F406445

General Info

Members Datasets Scaffolds Average Seq Length
322 162 644 144

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10729300|Ga0157371_107293001
Length 150
Sequence MKLLLALSFTCLSFLSLNWQTDFTKAKEDALKENRAILISFSGSDWCGPCIRMEREIFESNVFTNYATNNLVLVKADFPRQKKNQLSKEQTQKNDALAEKYNPNGKFPLTLLVSSDEKILKEWEGLPKETADQFVEEIKSVLNDAGNSSK

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
125 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
156 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
157 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
158 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
159 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
160 2818991437 Pedobacter terrae 518 Isolate Unclassified
161 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
162 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 1.86
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 0
Rhizoplane 0.31
Rhizosphere 88.2
Stem 0
Stem Tuber 0
Unclassified 15.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10729300 3300013102 Bacteria 743
2 SwRhRL2b_contig_188096 2162886007 Bacteria 7786
3 SwRhRL2b_contig_2054166 2162886007 Bacteria 4382
4 JGI24741J21665_1006393 3300001915 Bacteria 2368
5 JGI24740J21852_10016170 3300001979 Bacteria 2702
6 JGI24740J21852_10031511 3300001979 Bacteria 1709
7 JGI24740J21852_10069939 3300001979 Unclassified 943
8 JGI24739J22299_10009347 3300001989 Bacteria 3656
9 JGI24737J22298_10004172 3300001990 Bacteria 5052
10 JGI24737J22298_10071776 3300001990 Bacteria 1033
11 JGI24737J22298_10090811 3300001990 Bacteria 906
12 JGI24735J21928_10000002 3300002067 Bacteria 624895
13 JGI24735J21928_10005473 3300002067 Bacteria 4212
14 JGI24735J21928_10196824 3300002067 Bacteria 584
15 JGI24744J21845_10000781 3300002077 Bacteria 5959
16 JGI25157J39369_1014548 3300002741 Bacteria 976
17 JGI25165J46597_1026330 3300003214 Bacteria 753
18 rootH2_10001661 3300003320 Bacteria 18662
19 rootH2_10088266 3300003320 Bacteria 14905
20 rootH2_10089123 3300003320 Bacteria 1952
21 rootH2_10191916 3300003320 Bacteria 2329
22 rootH2_10208810 3300003320 Unclassified 1089
23 rootH2_10334183 3300003320 Bacteria 1639
24 rootL2_10162841 3300003322 Bacteria 1087
25 rootH1_10014057 3300003323 Bacteria 12949
26 rootH1_10014058 3300003323 Bacteria 71578
27 rootH1_10106778 3300003323 Bacteria 3493
28 rootH1_10149412 3300003323 Bacteria 3023
29 rootH1_10325025 3300003323 Bacteria 1941
30 Ga0058863_10942654 3300004799 Unclassified 700
31 Ga0058861_10246701 3300004800 Unclassified 520
32 Ga0058862_12044153 3300004803 Unclassified 749
33 Ga0065714_10002228 3300005288 Bacteria 43581
34 Ga0065714_10064438 3300005288 Bacteria 113441
35 Ga0065704_10000215 3300005289 Bacteria 98472
36 Ga0065704_10072845 3300005289 Bacteria 7935
37 Ga0065704_10196523 3300005289 Unclassified 1165
38 Ga0070658_10000032 3300005327 Bacteria 147726
39 Ga0070658_10009767 3300005327 Bacteria 7708
40 Ga0070676_11000756 3300005328 Bacteria 627
41 Ga0070683_100014496 3300005329 Bacteria 6897
42 Ga0070683_100224627 3300005329 Unclassified 1785
43 Ga0070690_100544936 3300005330 Bacteria 874
44 Ga0070680_100008492 3300005336 Bacteria 7866
45 Ga0068868_100002277 3300005338 Bacteria 13263
46 Ga0070660_100036312 3300005339 Unclassified 3732
47 Ga0070660_100109731 3300005339 Unclassified 2194
48 Ga0070660_100362404 3300005339 Bacteria 1195
49 Ga0070660_100436436 3300005339 Bacteria 1085
50 Ga0070675_100095720 3300005354 Bacteria 2493
51 Ga0070671_100020934 3300005355 Bacteria 5336
52 Ga0070671_100304033 3300005355 Unclassified 1358
53 Ga0070674_100107553 3300005356 Bacteria 2042
54 Ga0070673_100110532 3300005364 Unclassified 2279
55 Ga0070673_100390377 3300005364 Unclassified 1243
56 Ga0070673_101687029 3300005364 Unclassified 599
57 Ga0070659_100000119 3300005366 Bacteria 59333
58 Ga0070659_100026815 3300005366 Bacteria 4435
59 Ga0070659_100032312 3300005366 Bacteria 4058
60 Ga0070659_100190876 3300005366 Unclassified 1684
61 Ga0070663_100009839 3300005455 Bacteria 5940
62 Ga0070678_100008303 3300005456 Bacteria 6215
63 Ga0070662_100000365 3300005457 Bacteria 27040
64 Ga0070662_100155731 3300005457 Unclassified 1783
65 Ga0070681_10009723 3300005458 Bacteria 9463
66 Ga0070681_10413609 3300005458 Bacteria 1260
67 Ga0068867_100000655 3300005459 Bacteria 22898
68 Ga0070679_100079699 3300005530 Bacteria 3264
69 Ga0070684_100147896 3300005535 Unclassified 2127
70 Ga0070684_100175008 3300005535 Unclassified 1950
71 Ga0068853_100014799 3300005539 Bacteria 6402
72 Ga0068853_100057210 3300005539 Bacteria 3364
73 Ga0068853_100136654 3300005539 Bacteria 2198
74 Ga0068853_100272441 3300005539 Unclassified 1559
75 Ga0068853_100930672 3300005539 Bacteria 835
76 Ga0070672_100463879 3300005543 Bacteria 1092
77 Ga0070665_100000147 3300005548 Bacteria 129683
78 Ga0068855_100000195 3300005563 Bacteria 78223
79 Ga0068855_100000302 3300005563 Bacteria 61501
80 Ga0068855_100012251 3300005563 Bacteria 10363
81 Ga0068855_100081865 3300005563 Bacteria 3742
82 Ga0068855_100139197 3300005563 Bacteria 2768
83 Ga0068855_101487765 3300005563 Bacteria 696
84 Ga0068855_101644081 3300005563 Bacteria 656
85 Ga0070664_100173458 3300005564 Unclassified 1914
86 Ga0068857_100085992 3300005577 Bacteria 2811
87 Ga0068856_100000031 3300005614 Bacteria 126668
88 Ga0068856_100121372 3300005614 Bacteria 2615
89 Ga0068856_100343810 3300005614 Bacteria 1510
90 Ga0068856_100859935 3300005614 Bacteria 926
91 Ga0068852_100002945 3300005616 Bacteria 11831
92 Ga0068852_100246058 3300005616 Bacteria 1711
93 Ga0068852_100309892 3300005616 Bacteria 1530
94 Ga0068852_100744283 3300005616 Bacteria 992
95 Ga0068859_100039224 3300005617 Bacteria 4751
96 Ga0068866_10382922 3300005718 Bacteria 902
97 Ga0068870_10041212 3300005840 Bacteria 2398
98 Ga0075366_10159597 3300006195 Unclassified 1366
99 Ga0097621_100000551 3300006237 Bacteria 26354
100 Ga0097621_100046436 3300006237 Bacteria 3514
101 Ga0068871_100000072 3300006358 Bacteria 56289
102 Ga0068871_101366278 3300006358 Bacteria 667
103 Ga0068865_100201746 3300006881 Bacteria 1544
104 Ga0097620_100039223 3300006931 Bacteria 4751
105 Ga0105244_10019715 3300009036 Bacteria 3758
106 Ga0105240_10012512 3300009093 Bacteria 11705
107 Ga0105240_10036460 3300009093 Bacteria 6325
108 Ga0105240_10120180 3300009093 Bacteria 3164
109 Ga0105240_10185636 3300009093 Bacteria 2450
110 Ga0105240_10197235 3300009093 Bacteria 2362
111 Ga0105240_10267477 3300009093 Bacteria 1970
112 Ga0105240_10305160 3300009093 Bacteria 1820
113 Ga0105245_10253544 3300009098 Unclassified 1710
114 Ga0105241_10005349 3300009174 Bacteria 9486
115 Ga0105241_10018464 3300009174 Bacteria 5130
116 Ga0105241_10060734 3300009174 Bacteria 2909
117 Ga0105241_10424649 3300009174 Bacteria 1171
118 Ga0105242_10013868 3300009176 Bacteria 6235
119 Ga0105237_10001788 3300009545 Bacteria 27807
120 Ga0105237_10005179 3300009545 Bacteria 14746
121 Ga0105237_10088230 3300009545 Bacteria 3091
122 Ga0105237_10135812 3300009545 Bacteria 2454
123 Ga0105238_10006932 3300009551 Bacteria 11321
124 Ga0105239_10000011 3300010375 Bacteria 337500
125 Ga0105239_10000440 3300010375 Bacteria 60691
126 Ga0105239_10010926 3300010375 Bacteria 10142
127 Ga0105239_10036952 3300010375 Bacteria 5358
128 Ga0105239_10161979 3300010375 Bacteria 2500
129 Ga0105239_10357088 3300010375 Bacteria 1650
130 Ga0105239_11680208 3300010375 Bacteria 735
131 Ga0105246_10217701 3300011119 Bacteria 1495
132 Ga0157373_10000069 3300013100 Bacteria 91687
133 Ga0157373_10000464 3300013100 Bacteria 32220
134 Ga0157373_10009325 3300013100 Bacteria 7254
135 Ga0157373_10015773 3300013100 Bacteria 5517
136 Ga0157373_10023465 3300013100 Bacteria 4472
137 Ga0157373_10077725 3300013100 Bacteria 2341
138 Ga0157373_11460912 3300013100 Bacteria 521
139 Ga0157371_10000178 3300013102 Bacteria 92872
140 Ga0157371_10000749 3300013102 Bacteria 37566
141 Ga0157371_10004325 3300013102 Bacteria 12452
142 Ga0157371_10035647 3300013102 Unclassified 3565
143 Ga0157371_10043809 3300013102 Bacteria 3187
144 Ga0157371_10107085 3300013102 Unclassified 1984
145 Ga0157370_10000332 3300013104 Bacteria 59335
146 Ga0157370_10002241 3300013104 Bacteria 23522
147 Ga0157370_10276290 3300013104 Unclassified 1552
148 Ga0157370_10555484 3300013104 Bacteria 1052
149 Ga0157369_10058564 3300013105 Bacteria 4155
150 Ga0157369_10079952 3300013105 Unclassified 3501
151 Ga0157369_10201286 3300013105 Unclassified 2090
152 Ga0157369_10754529 3300013105 Bacteria 1001
153 Ga0157374_10001224 3300013296 Bacteria 21940
154 Ga0157374_10002996 3300013296 Bacteria 14134
155 Ga0157374_10009934 3300013296 Bacteria 8172
156 Ga0157378_10005725 3300013297 Bacteria 10878
157 Ga0157378_10020232 3300013297 Bacteria 5854
158 Ga0157378_10033534 3300013297 Bacteria 4540
159 Ga0157378_10271234 3300013297 Unclassified 1632
160 Ga0163162_10000049 3300013306 Bacteria 122455
161 Ga0163162_10000088 3300013306 Bacteria 85462
162 Ga0163162_10020392 3300013306 Bacteria 6513
163 Ga0157372_10000009 3300013307 Bacteria 302051
164 Ga0157372_10001047 3300013307 Bacteria 30262
165 Ga0157372_10004867 3300013307 Bacteria 14272
166 Ga0157372_10005594 3300013307 Bacteria 13364
167 Ga0157372_10016245 3300013307 Bacteria 7987
168 Ga0157372_10067463 3300013307 Bacteria 4020
169 Ga0157372_10279016 3300013307 Unclassified 1942
170 Ga0157372_10322000 3300013307 Bacteria 1800
171 Ga0157372_10474014 3300013307 Unclassified 1459
172 Ga0157375_10016597 3300013308 Bacteria 6621
173 Ga0157375_10444789 3300013308 Bacteria 1461
174 Ga0157375_10618412 3300013308 Bacteria 1241
175 Ga0182008_10000009 3300014497 Bacteria 331416
176 Ga0157376_10679736 3300014969 Bacteria 1032
177 Ga0157376_10942598 3300014969 Unclassified 883
178 Ga0182006_1000267 3300015261 Bacteria 47415
179 Ga0206351_10663275 3300020077 Bacteria 616
180 Ga0206352_10358190 3300020078 Bacteria 741
181 Ga0206352_10988754 3300020078 Bacteria 758
182 Ga0209437_100024 3300025233 Bacteria 592878
183 Ga0209026_1001737 3300025250 Bacteria 9081
184 Ga0209026_1002014 3300025250 Bacteria 8070
185 Ga0209026_1003257 3300025250 Bacteria 5451
186 Ga0209129_1017332 3300025258 Unclassified 1416
187 Ga0209233_1001432 3300025261 Bacteria 9412
188 Ga0209233_1014938 3300025261 Unclassified 2176
189 Ga0209233_1021922 3300025261 Bacteria 1644
190 Ga0209455_1006228 3300025272 Bacteria 3555
191 Ga0207642_10533440 3300025899 Bacteria 723
192 Ga0207647_10000043 3300025904 Bacteria 91109
193 Ga0207647_10000258 3300025904 Bacteria 43440
194 Ga0207647_10271901 3300025904 Bacteria 969
195 Ga0207647_10657390 3300025904 Bacteria 574
196 Ga0207645_10001730 3300025907 Bacteria 17692
197 Ga0207643_10090744 3300025908 Bacteria 1781
198 Ga0207705_10000032 3300025909 Bacteria 224376
199 Ga0207705_10049382 3300025909 Bacteria 3028
200 Ga0207705_10209693 3300025909 Bacteria 1478
201 Ga0207654_10001469 3300025911 Bacteria 12466
202 Ga0207707_10018394 3300025912 Bacteria 6092
203 Ga0207707_10331732 3300025912 Bacteria 1312
204 Ga0207695_10007657 3300025913 Bacteria 13682
205 Ga0207695_10009204 3300025913 Bacteria 12246
206 Ga0207695_10020429 3300025913 Bacteria 7585
207 Ga0207695_10035695 3300025913 Bacteria 5386
208 Ga0207695_10132947 3300025913 Bacteria 2444
209 Ga0207695_10216014 3300025913 Bacteria 1826
210 Ga0207671_10003472 3300025914 Bacteria 15675
211 Ga0207671_10024184 3300025914 Bacteria 4571
212 Ga0207660_10013970 3300025917 Bacteria 5270
213 Ga0207657_10308624 3300025919 Bacteria 1253
214 Ga0207652_10023991 3300025921 Bacteria 5059
215 Ga0207694_10076480 3300025924 Bacteria 2622
216 Ga0207644_10031458 3300025931 Bacteria 3697
217 Ga0207644_10213182 3300025931 Unclassified 1528
218 Ga0207690_10000465 3300025932 Bacteria 26044
219 Ga0207690_10103727 3300025932 Bacteria 2036
220 Ga0207690_10158043 3300025932 Unclassified 1687
221 Ga0207690_10186978 3300025932 Bacteria 1564
222 Ga0207706_10000779 3300025933 Bacteria 33001
223 Ga0207706_10162681 3300025933 Unclassified 1962
224 Ga0207686_10051727 3300025934 Bacteria 2560
225 Ga0207669_10084844 3300025937 Bacteria 2042
226 Ga0207704_10000220 3300025938 Bacteria 28668
227 Ga0207704_10628816 3300025938 Bacteria 882
228 Ga0207661_10045479 3300025944 Bacteria 3475
229 Ga0207679_10080129 3300025945 Unclassified 2492
230 Ga0207667_10000046 3300025949 Bacteria 245420
231 Ga0207667_10003734 3300025949 Bacteria 18783
232 Ga0207667_10006175 3300025949 Bacteria 14545
233 Ga0207667_10357617 3300025949 Bacteria 1489
234 Ga0207667_10564819 3300025949 Unclassified 1150
235 Ga0207667_10646576 3300025949 Bacteria 1063
236 Ga0207667_10996113 3300025949 Bacteria 826
237 Ga0207651_10137912 3300025960 Unclassified 1879
238 Ga0207651_10196140 3300025960 Unclassified 1614
239 Ga0207677_10087990 3300026023 Bacteria 2251
240 Ga0207677_11348647 3300026023 Unclassified 656
241 Ga0207639_10033641 3300026041 Bacteria 3783
242 Ga0207639_10071280 3300026041 Bacteria 2717
243 Ga0207639_10618283 3300026041 Bacteria 1000
244 Ga0207639_11043194 3300026041 Bacteria 766
245 Ga0207678_10023973 3300026067 Bacteria 5334
246 Ga0207702_10000071 3300026078 Bacteria 114394
247 Ga0207702_10029223 3300026078 Bacteria 4586
248 Ga0207702_10298366 3300026078 Bacteria 1529
249 Ga0207648_10001785 3300026089 Bacteria 23566
250 Ga0207683_10045741 3300026121 Bacteria 3828
251 Ga0207698_10228538 3300026142 Bacteria 1687
252 Ga0207698_10585786 3300026142 Bacteria 1098
253 Ga0268266_10000030 3300028379 Bacteria 417120
254 Ga0307517_10007033 3300028786 Bacteria 16512
255 Ga0265338_10085339 3300028800 Bacteria 2632
256 Ga0307512_10421637 3300030522 Bacteria 551
257 Ga0265327_10033017 3300031251 Unclassified 2891
258 Ga0307414_10000131 3300032004 Bacteria 51831
259 Ga0307414_10001835 3300032004 Bacteria 10977
260 Ga0307510_10003615 3300033180 Bacteria 18053
261 Ga0395899_0000121 3300037312 Bacteria 125324
262 Ga0395899_0000220 3300037312 Bacteria 78900
263 Ga0395899_0001386 3300037312 Bacteria 20798
264 Ga0395900_0000115 3300037418 Bacteria 138474
265 Ga0395898_0038613 3300037466 Bacteria 4731
266 Ga0395905_0000045 3300037471 Bacteria 241370
267 Ga0395905_1169257 3300037471 Unclassified 673
268 Ga0395901_0000706 3300038443 Bacteria 38128
269 Ga0395901_0075895 3300038443 Bacteria 3507
270 Ga0395901_0714074 3300038443 Bacteria 999
271 Ga0436361_0831474 3300039447 Bacteria 12282
272 Ga0439439_0128357 3300041406 Bacteria 711
273 Ga0451835_0709782 3300041492 Unclassified 792
274 Ga0466969_0042927 3300044656 Bacteria 2255
275 Ga0466966_0055511 3300044684 Bacteria 2506
276 Ga0466966_0231418 3300044684 Bacteria 1115
277 Ga0466961_0320469 3300044693 Unclassified 945
278 Ga0466957_0551125 3300044842 Bacteria 803
279 Ga0466959_0099372 3300045049 Bacteria 2084
280 Ga0466958_0312507 3300045836 Bacteria 1009
281 Ga0495650_0000036 3300046471 Bacteria 400633
282 Ga0495585_0161586 3300046492 Unclassified 1162
283 Ga0495596_0017324 3300046500 Bacteria 2985
284 Ga0495583_0347773 3300046506 Bacteria 585
285 Ga0495606_0000143 3300046507 Bacteria 123231
286 Ga0495610_0001747 3300046512 Bacteria 19026
287 Ga0495616_0008524 3300046513 Bacteria 6062
288 Ga0495616_0050300 3300046513 Unclassified 2085
289 Ga0495631_0058400 3300046518 Bacteria 1678
290 Ga0495648_0010424 3300046524 Bacteria 7079
291 Ga0495648_0011643 3300046524 Bacteria 6608
292 Ga0495609_0003634 3300046538 Bacteria 8746
293 Ga0495645_0450462 3300046543 Bacteria 812
294 Ga0495622_0204664 3300046557 Bacteria 878
295 Ga0495633_0024395 3300046558 Bacteria 2989
296 Ga0495668_0000011 3300046616 Bacteria 472186
297 Ga0495625_0000009 3300046660 Bacteria 404954
298 Ga0495625_0076019 3300046660 Unclassified 2349
299 Ga0495625_0524435 3300046660 Bacteria 721
300 Ga0495661_0016299 3300046665 Bacteria 4929
301 Ga0495613_0540458 3300046689 Bacteria 781
302 Ga0495649_0000008 3300046694 Bacteria 483706
303 Ga0495660_0023770 3300046810 Bacteria 3495
304 Ga0495660_0213434 3300046810 Bacteria 914
305 Ga0495683_0002545 3300047323 Bacteria 10956
306 Ga0495687_001322 3300047443 Bacteria 23124
307 Ga0495687_005561 3300047443 Bacteria 7988
308 Ga0495686_0032626 3300047472 Bacteria 3369
309 Ga0495686_0106449 3300047472 Unclassified 1686
310 Ga0495686_0147455 3300047472 Bacteria 1384
311 Ga0495686_0178981 3300047472 Bacteria 1229
312 nmdc:mga0k408_152950_c1 3300050493 Unclassified 1374
313 Ga0500635_0002823 3300053080 Bacteria 4316
314 Ga0500650_0170417 3300053098 Unclassified 1001
315 Ga0500608_000600 3300053122 Bacteria 13258
316 Ga0500608_018680 3300053122 Bacteria 3167
317 Ga0500608_025980 3300053122 Unclassified 2746
318 Ga0500642_0163788 3300053130 Bacteria 1042
319 2599478099 2599185184 Bacteria 6430550
320 2819549357 2818991437 Bacteria 5805520
321 2928147481 2928147474 Bacteria 6512076
322 2932083592 2932082852 Bacteria 6563563
323 Ga0157371_10729300
324 SwRhRL2b_contig_188096
325 SwRhRL2b_contig_2054166
326 JGI24741J21665_1006393
327 JGI24740J21852_10016170
328 JGI24740J21852_10031511
329 JGI24740J21852_10069939
330 JGI24739J22299_10009347
331 JGI24737J22298_10004172
332 JGI24737J22298_10071776
333 JGI24737J22298_10090811
334 JGI24735J21928_10000002
335 JGI24735J21928_10005473
336 JGI24735J21928_10196824
337 JGI24744J21845_10000781
338 JGI25157J39369_1014548
339 JGI25165J46597_1026330
340 rootH2_10001661
341 rootH2_10088266
342 rootH2_10089123
343 rootH2_10191916
344 rootH2_10208810
345 rootH2_10334183
346 rootL2_10162841
347 rootH1_10014057
348 rootH1_10014058
349 rootH1_10106778
350 rootH1_10149412
351 rootH1_10325025
352 Ga0058863_10942654
353 Ga0058861_10246701
354 Ga0058862_12044153
355 Ga0065714_10002228
356 Ga0065714_10064438
357 Ga0065704_10000215
358 Ga0065704_10072845
359 Ga0065704_10196523
360 Ga0070658_10000032
361 Ga0070658_10009767
362 Ga0070676_11000756
363 Ga0070683_100014496
364 Ga0070683_100224627
365 Ga0070690_100544936
366 Ga0070680_100008492
367 Ga0068868_100002277
368 Ga0070660_100036312
369 Ga0070660_100109731
370 Ga0070660_100362404
371 Ga0070660_100436436
372 Ga0070675_100095720
373 Ga0070671_100020934
374 Ga0070671_100304033
375 Ga0070674_100107553
376 Ga0070673_100110532
377 Ga0070673_100390377
378 Ga0070673_101687029
379 Ga0070659_100000119
380 Ga0070659_100026815
381 Ga0070659_100032312
382 Ga0070659_100190876
383 Ga0070663_100009839
384 Ga0070678_100008303
385 Ga0070662_100000365
386 Ga0070662_100155731
387 Ga0070681_10009723
388 Ga0070681_10413609
389 Ga0068867_100000655
390 Ga0070679_100079699
391 Ga0070684_100147896
392 Ga0070684_100175008
393 Ga0068853_100014799
394 Ga0068853_100057210
395 Ga0068853_100136654
396 Ga0068853_100272441
397 Ga0068853_100930672
398 Ga0070672_100463879
399 Ga0070665_100000147
400 Ga0068855_100000195
401 Ga0068855_100000302
402 Ga0068855_100012251
403 Ga0068855_100081865
404 Ga0068855_100139197
405 Ga0068855_101487765
406 Ga0068855_101644081
407 Ga0070664_100173458
408 Ga0068857_100085992
409 Ga0068856_100000031
410 Ga0068856_100121372
411 Ga0068856_100343810
412 Ga0068856_100859935
413 Ga0068852_100002945
414 Ga0068852_100246058
415 Ga0068852_100309892
416 Ga0068852_100744283
417 Ga0068859_100039224
418 Ga0068866_10382922
419 Ga0068870_10041212
420 Ga0075366_10159597
421 Ga0097621_100000551
422 Ga0097621_100046436
423 Ga0068871_100000072
424 Ga0068871_101366278
425 Ga0068865_100201746
426 Ga0097620_100039223
427 Ga0105244_10019715
428 Ga0105240_10012512
429 Ga0105240_10036460
430 Ga0105240_10120180
431 Ga0105240_10185636
432 Ga0105240_10197235
433 Ga0105240_10267477
434 Ga0105240_10305160
435 Ga0105245_10253544
436 Ga0105241_10005349
437 Ga0105241_10018464
438 Ga0105241_10060734
439 Ga0105241_10424649
440 Ga0105242_10013868
441 Ga0105237_10001788
442 Ga0105237_10005179
443 Ga0105237_10088230
444 Ga0105237_10135812
445 Ga0105238_10006932
446 Ga0105239_10000011
447 Ga0105239_10000440
448 Ga0105239_10010926
449 Ga0105239_10036952
450 Ga0105239_10161979
451 Ga0105239_10357088
452 Ga0105239_11680208
453 Ga0105246_10217701
454 Ga0157373_10000069
455 Ga0157373_10000464
456 Ga0157373_10009325
457 Ga0157373_10015773
458 Ga0157373_10023465
459 Ga0157373_10077725
460 Ga0157373_11460912
461 Ga0157371_10000178
462 Ga0157371_10000749
463 Ga0157371_10004325
464 Ga0157371_10035647
465 Ga0157371_10043809
466 Ga0157371_10107085
467 Ga0157370_10000332
468 Ga0157370_10002241
469 Ga0157370_10276290
470 Ga0157370_10555484
471 Ga0157369_10058564
472 Ga0157369_10079952
473 Ga0157369_10201286
474 Ga0157369_10754529
475 Ga0157374_10001224
476 Ga0157374_10002996
477 Ga0157374_10009934
478 Ga0157378_10005725
479 Ga0157378_10020232
480 Ga0157378_10033534
481 Ga0157378_10271234
482 Ga0163162_10000049
483 Ga0163162_10000088
484 Ga0163162_10020392
485 Ga0157372_10000009
486 Ga0157372_10001047
487 Ga0157372_10004867
488 Ga0157372_10005594
489 Ga0157372_10016245
490 Ga0157372_10067463
491 Ga0157372_10279016
492 Ga0157372_10322000
493 Ga0157372_10474014
494 Ga0157375_10016597
495 Ga0157375_10444789
496 Ga0157375_10618412
497 Ga0182008_10000009
498 Ga0157376_10679736
499 Ga0157376_10942598
500 Ga0182006_1000267
501 Ga0206351_10663275
502 Ga0206352_10358190
503 Ga0206352_10988754
504 Ga0209437_100024
505 Ga0209026_1001737
506 Ga0209026_1002014
507 Ga0209026_1003257
508 Ga0209129_1017332
509 Ga0209233_1001432
510 Ga0209233_1014938
511 Ga0209233_1021922
512 Ga0209455_1006228
513 Ga0207642_10533440
514 Ga0207647_10000043
515 Ga0207647_10000258
516 Ga0207647_10271901
517 Ga0207647_10657390
518 Ga0207645_10001730
519 Ga0207643_10090744
520 Ga0207705_10000032
521 Ga0207705_10049382
522 Ga0207705_10209693
523 Ga0207654_10001469
524 Ga0207707_10018394
525 Ga0207707_10331732
526 Ga0207695_10007657
527 Ga0207695_10009204
528 Ga0207695_10020429
529 Ga0207695_10035695
530 Ga0207695_10132947
531 Ga0207695_10216014
532 Ga0207671_10003472
533 Ga0207671_10024184
534 Ga0207660_10013970
535 Ga0207657_10308624
536 Ga0207652_10023991
537 Ga0207694_10076480
538 Ga0207644_10031458
539 Ga0207644_10213182
540 Ga0207690_10000465
541 Ga0207690_10103727
542 Ga0207690_10158043
543 Ga0207690_10186978
544 Ga0207706_10000779
545 Ga0207706_10162681
546 Ga0207686_10051727
547 Ga0207669_10084844
548 Ga0207704_10000220
549 Ga0207704_10628816
550 Ga0207661_10045479
551 Ga0207679_10080129
552 Ga0207667_10000046
553 Ga0207667_10003734
554 Ga0207667_10006175
555 Ga0207667_10357617
556 Ga0207667_10564819
557 Ga0207667_10646576
558 Ga0207667_10996113
559 Ga0207651_10137912
560 Ga0207651_10196140
561 Ga0207677_10087990
562 Ga0207677_11348647
563 Ga0207639_10033641
564 Ga0207639_10071280
565 Ga0207639_10618283
566 Ga0207639_11043194
567 Ga0207678_10023973
568 Ga0207702_10000071
569 Ga0207702_10029223
570 Ga0207702_10298366
571 Ga0207648_10001785
572 Ga0207683_10045741
573 Ga0207698_10228538
574 Ga0207698_10585786
575 Ga0268266_10000030
576 Ga0307517_10007033
577 Ga0265338_10085339
578 Ga0307512_10421637
579 Ga0265327_10033017
580 Ga0307414_10000131
581 Ga0307414_10001835
582 Ga0307510_10003615
583 Ga0395899_0000121
584 Ga0395899_0000220
585 Ga0395899_0001386
586 Ga0395900_0000115
587 Ga0395898_0038613
588 Ga0395905_0000045
589 Ga0395905_1169257
590 Ga0395901_0000706
591 Ga0395901_0075895
592 Ga0395901_0714074
593 Ga0436361_0831474
594 Ga0439439_0128357
595 Ga0451835_0709782
596 Ga0466969_0042927
597 Ga0466966_0055511
598 Ga0466966_0231418
599 Ga0466961_0320469
600 Ga0466957_0551125
601 Ga0466959_0099372
602 Ga0466958_0312507
603 Ga0495650_0000036
604 Ga0495585_0161586
605 Ga0495596_0017324
606 Ga0495583_0347773
607 Ga0495606_0000143
608 Ga0495610_0001747
609 Ga0495616_0008524
610 Ga0495616_0050300
611 Ga0495631_0058400
612 Ga0495648_0010424
613 Ga0495648_0011643
614 Ga0495609_0003634
615 Ga0495645_0450462
616 Ga0495622_0204664
617 Ga0495633_0024395
618 Ga0495668_0000011
619 Ga0495625_0000009
620 Ga0495625_0076019
621 Ga0495625_0524435
622 Ga0495661_0016299
623 Ga0495613_0540458
624 Ga0495649_0000008
625 Ga0495660_0023770
626 Ga0495660_0213434
627 Ga0495683_0002545
628 Ga0495687_001322
629 Ga0495687_005561
630 Ga0495686_0032626
631 Ga0495686_0106449
632 Ga0495686_0147455
633 Ga0495686_0178981
634 nmdc:mga0k408_152950_c1
635 Ga0500635_0002823
636 Ga0500650_0170417
637 Ga0500608_000600
638 Ga0500608_018680
639 Ga0500608_025980
640 Ga0500642_0163788
641 2599478099
642 2819549357
643 2928147481
644 2932083592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13899

Thioredoxin_7

Thioredoxin-like

18

113

0.85

PF03190

Thioredox_DsbH

Protein of unknown function, DUF255

14

147

0.82

PF13098

Thioredoxin_2

Thioredoxin-like domain

30

136

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ju5-assembly1.cif.gz_A dsbh oxidoreductase 0.9367 14 142
3d21-assembly2.cif.gz_B crystal structure of a poplar wild-type thioredoxin h, pttrxh4 0.8264 22 141
1f6m-assembly1.cif.gz_C crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+ 0.8101 34 139
2lst-assembly1.cif.gz_A solution structure of a thioredoxin from thermus thermophilus 0.8056 15 141
1ep8-assembly2.cif.gz_B crystal structure of a mutated thioredoxin, d30a, from chlamydomonas reinhardtii 0.8038 22 142
ID Description Score Start End Superfamily
2ju5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9403 16 142 3.40.30.10
2ju5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9188 16 142 3.40.30.10
af_A0A1D6DU17_178_289_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.896 19 137 3.40.30.10
af_Q55BU7_148_259_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8959 21 144 3.40.30.10
af_O14048_160_269_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8925 21 144 3.40.30.10
ID Description Score Start End GO Terms
AF-A6E9E7-F1-model_v4 Putative thioredoxin disulfide isomerase 0.994 21 144 GO:0016853
AF-A0A519NYK3-F1-model_v4 deleted 0.9853 48 127
AF-A0A848ZKZ1-F1-model_v4 Thioredoxin family protein 0.9767 10 141
AF-A0A4Q5UVH3-F1-model_v4 Thioredoxin family protein 0.9753 37 143
AF-A0A4Q1BXV8-F1-model_v4 Thioredoxin family protein 0.9743 7 139

Map