207664_10389872 3300025929 Bacteria 1237
157 Ga0207644_10007815 3300025931 Bacteria 6986
158 Ga0207706_10237472 3300025933 Bacteria 1594
159 Ga0207706_10367829 3300025933 Bacteria 1249
160 Ga0207670_10006519 3300025936 Bacteria 6480
161 Ga0207665_10002914 3300025939 Bacteria 11473
162 Ga0207665_10023396 3300025939 Bacteria 4071
163 Ga0207665_10048615 3300025939 Bacteria 2848
164 Ga0207691_10001349 3300025940 Bacteria 24461
165 Ga0207711_10070843 3300025941 Bacteria 3024
166 Ga0207661_10018457 3300025944 Bacteria 5181
167 Ga0207679_10015833 3300025945 Bacteria 4996
168 Ga0207667_10000972 3300025949 Bacteria 36552
169 Ga0207667_10072890 3300025949 Bacteria 3569
170 Ga0207667_10239590 3300025949 Bacteria 1857
171 Ga0207651_10003376 3300025960 Bacteria 7840
172 Ga0207640_10055329 3300025981 Bacteria 2598
173 Ga0207703_10131841 3300026035 Bacteria 2159
174 Ga0207639_10001449 3300026041 Bacteria 15976
175 Ga0207702_10000238 3300026078 Bacteria 63877
176 Ga0207702_10000359 3300026078 Bacteria 52081
177 Ga0207641_10566778 3300026088 Bacteria 1109
178 Ga0207648_10016133 3300026089 Bacteria 6839
179 Ga0207674_10000127 3300026116 Bacteria 88956
180 Ga0207674_10009368 3300026116 Bacteria 11201
181 Ga0207674_10127839 3300026116 Bacteria 2505
182 Ga0207683_10000367 3300026121 Bacteria 41412
183 Ga0207683_10316165 3300026121 Bacteria 1430
184 Ga0207698_10000805 3300026142 Bacteria 18253
185 Ga0207698_10037451 3300026142 Bacteria 3573
186 Ga0265355_1000054 3300028036 Bacteria 3746
187 Ga0268266_10113677 3300028379 Bacteria 2401
188 Ga0265334_10056952 3300028573 Bacteria 1483
189 Ga0265323_10007471 3300028653 Bacteria 4539
190 Ga0265338_10019339 3300028800 Bacteria 7231
191 Ga0265760_10000797 3300031090 Bacteria 9073
192 Ga0265330_10030825 3300031235 Bacteria 2405
193 Ga0265332_10010516 3300031238 Bacteria 4120
194 Ga0265328_10033534 3300031239 Bacteria 1904
195 Ga0265325_10004893 3300031241 Bacteria 8367
196 Ga0265325_10006671 3300031241 Bacteria 6984
197 Ga0265340_10012465 3300031247 Bacteria 4490
198 Ga0265340_10014656 3300031247 Bacteria 4088
199 Ga0265340_10020145 3300031247 Bacteria 3432
200 Ga0265340_10074600 3300031247 Bacteria 1604
201 Ga0265331_10011517 3300031250 Bacteria 4840
202 Ga0265316_10011615 3300031344 Bacteria 7931
203 Ga0265316_10020774 3300031344 Bacteria 5579
204 Ga0265316_10040014 3300031344 Bacteria 3761
205 Ga0307513_10014136 3300031456 Bacteria 9768
206 Ga0307513_10051467 3300031456 Bacteria 4443
207 Ga0265313_10007076 3300031595 Bacteria 7751
208 Ga0265314_10001130 3300031711 Bacteria 30899
209 Ga0265342_10003262 3300031712 Bacteria 13442
210 Ga0265342_10005778 3300031712 Bacteria 9351
211 Ga0265342_10010809 3300031712 Bacteria 6289
212 Ga0265342_10090302 3300031712 Bacteria 1757
213 Ga0307409_100160824 3300031995 Bacteria 1964
214 Ga0373928_0001734 3300035084 Bacteria 4234
215 Ga0373944_0027886 3300035089 Bacteria 1678
216 Ga0373923_0012978 3300035111 Bacteria 3095
217 Ga0373932_0010429 3300035112 Bacteria 2248
218 Ga0373954_0004691 3300035118 Bacteria 5895
219 Ga0373956_0002118 3300035119 Bacteria 8225
220 Ga0373955_0014314 3300035172 Bacteria 3856
221 Ga0373931_0146274 3300035691 Bacteria 1374
222 Ga0373935_0233873 3300035692 Bacteria 1281
223 Ga0373935_0234680 3300035692 Bacteria 1278
224 Ga0373947_0020056 3300035725 Bacteria 3858
225 Ga0373937_0030150 3300036401 Bacteria 4913
226 Ga0373937_0058253 3300036401 Bacteria 3548
227 Ga0373925_0012539 3300037068 Bacteria 6142
228 Ga0373925_0157330 3300037068 Bacteria 1788
229 Ga0436364_1106984 3300037853 Bacteria 1908
230 Ga0451577_0001184 3300042876 Bacteria 36620
231 Ga0453683_0035935 3300044673 Unclassified 3120
232 Ga0453683_0069083 3300044673 Bacteria 2209
233 Ga0453684_0000930 3300044712 Bacteria 96857
234 Ga0466971_0000075 3300044719 Bacteria 36467
235 Ga0451576_0034864 3300045051 Bacteria 5343
236 Ga0495592_0000182 3300046454 Bacteria 55441
237 Ga0495651_0030025 3300046462 Bacteria 4238
238 Ga0495580_0084383 3300046472 Bacteria 2213
239 Ga0495618_0112338 3300046514 Bacteria 1745
240 Ga0495630_0038528 3300046517 Bacteria 3575
241 Ga0495587_0144669 3300046536 Bacteria 1356
242 Ga0495645_0084442 3300046543 Bacteria 2274
243 Ga0495635_0157105 3300046663 Bacteria 1548
244 Ga0495658_0069745 3300046683 Bacteria 2038
245 Ga0495669_0005798 3300046684 Bacteria 5150
246 Ga0495613_0097351 3300046689 Bacteria 2127
247 Ga0495589_0045820 3300046794 Bacteria 2172
248 Ga0495600_0145406 3300046809 Bacteria 1537
249 Ga0495684_0008556 3300047471 Bacteria 7924
250 Ga0496101_0228118 3300048904 Bacteria 1447
251 Ga0496102_0231542 3300048905 Bacteria 1742
252 Ga0496102_0340579 3300048905 Bacteria 1412
253 Ga0496104_0339292 3300048907 Bacteria 1416
254 Ga0496104_0354172 3300048907 Bacteria 1380
255 Ga0496107_0061500 3300048910 Bacteria 2719
256 Ga0496108_0000202 3300048911 Bacteria 55115
257 Ga0496109_0000131 3300048912 Bacteria 76860
258 Ga0496111_0011257 3300048914 Bacteria 6022
259 Ga0496112_0282661 3300048915 Bacteria 1606
260 Ga0501032_0001199 3300049569 Bacteria 20723
261 Ga0501032_0012082 3300049569 Bacteria 6183
262 Ga0501032_0041535 3300049569 Bacteria 3122
263 Ga0501033_0000002 3300049570 Bacteria 668574
264 Ga0501033_0000057 3300049570 Bacteria 107439
265 Ga0501033_0057388 3300049570 Bacteria 2878
266 Ga0501036_0097856 3300049572 Bacteria 2480
267 Ga0501037_0002372 3300049573 Bacteria 13598
268 Ga0501038_0000020 3300049574 Bacteria 152738
269 Ga0501038_0003279 3300049574 Bacteria 15078
270 Ga0501038_0008016 3300049574 Bacteria 9731
271 Ga0501038_0032289 3300049574 Bacteria 4621
272 Ga0501039_0004895 3300049575 Bacteria 10147
273 Ga0501040_0016813 3300049576 Bacteria 4850
274 Ga0501040_0172321 3300049576 Bacteria 1532
275 Ga0501041_0024412 3300049577 Bacteria 3629
276 Ga0501042_0000699 3300049578 Bacteria 18216
277 Ga0501043_0001680 3300049579 Bacteria 19212
278 Ga0501043_0004397 3300049579 Bacteria 11449
279 Ga0501046_0000026 3300049580 Bacteria 197226
280 Ga0501046_0003955 3300049580 Bacteria 13532
281 Ga0501046_0007080 3300049580 Bacteria 9875
282 Ga0501047_0002039 3300049581 Bacteria 19304
283 Ga0501047_0195271 3300049581 Bacteria 1886
284 Ga0501048_0000087 3300049582 Bacteria 48546
285 Ga0501048_0000956 3300049582 Bacteria 21343
286 Ga0501048_0069944 3300049582 Bacteria 2479
287 Ga0501070_0051846 3300049586 Bacteria 3405
288 Ga0501070_0086765 3300049586 Bacteria 2591
289 Ga0501072_0001904 3300049588 Bacteria 15553
290 Ga0501072_0025383 3300049588 Bacteria 4617
291 Ga0501073_0248263 3300049589 Bacteria 1228
292 Ga0501074_0030064 3300049590 Bacteria 3936
293 Ga0501074_0034214 3300049590 Bacteria 3684
294 Ga0501075_0002741 3300049591 Bacteria 11795
295 Ga0501075_0032952 3300049591 Bacteria 3853
296 Ga0501076_0000626 3300049592 Bacteria 22547
297 Ga0501076_0462748 3300049592 Bacteria 1044
298 Ga0501077_0001981 3300049593 Bacteria 12376
299 Ga0501079_0000083 3300049741 Bacteria 45025
300 Ga0501079_0046950 3300049741 Bacteria 3332
301 Ga0501080_0108736 3300049742 Bacteria 2570
302 Ga0501081_0004414 3300049743 Bacteria 9020
303 Ga0501081_0091413 3300049743 Bacteria 2140
304 Ga0501083_0000006 3300049744 Bacteria 199638
305 Ga0501035_0150824 3300049822 Bacteria 2017
306 Ga0501044_0166035 3300049823 Bacteria 2182
307 Ga0501045_0003257 3300049824 Bacteria 11090
308 Ga0501045_0194149 3300049824 Bacteria 1513
309 Ga0501045_0312539 3300049824 Bacteria 1169
310 nmdc:mga0n895_105078_c1 3300050512 Bacteria 2836
311 nmdc:mga0n895_129355_c1 3300050512 Bacteria 2549
312 nmdc:mga0n895_18938_c1 3300050512 Bacteria 6385
313 nmdc:mga08x19_159980_c1 3300050514 Bacteria 1529
314 nmdc:mga08x19_9085_c1 3300050514 Bacteria 5934
315 nmdc:mga08x19_91_c1 3300050514 Bacteria 81177
316 Ga0501084_0002472 3300054114 Bacteria 14886
317 Ga0501084_0061462 3300054114 Bacteria 3145
318 Ga0501082_0001978 3300060353 Bacteria 18035
319 Ga0501082_0004234 3300060353 Bacteria 12535
320 Ga0466962_0000010 3300061719 Bacteria 130694
321 Ga0530510_0005357 3300061734 Bacteria 8876
322 Ga0530510_0017661 3300061734 Bacteria 5055

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10164126 Ga0157378_101641262 257
2 3300049822 Ga0501035_0150824 Ga0501035_0150824_1098_1937 270
3 3300013296 Ga0157374_10103334 Ga0157374_101033343 301
4 3300013297 Ga0157378_10001185 Ga0157378_100011851 301
5 3300013308 Ga0157375_10177986 Ga0157375_101779863 301
6 3300046536 Ga0495587_0144669 Ga0495587_0144669_419_1342 301
7 3300049569 Ga0501032_0041535 Ga0501032_0041535_802_1770 301
8 3300049570 Ga0501033_0000057 Ga0501033_0000057_95349_96317 301
9 3300049574 Ga0501038_0003279 Ga0501038_0003279_10767_11735 301
10 3300035692 Ga0373935_0234680 Ga0373935_0234680_130_1047 303
11 3300037068 Ga0373925_0157330 Ga0373925_0157330_328_1245 303
12 3300014968 Ga0157379_10069417 Ga0157379_100694172 312
13 3300048905 Ga0496102_0231542 Ga0496102_0231542_468_1412 312
14 3300050512 nmdc:mga0n895_105078_c1 nmdc:mga0n895_105078_c1_1468_2412 312
15 3300050512 nmdc:mga0n895_18938_c1 nmdc:mga0n895_18938_c1_1122_2066 312
16 3300050514 nmdc:mga08x19_91_c1 nmdc:mga08x19_91_c1_76865_77809 312
17 3300049570 Ga0501033_0057388 Ga0501033_0057388_1610_2575 314
18 3300049572 Ga0501036_0097856 Ga0501036_0097856_327_1292 314
19 3300049573 Ga0501037_0002372 Ga0501037_0002372_7748_8728 314
20 3300049574 Ga0501038_0032289 Ga0501038_0032289_3232_4197 314
21 3300049576 Ga0501040_0172321 Ga0501040_0172321_342_1307 314
22 3300049577 Ga0501041_0024412 Ga0501041_0024412_2212_3177 314
23 3300049580 Ga0501046_0007080 Ga0501046_0007080_2716_3681 314
24 3300049582 Ga0501048_0069944 Ga0501048_0069944_1204_2169 314
25 3300049588 Ga0501072_0025383 Ga0501072_0025383_3205_4170 314
26 3300049590 Ga0501074_0034214 Ga0501074_0034214_2405_3370 314
27 3300049591 Ga0501075_0032952 Ga0501075_0032952_1659_2624 314
28 3300049592 Ga0501076_0462748 Ga0501076_0462748_42_1007 314
29 3300049741 Ga0501079_0046950 Ga0501079_0046950_16_981 314
30 3300049742 Ga0501080_0108736 Ga0501080_0108736_1047_2012 314
31 3300049743 Ga0501081_0091413 Ga0501081_0091413_220_1185 314
32 3300049824 Ga0501045_0003257 Ga0501045_0003257_6045_7010 314
33 3300049824 Ga0501045_0194149 Ga0501045_0194149_512_1492 314
34 3300054114 Ga0501084_0061462 Ga0501084_0061462_1233_2198 314
35 3300060353 Ga0501082_0004234 Ga0501082_0004234_5993_6958 314
36 3300061734 Ga0530510_0017661 Ga0530510_0017661_3499_4464 314
37 3300042876 Ga0451577_0001184 Ga0451577_0001184_1134_2177 318
38 3300005341 Ga0070691_10000215 Ga0070691_100002154 322
39 3300005434 Ga0070709_10003388 Ga0070709_100033884 322
40 3300005436 Ga0070713_100000122 Ga0070713_10000012244 322
41 3300005458 Ga0070681_10170417 Ga0070681_101704172 322
42 3300005539 Ga0068853_100006000 Ga0068853_10000600011 322
43 3300005545 Ga0070695_100095303 Ga0070695_1000953032 322
44 3300005577 Ga0068857_100000408 Ga0068857_1000004083 322
45 3300005614 Ga0068856_100000251 Ga0068856_10000025124 322
46 3300005614 Ga0068856_100002153 Ga0068856_1000021533 322
47 3300005616 Ga0068852_100029352 Ga0068852_1000293522 322
48 3300006173 Ga0070716_100003573 Ga0070716_1000035732 322
49 3300006175 Ga0070712_100000019 Ga0070712_10000001924 322
50 3300006871 Ga0075434_100071315 Ga0075434_1000713154 322
51 3300006914 Ga0075436_100000102 Ga0075436_10000010245 322
52 3300006914 Ga0075436_100119975 Ga0075436_1001199753 322
53 3300009093 Ga0105240_10000482 Ga0105240_1000048268 322
54 3300009174 Ga0105241_10023267 Ga0105241_100232673 322
55 3300009545 Ga0105237_10021705 Ga0105237_100217053 322
56 3300010375 Ga0105239_10004824 Ga0105239_1000482411 322
57 3300013100 Ga0157373_10010371 Ga0157373_100103713 322
58 3300013104 Ga0157370_10011743 Ga0157370_1001174310 322
59 3300013105 Ga0157369_10028611 Ga0157369_100286116 322
60 3300013296 Ga0157374_10027605 Ga0157374_100276052 322
61 3300013307 Ga0157372_10017758 Ga0157372_1001775810 322
62 3300014968 Ga0157379_10003644 Ga0157379_100036448 322
63 3300025906 Ga0207699_10000238 Ga0207699_100002389 322
64 3300025914 Ga0207671_10041890 Ga0207671_100418903 322
65 3300025915 Ga0207693_10002009 Ga0207693_1000200910 322
66 3300025928 Ga0207700_10000088 Ga0207700_1000008814 322
67 3300025939 Ga0207665_10023396 Ga0207665_100233962 322
68 3300025949 Ga0207667_10072890 Ga0207667_100728903 322
69 3300026035 Ga0207703_10131841 Ga0207703_101318412 322
70 3300026041 Ga0207639_10001449 Ga0207639_100014493 322
71 3300026078 Ga0207702_10000238 Ga0207702_1000023857 322
72 3300026078 Ga0207702_10000359 Ga0207702_100003596 322
73 3300026116 Ga0207674_10000127 Ga0207674_1000012786 322
74 3300036401 Ga0373937_0030150 Ga0373937_0030150_3563_4573 322
75 3300046472 Ga0495580_0084383 Ga0495580_0084383_940_1941 322
76 3300005340 Ga0070689_100010985 Ga0070689_1000109851 326
77 3300005435 Ga0070714_100119736 Ga0070714_1001197362 326
78 3300009093 Ga0105240_10140947 Ga0105240_101409472 326
79 3300009098 Ga0105245_10004598 Ga0105245_1000459813 326
80 3300025929 Ga0207664_10389872 Ga0207664_103898722 326
81 3300026121 Ga0207683_10316165 Ga0207683_103161652 326
82 3300035089 Ga0373944_0027886 Ga0373944_0027886_320_1306 326
83 3300035692 Ga0373935_0233873 Ga0373935_0233873_61_1047 326
84 3300044719 Ga0466971_0000075 Ga0466971_0000075_11532_12512 326
85 3300046462 Ga0495651_0030025 Ga0495651_0030025_1496_2482 326
86 3300046663 Ga0495635_0157105 Ga0495635_0157105_238_1224 326
87 3300046684 Ga0495669_0005798 Ga0495669_0005798_103_1089 326
88 3300046794 Ga0495589_0045820 Ga0495589_0045820_779_1771 326
89 3300046809 Ga0495600_0145406 Ga0495600_0145406_129_1115 326
90 3300048907 Ga0496104_0339292 Ga0496104_0339292_60_1046 326
91 3300049574 Ga0501038_0000020 Ga0501038_0000020_85526_86506 326
92 3300049586 Ga0501070_0086765 Ga0501070_0086765_131_1111 326
93 3300049589 Ga0501073_0248263 Ga0501073_0248263_159_1142 326
94 3300061719 Ga0466962_0000010 Ga0466962_0000010_109863_110843 326
95 3300005444 Ga0070694_100161761 Ga0070694_1001617611 327
96 3300005548 Ga0070665_100087319 Ga0070665_1000873193 329
97 3300028379 Ga0268266_10113677 Ga0268266_101136772 329
98 3300031456 Ga0307513_10014136 Ga0307513_100141363 330
99 3300031456 Ga0307513_10051467 Ga0307513_100514672 331
100 3300035172 Ga0373955_0014314 Ga0373955_0014314_916_1914 331
101 3300036401 Ga0373937_0058253 Ga0373937_0058253_220_1218 331
102 3300044673 Ga0453683_0035935 Ga0453683_0035935_1863_2861 331
103 3300005436 Ga0070713_100045029 Ga0070713_1000450292 332
104 3300005458 Ga0070681_10556713 Ga0070681_105567131 332
105 3300005468 Ga0070707_100006179 Ga0070707_1000061794 332
106 3300005536 Ga0070697_100003470 Ga0070697_1000034704 332
107 3300005563 Ga0068855_100129517 Ga0068855_1001295172 332
108 3300005842 Ga0068858_100103197 Ga0068858_1001031972 332
109 3300005843 Ga0068860_100055911 Ga0068860_1000559111 332
110 3300013104 Ga0157370_10007658 Ga0157370_100076582 332
111 3300025913 Ga0207695_10069512 Ga0207695_100695122 332
112 3300025918 Ga0207662_10142770 Ga0207662_101427702 332
113 3300025928 Ga0207700_10048150 Ga0207700_100481502 332
114 3300025929 Ga0207664_10010274 Ga0207664_100102743 332
115 3300025949 Ga0207667_10239590 Ga0207667_102395902 332
116 3300026088 Ga0207641_10566778 Ga0207641_105667781 332
117 3300046514 Ga0495618_0112338 Ga0495618_0112338_629_1633 332
118 3300050514 nmdc:mga08x19_9085_c1 nmdc:mga08x19_9085_c1_530_1531 332
119 3300005344 Ga0070661_100208309 Ga0070661_1002083092 333
120 3300005564 Ga0070664_100031135 Ga0070664_1000311354 333
121 3300025945 Ga0207679_10015833 Ga0207679_100158334 333
122 3300028653 Ga0265323_10007471 Ga0265323_100074712 333
123 3300028800 Ga0265338_10019339 Ga0265338_100193392 333
124 3300031235 Ga0265330_10030825 Ga0265330_100308252 333
125 3300031238 Ga0265332_10010516 Ga0265332_100105163 333
126 3300031239 Ga0265328_10033534 Ga0265328_100335342 333
127 3300031241 Ga0265325_10004893 Ga0265325_100048932 333
128 3300031250 Ga0265331_10011517 Ga0265331_100115173 333
129 3300031344 Ga0265316_10020774 Ga0265316_100207743 333
130 3300031711 Ga0265314_10001130 Ga0265314_1000113018 333
131 3300031712 Ga0265342_10005778 Ga0265342_100057783 333
132 3300044712 Ga0453684_0000930 Ga0453684_0000930_26443_27462 334
133 3300005289 Ga0065704_10001221 Ga0065704_100012214 335
134 3300031247 Ga0265340_10074600 Ga0265340_100746001 335
135 3300035111 Ga0373923_0012978 Ga0373923_0012978_691_1701 335
136 3300035118 Ga0373954_0004691 Ga0373954_0004691_3425_4435 335
137 3300035119 Ga0373956_0002118 Ga0373956_0002118_172_1182 335
138 3300046683 Ga0495658_0069745 Ga0495658_0069745_305_1315 335
139 3300046689 Ga0495613_0097351 Ga0495613_0097351_636_1646 335
140 3300049579 Ga0501043_0001680 Ga0501043_0001680_4024_5058 335
141 3300049580 Ga0501046_0000026 Ga0501046_0000026_120020_121054 335
142 3300049581 Ga0501047_0002039 Ga0501047_0002039_10856_11890 335
143 3300049582 Ga0501048_0000956 Ga0501048_0000956_7034_8068 335
144 3300049744 Ga0501083_0000006 Ga0501083_0000006_176381_177415 335
145 3300049824 Ga0501045_0312539 Ga0501045_0312539_35_1069 335
146 3300001991 JGI24743J22301_10000018 JGI24743J22301_100000188 336
147 3300003320 rootH2_10002489 rootH2_100024896 336
148 3300005293 Ga0065715_10090415 Ga0065715_100904154 336
149 3300005328 Ga0070676_10102382 Ga0070676_101023822 336
150 3300005329 Ga0070683_100002813 Ga0070683_1000028135 336
151 3300005331 Ga0070670_100022025 Ga0070670_1000220256 336
152 3300005333 Ga0070677_10016857 Ga0070677_100168572 336
153 3300005341 Ga0070691_10066429 Ga0070691_100664292 336
154 3300005344 Ga0070661_100001932 Ga0070661_10000193211 336
155 3300005344 Ga0070661_100006153 Ga0070661_1000061535 336
156 3300005354 Ga0070675_100001289 Ga0070675_1000012895 336
157 3300005355 Ga0070671_100000666 Ga0070671_1000006665 336
158 3300005364 Ga0070673_100002795 Ga0070673_1000027955 336
159 3300005435 Ga0070714_100038147 Ga0070714_1000381472 336
160 3300005435 Ga0070714_100314977 Ga0070714_1003149772 336
161 3300005436 Ga0070713_100007429 Ga0070713_1000074296 336
162 3300005436 Ga0070713_100048750 Ga0070713_1000487502 336
163 3300005445 Ga0070708_100001379 Ga0070708_1000013797 336
164 3300005456 Ga0070678_100001820 Ga0070678_1000018209 336
165 3300005457 Ga0070662_100036092 Ga0070662_1000360922 336
166 3300005458 Ga0070681_10039168 Ga0070681_100391685 336
167 3300005459 Ga0068867_100006321 Ga0068867_1000063214 336
168 3300005467 Ga0070706_100003762 Ga0070706_1000037623 336
169 3300005467 Ga0070706_100026994 Ga0070706_1000269946 336
170 3300005468 Ga0070707_100032668 Ga0070707_1000326686 336
171 3300005468 Ga0070707_100167629 Ga0070707_1001676292 336
172 3300005471 Ga0070698_100062206 Ga0070698_1000622063 336
173 3300005471 Ga0070698_100121977 Ga0070698_1001219772 336
174 3300005518 Ga0070699_100002084 Ga0070699_1000020848 336
175 3300005518 Ga0070699_100174967 Ga0070699_1001749673 336
176 3300005518 Ga0070699_100289649 Ga0070699_1002896492 336
177 3300005530 Ga0070679_100017243 Ga0070679_1000172435 336
178 3300005530 Ga0070679_100282024 Ga0070679_1002820242 336
179 3300005535 Ga0070684_100068759 Ga0070684_1000687592 336
180 3300005535 Ga0070684_100111876 Ga0070684_1001118762 336
181 3300005536 Ga0070697_100006903 Ga0070697_1000069032 336
182 3300005543 Ga0070672_100000294 Ga0070672_1000002948 336
183 3300005547 Ga0070693_100072210 Ga0070693_1000722102 336
184 3300005563 Ga0068855_100059230 Ga0068855_1000592304 336
185 3300005563 Ga0068855_100067392 Ga0068855_1000673922 336
186 3300005564 Ga0070664_100001493 Ga0070664_1000014935 336
187 3300005577 Ga0068857_100009498 Ga0068857_1000094987 336
188 3300005578 Ga0068854_100024223 Ga0068854_1000242234 336
189 3300005614 Ga0068856_100019350 Ga0068856_1000193502 336
190 3300005616 Ga0068852_100001267 Ga0068852_1000012674 336
191 3300005616 Ga0068852_100006673 Ga0068852_1000066736 336
192 3300005618 Ga0068864_100035876 Ga0068864_1000358763 336
193 3300005718 Ga0068866_10030189 Ga0068866_100301892 336
194 3300005842 Ga0068858_100094368 Ga0068858_1000943683 336
195 3300006028 Ga0070717_10064805 Ga0070717_100648052 336
196 3300006173 Ga0070716_100000755 Ga0070716_1000007554 336
197 3300006175 Ga0070712_100052342 Ga0070712_1000523423 336
198 3300006237 Ga0097621_100001516 Ga0097621_1000015164 336
199 3300006358 Ga0068871_100003912 Ga0068871_1000039124 336
200 3300006358 Ga0068871_100013898 Ga0068871_1000138985 336
201 3300006914 Ga0075436_100072281 Ga0075436_1000722812 336
202 3300006914 Ga0075436_100099935 Ga0075436_1000999352 336
203 3300009093 Ga0105240_10027710 Ga0105240_100277102 336
204 3300009093 Ga0105240_10209401 Ga0105240_102094012 336
205 3300009093 Ga0105240_10258940 Ga0105240_102589403 336
206 3300009147 Ga0114129_10240073 Ga0114129_102400732 336
207 3300009174 Ga0105241_10026395 Ga0105241_100263954 336
208 3300009177 Ga0105248_10084009 Ga0105248_100840092 336
209 3300010375 Ga0105239_10024414 Ga0105239_100244145 336
210 3300010375 Ga0105239_10441691 Ga0105239_104416912 336
211 3300011119 Ga0105246_10423751 Ga0105246_104237511 336
212 3300013105 Ga0157369_10035058 Ga0157369_100350584 336
213 3300013105 Ga0157369_10046244 Ga0157369_100462443 336
214 3300013296 Ga0157374_10001133 Ga0157374_100011334 336
215 3300013296 Ga0157374_10013519 Ga0157374_100135194 336
216 3300013297 Ga0157378_10006905 Ga0157378_100069055 336
217 3300013297 Ga0157378_10024648 Ga0157378_100246482 336
218 3300013307 Ga0157372_10448958 Ga0157372_104489581 336
219 3300013308 Ga0157375_10000942 Ga0157375_1000094223 336
220 3300014969 Ga0157376_10008465 Ga0157376_100084659 336
221 3300014969 Ga0157376_10016880 Ga0157376_100168802 336
222 3300025315 Ga0207697_10045803 Ga0207697_100458032 336
223 3300025893 Ga0207682_10020288 Ga0207682_100202882 336
224 3300025899 Ga0207642_10054537 Ga0207642_100545372 336
225 3300025910 Ga0207684_10000975 Ga0207684_1000097524 336
226 3300025910 Ga0207684_10009310 Ga0207684_100093105 336
227 3300025911 Ga0207654_10014406 Ga0207654_100144064 336
228 3300025912 Ga0207707_10000894 Ga0207707_100008949 336
229 3300025913 Ga0207695_10003354 Ga0207695_1000335415 336
230 3300025913 Ga0207695_10039741 Ga0207695_100397412 336
231 3300025913 Ga0207695_10109226 Ga0207695_101092262 336
232 3300025914 Ga0207671_10274365 Ga0207671_102743652 336
233 3300025919 Ga0207657_10059519 Ga0207657_100595193 336
234 3300025920 Ga0207649_10001275 Ga0207649_100012759 336
235 3300025920 Ga0207649_10007317 Ga0207649_100073173 336
236 3300025921 Ga0207652_10037874 Ga0207652_100378742 336
237 3300025922 Ga0207646_10010390 Ga0207646_1001039010 336
238 3300025922 Ga0207646_10012319 Ga0207646_100123192 336
239 3300025922 Ga0207646_10093198 Ga0207646_100931982 336
240 3300025924 Ga0207694_10009283 Ga0207694_100092836 336
241 3300025926 Ga0207659_10002917 Ga0207659_100029175 336
242 3300025928 Ga0207700_10042567 Ga0207700_100425673 336
243 3300025929 Ga0207664_10010477 Ga0207664_100104775 336
244 3300025929 Ga0207664_10062691 Ga0207664_100626911 336
245 3300025929 Ga0207664_10319650 Ga0207664_103196502 336
246 3300025931 Ga0207644_10007815 Ga0207644_100078153 336
247 3300025933 Ga0207706_10237472 Ga0207706_102374722 336
248 3300025933 Ga0207706_10367829 Ga0207706_103678291 336
249 3300025936 Ga0207670_10006519 Ga0207670_100065192 336
250 3300025939 Ga0207665_10002914 Ga0207665_100029143 336
251 3300025939 Ga0207665_10048615 Ga0207665_100486152 336
252 3300025940 Ga0207691_10001349 Ga0207691_100013497 336
253 3300025941 Ga0207711_10070843 Ga0207711_100708432 336
254 3300025944 Ga0207661_10018457 Ga0207661_100184574 336
255 3300025949 Ga0207667_10000972 Ga0207667_1000097229 336
256 3300025960 Ga0207651_10003376 Ga0207651_100033765 336
257 3300025981 Ga0207640_10055329 Ga0207640_100553291 336
258 3300026089 Ga0207648_10016133 Ga0207648_100161332 336
259 3300026116 Ga0207674_10009368 Ga0207674_100093687 336
260 3300026116 Ga0207674_10127839 Ga0207674_101278393 336
261 3300026121 Ga0207683_10000367 Ga0207683_1000036713 336
262 3300026142 Ga0207698_10000805 Ga0207698_100008053 336
263 3300026142 Ga0207698_10037451 Ga0207698_100374512 336
264 3300028036 Ga0265355_1000054 Ga0265355_10000541 336
265 3300028573 Ga0265334_10056952 Ga0265334_100569522 336
266 3300031090 Ga0265760_10000797 Ga0265760_100007976 336
267 3300031241 Ga0265325_10006671 Ga0265325_100066718 336
268 3300031247 Ga0265340_10012465 Ga0265340_100124653 336
269 3300031247 Ga0265340_10014656 Ga0265340_100146562 336
270 3300031247 Ga0265340_10020145 Ga0265340_100201452 336
271 3300031344 Ga0265316_10011615 Ga0265316_100116155 336
272 3300031344 Ga0265316_10040014 Ga0265316_100400143 336
273 3300031595 Ga0265313_10007076 Ga0265313_100070768 336
274 3300031712 Ga0265342_10003262 Ga0265342_100032623 336
275 3300031712 Ga0265342_10010809 Ga0265342_100108092 336
276 3300031712 Ga0265342_10090302 Ga0265342_100903023 336
277 3300031995 Ga0307409_100160824 Ga0307409_1001608242 336
278 3300035084 Ga0373928_0001734 Ga0373928_0001734_2654_3679 336
279 3300035112 Ga0373932_0010429 Ga0373932_0010429_144_1169 336
280 3300035691 Ga0373931_0146274 Ga0373931_0146274_62_1084 336
281 3300035725 Ga0373947_0020056 Ga0373947_0020056_960_1976 336
282 3300037068 Ga0373925_0012539 Ga0373925_0012539_2052_3095 336
283 3300037853 Ga0436364_1106984 Ga0436364_1106984_180_1265 336
284 3300044673 Ga0453683_0069083 Ga0453683_0069083_44_1057 336
285 3300045051 Ga0451576_0034864 Ga0451576_0034864_4182_5195 336
286 3300046454 Ga0495592_0000182 Ga0495592_0000182_10229_11272 336
287 3300046517 Ga0495630_0038528 Ga0495630_0038528_1043_2059 336
288 3300046543 Ga0495645_0084442 Ga0495645_0084442_268_1311 336
289 3300047471 Ga0495684_0008556 Ga0495684_0008556_1775_2791 336
290 3300048904 Ga0496101_0228118 Ga0496101_0228118_188_1213 336
291 3300048905 Ga0496102_0340579 Ga0496102_0340579_367_1392 336
292 3300048907 Ga0496104_0354172 Ga0496104_0354172_145_1167 336
293 3300048910 Ga0496107_0061500 Ga0496107_0061500_804_1826 336
294 3300048911 Ga0496108_0000202 Ga0496108_0000202_24974_25990 336
295 3300048912 Ga0496109_0000131 Ga0496109_0000131_60412_61428 336
296 3300048914 Ga0496111_0011257 Ga0496111_0011257_868_1890 336
297 3300048915 Ga0496112_0282661 Ga0496112_0282661_499_1524 336
298 3300049569 Ga0501032_0001199 Ga0501032_0001199_4445_5455 336
299 3300049569 Ga0501032_0012082 Ga0501032_0012082_4310_5329 336
300 3300049570 Ga0501033_0000002 Ga0501033_0000002_15297_16307 336
301 3300049574 Ga0501038_0008016 Ga0501038_0008016_2240_3259 336
302 3300049575 Ga0501039_0004895 Ga0501039_0004895_1704_2723 336
303 3300049576 Ga0501040_0016813 Ga0501040_0016813_3808_4827 336
304 3300049578 Ga0501042_0000699 Ga0501042_0000699_11430_12449 336
305 3300049579 Ga0501043_0004397 Ga0501043_0004397_7611_8630 336
306 3300049580 Ga0501046_0003955 Ga0501046_0003955_9661_10680 336
307 3300049581 Ga0501047_0195271 Ga0501047_0195271_761_1780 336
308 3300049582 Ga0501048_0000087 Ga0501048_0000087_40466_41485 336
309 3300049586 Ga0501070_0051846 Ga0501070_0051846_563_1582 336
310 3300049588 Ga0501072_0001904 Ga0501072_0001904_12179_13198 336
311 3300049590 Ga0501074_0030064 Ga0501074_0030064_2043_3062 336
312 3300049591 Ga0501075_0002741 Ga0501075_0002741_8250_9269 336
313 3300049592 Ga0501076_0000626 Ga0501076_0000626_11233_12252 336
314 3300049593 Ga0501077_0001981 Ga0501077_0001981_7780_8799 336
315 3300049741 Ga0501079_0000083 Ga0501079_0000083_1705_2724 336
316 3300049743 Ga0501081_0004414 Ga0501081_0004414_3438_4457 336
317 3300049823 Ga0501044_0166035 Ga0501044_0166035_935_1954 336
318 3300050512 nmdc:mga0n895_129355_c1 nmdc:mga0n895_129355_c1_174_1193 336
319 3300050514 nmdc:mga08x19_159980_c1 nmdc:mga08x19_159980_c1_269_1285 336
320 3300054114 Ga0501084_0002472 Ga0501084_0002472_8376_9395 336
321 3300060353 Ga0501082_0001978 Ga0501082_0001978_11870_12889 336
322 3300061734 Ga0530510_0005357 Ga0530510_0005357_4886_5905 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

69

226

0.98

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

249

288

0.89

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

294

398

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pvj-assembly1.cif.gz_A crystal structure of phqk in complex with malbrancheamide c 0.9492 2 32
4j33-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.936 2 30
7ctq-assembly2.cif.gz_B peptidyl tryptophan dihydroxylase qhpg essential for tryptophylquinone cofactor biogenesis 0.9359 3 30
4j31-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-396prot) 0.932 2 30
6fp1-assembly1.cif.gz_A the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1 0.9318 1 28
ID Description Score Start End Superfamily
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9784 1 179 3.40.50.720
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9728 1 179 3.40.50.720
af_P75728_4_256_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9462 2 28 3.50.50.60
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9286 1 136 3.40.50.720
3i3lA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.921 2 30 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A434GE67-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9989 13 151 GO:0004616
GO:0050661
AF-A0A2M7WZ84-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9963 1 152 GO:0004616
GO:0050661
AF-A0A534C3M2-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9954 1 143 GO:0004616
GO:0050661
AF-A0A520J4Q4-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9928 1 114 GO:0004616
GO:0050661
AF-A0A3L7N5A4-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9924 1 85 GO:0004616
GO:0050661

Feature Viewer

pLDDT pTM Quality
90.16 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map