F406405

General Info

Members Datasets Scaffolds Average Seq Length
322 138 644 250

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10065960|Ga0075433_100659603
Length 256
Sequence MTIDALILSSVVAVAAGLIGCFAVMRRMALAADALSHVALPGIGVALALHVHPVFGAAAMLFFGGILVWALEDRSRLATETIIGVIFSAALAIGSVITSGDDLIEALFGGASGRPSALEAGFGLVASIAVTVFVLRRKRALVVALVSPDIARTIGIDVRRLNLLYIQMFALTVALGLRYLGVLLMGSLIIIPAATAKRVSRNLNEMLMMAALIAIAVTVTGSVLAGYLHRPTGPLIVAVAALGFFLTFLRRDPATL

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
47 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
48 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
49 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
50 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
51 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
52 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
53 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
62 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
75 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
76 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.11
Rhizosphere 95.96
Stem 0
Stem Tuber 0
Unclassified 9.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10065960 3300006852 Bacteria 3175
2 JGI24751J29686_10001591 3300002459 Bacteria 4691
3 Ga0065715_10103642 3300005293 Bacteria 3010
4 Ga0070670_100118921 3300005331 Bacteria 2279
5 Ga0070670_100160739 3300005331 Bacteria 1947
6 Ga0070680_100228214 3300005336 Bacteria 1572
7 Ga0070660_100007747 3300005339 Bacteria 7490
8 Ga0070659_100142278 3300005366 Bacteria 1953
9 Ga0070711_100154055 3300005439 Bacteria 1736
10 Ga0070708_100061232 3300005445 Bacteria 3362
11 Ga0070681_10009079 3300005458 Bacteria 9773
12 Ga0070681_10081272 3300005458 Bacteria 3197
13 Ga0070681_10341519 3300005458 Bacteria 1407
14 Ga0070706_100220321 3300005467 Bacteria 1771
15 Ga0070698_100299331 3300005471 Bacteria 1539
16 Ga0070679_100056522 3300005530 Bacteria 3910
17 Ga0070684_100107728 3300005535 Bacteria 2496
18 Ga0070684_100275399 3300005535 Unclassified 1541
19 Ga0068855_100001043 3300005563 Bacteria 34431
20 Ga0068855_100280232 3300005563 Bacteria 1851
21 Ga0068855_100455636 3300005563 Unclassified 1395
22 Ga0068854_100090433 3300005578 Bacteria 2276
23 Ga0068864_100013689 3300005618 Bacteria 6726
24 Ga0068858_100340445 3300005842 Bacteria 1435
25 Ga0068862_100813656 3300005844 Unclassified 913
26 Ga0068862_100948271 3300005844 Bacteria 848
27 Ga0070717_10758381 3300006028 Unclassified 882
28 Ga0097621_100092050 3300006237 Unclassified 2539
29 Ga0075434_100070310 3300006871 Bacteria 3491
30 Ga0075434_100096210 3300006871 Bacteria 2966
31 Ga0075435_100102938 3300007076 Bacteria 2367
32 Ga0099794_10203605 3300007265 Unclassified 1014
33 Ga0105240_10009124 3300009093 Bacteria 14079
34 Ga0105240_10031346 3300009093 Bacteria 6897
35 Ga0114129_10012375 3300009147 Bacteria 12146
36 Ga0114129_10076617 3300009147 Bacteria 4655
37 Ga0105248_10038561 3300009177 Bacteria 5348
38 Ga0105248_10210755 3300009177 Bacteria 2189
39 Ga0105248_10462538 3300009177 Bacteria 1430
40 Ga0105239_10658261 3300010375 Bacteria 1196
41 Ga0157370_10017665 3300013104 Bacteria 7191
42 Ga0157369_10047908 3300013105 Bacteria 4639
43 Ga0163162_10140646 3300013306 Bacteria 2527
44 Ga0157372_10169331 3300013307 Unclassified 2527
45 Ga0163163_10000003 3300014325 Bacteria 455102
46 Ga0207707_10060346 3300025912 Bacteria 3299
47 Ga0207695_10004966 3300025913 Bacteria 17909
48 Ga0207695_10257670 3300025913 Bacteria 1643
49 Ga0207695_10258541 3300025913 Bacteria 1639
50 Ga0207671_10509404 3300025914 Bacteria 959
51 Ga0207663_10193698 3300025916 Bacteria 1461
52 Ga0207657_10062854 3300025919 Bacteria 3177
53 Ga0207649_10197160 3300025920 Unclassified 1420
54 Ga0207650_10125492 3300025925 Bacteria 2003
55 Ga0207650_10125577 3300025925 Bacteria 2003
56 Ga0207711_10052415 3300025941 Bacteria 3496
57 Ga0207667_10027743 3300025949 Bacteria 6159
58 Ga0207667_10048787 3300025949 Bacteria 4476
59 Ga0207703_10039394 3300026035 Bacteria 3777
60 Ga0207676_10068700 3300026095 Bacteria 2835
61 Ga0268265_10725091 3300028380 Bacteria 963
62 Ga0265337_1010253 3300028556 Bacteria 3294
63 Ga0265337_1010864 3300028556 Bacteria 3166
64 Ga0265337_1037188 3300028556 Bacteria 1417
65 Ga0265326_10010950 3300028558 Unclassified 2684
66 Ga0265326_10050641 3300028558 Unclassified 1176
67 Ga0265319_1032167 3300028563 Bacteria 1821
68 Ga0265319_1033206 3300028563 Bacteria 1784
69 Ga0265334_10048303 3300028573 Bacteria 1639
70 Ga0265318_10000028 3300028577 Bacteria 149330
71 Ga0265318_10000249 3300028577 Bacteria 46904
72 Ga0265318_10001658 3300028577 Bacteria 12795
73 Ga0265318_10008917 3300028577 Bacteria 4441
74 Ga0265323_10003969 3300028653 Bacteria 6423
75 Ga0265322_10021164 3300028654 Bacteria 1863
76 Ga0265336_10008710 3300028666 Unclassified 3540
77 Ga0265338_10007526 3300028800 Bacteria 13472
78 Ga0265338_10109214 3300028800 Bacteria 2232
79 Ga0265338_10154325 3300028800 Unclassified 1780
80 Ga0265324_10000156 3300029957 Bacteria 52501
81 Ga0265324_10000254 3300029957 Bacteria 39595
82 Ga0265324_10036026 3300029957 Archaea 1721
83 Ga0265324_10056845 3300029957 Bacteria 1340
84 Ga0265330_10000021 3300031235 Bacteria 154495
85 Ga0265330_10000628 3300031235 Bacteria 22815
86 Ga0265330_10001293 3300031235 Bacteria 14644
87 Ga0265330_10001421 3300031235 Bacteria 13999
88 Ga0265330_10002008 3300031235 Bacteria 11286
89 Ga0265330_10005798 3300031235 Bacteria 6130
90 Ga0265330_10006959 3300031235 Bacteria 5554
91 Ga0265330_10010600 3300031235 Bacteria 4339
92 Ga0265330_10039030 3300031235 Bacteria 2110
93 Ga0265332_10000109 3300031238 Bacteria 70186
94 Ga0265332_10001503 3300031238 Bacteria 12964
95 Ga0265328_10001066 3300031239 Bacteria 12644
96 Ga0265328_10003491 3300031239 Bacteria 6937
97 Ga0265328_10003897 3300031239 Bacteria 6563
98 Ga0265320_10000033 3300031240 Bacteria 141362
99 Ga0265320_10005628 3300031240 Bacteria 8005
100 Ga0265320_10014838 3300031240 Bacteria 4419
101 Ga0265320_10057487 3300031240 Bacteria 1866
102 Ga0265325_10013591 3300031241 Bacteria 4629
103 Ga0265325_10031923 3300031241 Archaea 2815
104 Ga0265325_10034180 3300031241 Bacteria 2707
105 Ga0265329_10000118 3300031242 Bacteria 37207
106 Ga0265329_10001358 3300031242 Bacteria 11868
107 Ga0265329_10003042 3300031242 Bacteria 7441
108 Ga0265329_10039777 3300031242 Bacteria 1510
109 Ga0265329_10044885 3300031242 Unclassified 1413
110 Ga0265329_10048466 3300031242 Bacteria 1355
111 Ga0265340_10000855 3300031247 Bacteria 17304
112 Ga0265339_10000044 3300031249 Bacteria 116396
113 Ga0265339_10024018 3300031249 Bacteria 3518
114 Ga0265339_10031964 3300031249 Bacteria 2971
115 Ga0265331_10000077 3300031250 Bacteria 145529
116 Ga0265331_10002792 3300031250 Bacteria 11584
117 Ga0265316_10000079 3300031344 Bacteria 101016
118 Ga0265316_10002816 3300031344 Bacteria 17792
119 Ga0265316_10002890 3300031344 Bacteria 17559
120 Ga0265316_10004205 3300031344 Bacteria 14389
121 Ga0265316_10008506 3300031344 Bacteria 9517
122 Ga0265316_10009616 3300031344 Bacteria 8884
123 Ga0265316_10012097 3300031344 Bacteria 7750
124 Ga0265316_10030484 3300031344 Bacteria 4420
125 Ga0265316_10057415 3300031344 Bacteria 3035
126 Ga0265316_10132197 3300031344 Bacteria 1879
127 Ga0307509_10271966 3300031507 Bacteria 1461
128 Ga0307408_100062505 3300031548 Bacteria 2721
129 Ga0265313_10000025 3300031595 Bacteria 136925
130 Ga0265313_10002060 3300031595 Bacteria 18029
131 Ga0265313_10007350 3300031595 Bacteria 7549
132 Ga0265313_10008720 3300031595 Bacteria 6696
133 Ga0265313_10027534 3300031595 Bacteria 2973
134 Ga0265313_10027729 3300031595 Bacteria 2960
135 Ga0265313_10099970 3300031595 Bacteria 1288
136 Ga0265314_10000038 3300031711 Bacteria 224533
137 Ga0265314_10000092 3300031711 Bacteria 136898
138 Ga0265314_10000832 3300031711 Bacteria 36591
139 Ga0265314_10008136 3300031711 Bacteria 9024
140 Ga0265314_10010216 3300031711 Bacteria 7853
141 Ga0265314_10023838 3300031711 Unclassified 4654
142 Ga0265314_10065179 3300031711 Unclassified 2462
143 Ga0265314_10110399 3300031711 Bacteria 1749
144 Ga0265342_10000660 3300031712 Bacteria 35953
145 Ga0265342_10000952 3300031712 Bacteria 28815
146 Ga0265342_10001046 3300031712 Bacteria 27124
147 Ga0265342_10001484 3300031712 Bacteria 21762
148 Ga0265342_10003444 3300031712 Bacteria 12986
149 Ga0265342_10004340 3300031712 Bacteria 11219
150 Ga0265342_10004944 3300031712 Bacteria 10291
151 Ga0265342_10007023 3300031712 Bacteria 8307
152 Ga0265342_10010687 3300031712 Bacteria 6342
153 Ga0265342_10021152 3300031712 Bacteria 4159
154 Ga0265342_10066645 3300031712 Bacteria 2108
155 Ga0265342_10075298 3300031712 Bacteria 1959
156 Ga0307412_10071667 3300031911 Bacteria 2366
157 Ga0307409_100176778 3300031995 Bacteria 1885
158 Ga0373934_0000144 3300035086 Bacteria 26016
159 Ga0373954_0007172 3300035118 Bacteria 4867
160 Ga0373957_0051188 3300035120 Bacteria 1580
161 Ga0373955_0002231 3300035172 Bacteria 8413
162 Ga0373935_0696442 3300035692 Bacteria 747
163 Ga0373947_0108699 3300035725 Bacteria 1750
164 Ga0373937_0000428 3300036401 Bacteria 39151
165 Ga0373937_0016424 3300036401 Bacteria 6575
166 Ga0373937_0223905 3300036401 Bacteria 1771
167 Ga0373925_0490552 3300037068 Bacteria 1008
168 Ga0436365_0098838 3300039437 Bacteria 2070
169 Ga0436365_0498874 3300039437 Bacteria 1284
170 Ga0436361_0019133 3300039447 Bacteria 1882
171 Ga0436362_0761161 3300039453 Bacteria 1043
172 Ga0451577_0117857 3300042876 Bacteria 2378
173 Ga0451577_0215617 3300042876 Bacteria 1734
174 Ga0453683_0013371 3300044673 Bacteria 5362
175 Ga0453683_0092521 3300044673 Bacteria 1896
176 Ga0495592_0094239 3300046454 Bacteria 2143
177 Ga0495651_0116424 3300046462 Bacteria 1969
178 Ga0495599_0053141 3300046678 Bacteria 2538
179 Ga0495613_0397235 3300046689 Bacteria 941
180 Ga0495602_0126988 3300048088 Bacteria 2041
181 Ga0496101_0520364 3300048904 Unclassified 940
182 Ga0496104_0111095 3300048907 Bacteria 2628
183 Ga0496109_0607161 3300048912 Bacteria 1030
184 Ga0496109_0696728 3300048912 Bacteria 953
185 Ga0496110_0140168 3300048913 Unclassified 2186
186 Ga0496110_0252293 3300048913 Bacteria 1606
187 Ga0496111_0260327 3300048914 Unclassified 1287
188 Ga0496112_0079639 3300048915 Bacteria 3241
189 Ga0496113_0518498 3300048916 Unclassified 957
190 Ga0496114_0190199 3300048917 Bacteria 1796
191 Ga0501031_0002237 3300049568 Bacteria 12239
192 Ga0501031_0137354 3300049568 Bacteria 1597
193 Ga0501032_0031508 3300049569 Bacteria 3635
194 Ga0501032_0167079 3300049569 Bacteria 1443
195 Ga0501033_0002992 3300049570 Bacteria 14116
196 Ga0501033_0007137 3300049570 Bacteria 8718
197 Ga0501034_0009030 3300049571 Bacteria 10466
198 Ga0501034_0040914 3300049571 Bacteria 4689
199 Ga0501034_0049642 3300049571 Bacteria 4233
200 Ga0501034_0084568 3300049571 Bacteria 3174
201 Ga0501034_0173179 3300049571 Bacteria 2124
202 Ga0501036_0009529 3300049572 Bacteria 7988
203 Ga0501036_0013353 3300049572 Bacteria 6822
204 Ga0501036_0044427 3300049572 Bacteria 3763
205 Ga0501036_0090911 3300049572 Bacteria 2578
206 Ga0501036_0289122 3300049572 Bacteria 1371
207 Ga0501037_0025034 3300049573 Bacteria 4411
208 Ga0501037_0052431 3300049573 Bacteria 2983
209 Ga0501037_0156275 3300049573 Bacteria 1627
210 Ga0501038_0007135 3300049574 Bacteria 10324
211 Ga0501038_0048901 3300049574 Bacteria 3658
212 Ga0501038_0050627 3300049574 Bacteria 3588
213 Ga0501038_0153313 3300049574 Bacteria 1877
214 Ga0501038_0183805 3300049574 Bacteria 1685
215 Ga0501038_0387049 3300049574 Unclassified 1084
216 Ga0501039_0012558 3300049575 Bacteria 6470
217 Ga0501039_0016500 3300049575 Bacteria 5657
218 Ga0501039_0038093 3300049575 Unclassified 3714
219 Ga0501039_0147087 3300049575 Bacteria 1851
220 Ga0501039_0364435 3300049575 Bacteria 1135
221 Ga0501040_0009651 3300049576 Bacteria 6302
222 Ga0501040_0023052 3300049576 Unclassified 4172
223 Ga0501040_0410543 3300049576 Bacteria 973
224 Ga0501042_0002398 3300049578 Bacteria 11485
225 Ga0501042_0057808 3300049578 Bacteria 2767
226 Ga0501042_0067863 3300049578 Bacteria 2550
227 Ga0501043_0000314 3300049579 Bacteria 43887
228 Ga0501043_0014106 3300049579 Bacteria 6251
229 Ga0501043_0019114 3300049579 Bacteria 5378
230 Ga0501043_0021374 3300049579 Bacteria 5072
231 Ga0501043_0031274 3300049579 Bacteria 4185
232 Ga0501046_0007465 3300049580 Bacteria 9606
233 Ga0501046_0022359 3300049580 Bacteria 5209
234 Ga0501046_0066923 3300049580 Bacteria 2798
235 Ga0501046_0102554 3300049580 Bacteria 2193
236 Ga0501046_0115173 3300049580 Unclassified 2050
237 Ga0501046_0437819 3300049580 Unclassified 941
238 Ga0501047_0001063 3300049581 Bacteria 27406
239 Ga0501047_0003087 3300049581 Bacteria 15799
240 Ga0501047_0013666 3300049581 Bacteria 7706
241 Ga0501047_0022378 3300049581 Bacteria 6070
242 Ga0501047_0136864 3300049581 Bacteria 2329
243 Ga0501047_0212088 3300049581 Bacteria 1794
244 Ga0501048_0003908 3300049582 Bacteria 11320
245 Ga0501048_0007253 3300049582 Bacteria 8407
246 Ga0501048_0019899 3300049582 Bacteria 4921
247 Ga0501048_0026168 3300049582 Unclassified 4248
248 Ga0501067_0001488 3300049583 Bacteria 12750
249 Ga0501067_0002725 3300049583 Bacteria 9717
250 Ga0501067_0010123 3300049583 Bacteria 5216
251 Ga0501067_0024317 3300049583 Bacteria 3360
252 Ga0501067_0051473 3300049583 Bacteria 2283
253 Ga0501067_0224349 3300049583 Bacteria 1046
254 Ga0501067_0235018 3300049583 Unclassified 1020
255 Ga0501068_0001641 3300049584 Bacteria 11950
256 Ga0501068_0003527 3300049584 Bacteria 8453
257 Ga0501069_0001883 3300049585 Bacteria 10477
258 Ga0501069_0015410 3300049585 Bacteria 4096
259 Ga0501069_0213354 3300049585 Unclassified 1120
260 Ga0501070_0060414 3300049586 Bacteria 3141
261 Ga0501070_0160482 3300049586 Bacteria 1853
262 Ga0501071_0002655 3300049587 Bacteria 10948
263 Ga0501071_0232813 3300049587 Bacteria 1388
264 Ga0501072_0021161 3300049588 Bacteria 5046
265 Ga0501072_0077132 3300049588 Bacteria 2638
266 Ga0501072_0079745 3300049588 Bacteria 2593
267 Ga0501072_0095041 3300049588 Bacteria 2368
268 Ga0501073_0007710 3300049589 Bacteria 7988
269 Ga0501073_0016293 3300049589 Bacteria 5385
270 Ga0501073_0034435 3300049589 Bacteria 3604
271 Ga0501073_0215803 3300049589 Bacteria 1326
272 Ga0501074_0028550 3300049590 Bacteria 4043
273 Ga0501075_0009492 3300049591 Bacteria 6809
274 Ga0501076_0075610 3300049592 Unclassified 2700
275 Ga0501076_0078372 3300049592 Unclassified 2652
276 Ga0501076_0098037 3300049592 Bacteria 2361
277 Ga0501077_0020411 3300049593 Bacteria 4194
278 Ga0501077_0057292 3300049593 Bacteria 2474
279 Ga0501079_0003339 3300049741 Bacteria 11771
280 Ga0501079_0044033 3300049741 Bacteria 3445
281 Ga0501079_0194640 3300049741 Bacteria 1583
282 Ga0501080_0007068 3300049742 Bacteria 10136
283 Ga0501080_0020401 3300049742 Bacteria 6134
284 Ga0501080_0047070 3300049742 Bacteria 4014
285 Ga0501080_0151074 3300049742 Bacteria 2146
286 Ga0501080_0166521 3300049742 Bacteria 2033
287 Ga0501080_0201640 3300049742 Bacteria 1826
288 Ga0501081_0020808 3300049743 Unclassified 4376
289 Ga0501081_0075891 3300049743 Unclassified 2347
290 Ga0501083_0004931 3300049744 Bacteria 9444
291 Ga0501083_0146459 3300049744 Bacteria 1546
292 Ga0501035_0000755 3300049822 Bacteria 34825
293 Ga0501035_0025953 3300049822 Bacteria 5367
294 Ga0501035_0043884 3300049822 Bacteria 4028
295 Ga0501035_0077546 3300049822 Bacteria 2936
296 Ga0501035_0138447 3300049822 Bacteria 2117
297 Ga0501044_0023691 3300049823 Bacteria 6528
298 Ga0501044_0080939 3300049823 Bacteria 3289
299 Ga0501044_0158733 3300049823 Bacteria 2239
300 Ga0501044_0161134 3300049823 Bacteria 2220
301 Ga0501044_0383493 3300049823 Bacteria 1320
302 Ga0501045_0003446 3300049824 Bacteria 10824
303 Ga0501045_0093072 3300049824 Bacteria 2229
304 nmdc:mga05p37_44444_c1 3300050507 Bacteria 5465
305 nmdc:mga05p37_76112_c1 3300050507 Bacteria 4132
306 nmdc:mga0n895_115566_c1 3300050512 Bacteria 2702
307 nmdc:mga0n895_174700_c1 3300050512 Bacteria 2179
308 nmdc:mga0n895_552636_c1 3300050512 Bacteria 1157
309 nmdc:mga0a205_21041_c1 3300050515 Bacteria 6167
310 nmdc:mga0a205_658068_c1 3300050515 Bacteria 899
311 Ga0495601_0187239 3300053077 Unclassified 1353
312 Ga0495595_0158181 3300053084 Bacteria 1117
313 Ga0501084_0001998 3300054114 Bacteria 16290
314 Ga0501084_0058877 3300054114 Bacteria 3215
315 Ga0501084_0080934 3300054114 Bacteria 2723
316 Ga0501084_0111047 3300054114 Bacteria 2304
317 Ga0501084_0275185 3300054114 Bacteria 1421
318 Ga0501082_0006679 3300060353 Bacteria 9981
319 Ga0501082_0035859 3300060353 Bacteria 4274
320 Ga0501082_0072594 3300060353 Bacteria 2964
321 Ga0530510_0000763 3300061734 Bacteria 20916
322 Ga0530510_0466234 3300061734 Bacteria 956
323 Ga0075433_10065960
324 JGI24751J29686_10001591
325 Ga0065715_10103642
326 Ga0070670_100118921
327 Ga0070670_100160739
328 Ga0070680_100228214
329 Ga0070660_100007747
330 Ga0070659_100142278
331 Ga0070711_100154055
332 Ga0070708_100061232
333 Ga0070681_10009079
334 Ga0070681_10081272
335 Ga0070681_10341519
336 Ga0070706_100220321
337 Ga0070698_100299331
338 Ga0070679_100056522
339 Ga0070684_100107728
340 Ga0070684_100275399
341 Ga0068855_100001043
342 Ga0068855_100280232
343 Ga0068855_100455636
344 Ga0068854_100090433
345 Ga0068864_100013689
346 Ga0068858_100340445
347 Ga0068862_100813656
348 Ga0068862_100948271
349 Ga0070717_10758381
350 Ga0097621_100092050
351 Ga0075434_100070310
352 Ga0075434_100096210
353 Ga0075435_100102938
354 Ga0099794_10203605
355 Ga0105240_10009124
356 Ga0105240_10031346
357 Ga0114129_10012375
358 Ga0114129_10076617
359 Ga0105248_10038561
360 Ga0105248_10210755
361 Ga0105248_10462538
362 Ga0105239_10658261
363 Ga0157370_10017665
364 Ga0157369_10047908
365 Ga0163162_10140646
366 Ga0157372_10169331
367 Ga0163163_10000003
368 Ga0207707_10060346
369 Ga0207695_10004966
370 Ga0207695_10257670
371 Ga0207695_10258541
372 Ga0207671_10509404
373 Ga0207663_10193698
374 Ga0207657_10062854
375 Ga0207649_10197160
376 Ga0207650_10125492
377 Ga0207650_10125577
378 Ga0207711_10052415
379 Ga0207667_10027743
380 Ga0207667_10048787
381 Ga0207703_10039394
382 Ga0207676_10068700
383 Ga0268265_10725091
384 Ga0265337_1010253
385 Ga0265337_1010864
386 Ga0265337_1037188
387 Ga0265326_10010950
388 Ga0265326_10050641
389 Ga0265319_1032167
390 Ga0265319_1033206
391 Ga0265334_10048303
392 Ga0265318_10000028
393 Ga0265318_10000249
394 Ga0265318_10001658
395 Ga0265318_10008917
396 Ga0265323_10003969
397 Ga0265322_10021164
398 Ga0265336_10008710
399 Ga0265338_10007526
400 Ga0265338_10109214
401 Ga0265338_10154325
402 Ga0265324_10000156
403 Ga0265324_10000254
404 Ga0265324_10036026
405 Ga0265324_10056845
406 Ga0265330_10000021
407 Ga0265330_10000628
408 Ga0265330_10001293
409 Ga0265330_10001421
410 Ga0265330_10002008
411 Ga0265330_10005798
412 Ga0265330_10006959
413 Ga0265330_10010600
414 Ga0265330_10039030
415 Ga0265332_10000109
416 Ga0265332_10001503
417 Ga0265328_10001066
418 Ga0265328_10003491
419 Ga0265328_10003897
420 Ga0265320_10000033
421 Ga0265320_10005628
422 Ga0265320_10014838
423 Ga0265320_10057487
424 Ga0265325_10013591
425 Ga0265325_10031923
426 Ga0265325_10034180
427 Ga0265329_10000118
428 Ga0265329_10001358
429 Ga0265329_10003042
430 Ga0265329_10039777
431 Ga0265329_10044885
432 Ga0265329_10048466
433 Ga0265340_10000855
434 Ga0265339_10000044
435 Ga0265339_10024018
436 Ga0265339_10031964
437 Ga0265331_10000077
438 Ga0265331_10002792
439 Ga0265316_10000079
440 Ga0265316_10002816
441 Ga0265316_10002890
442 Ga0265316_10004205
443 Ga0265316_10008506
444 Ga0265316_10009616
445 Ga0265316_10012097
446 Ga0265316_10030484
447 Ga0265316_10057415
448 Ga0265316_10132197
449 Ga0307509_10271966
450 Ga0307408_100062505
451 Ga0265313_10000025
452 Ga0265313_10002060
453 Ga0265313_10007350
454 Ga0265313_10008720
455 Ga0265313_10027534
456 Ga0265313_10027729
457 Ga0265313_10099970
458 Ga0265314_10000038
459 Ga0265314_10000092
460 Ga0265314_10000832
461 Ga0265314_10008136
462 Ga0265314_10010216
463 Ga0265314_10023838
464 Ga0265314_10065179
465 Ga0265314_10110399
466 Ga0265342_10000660
467 Ga0265342_10000952
468 Ga0265342_10001046
469 Ga0265342_10001484
470 Ga0265342_10003444
471 Ga0265342_10004340
472 Ga0265342_10004944
473 Ga0265342_10007023
474 Ga0265342_10010687
475 Ga0265342_10021152
476 Ga0265342_10066645
477 Ga0265342_10075298
478 Ga0307412_10071667
479 Ga0307409_100176778
480 Ga0373934_0000144
481 Ga0373954_0007172
482 Ga0373957_0051188
483 Ga0373955_0002231
484 Ga0373935_0696442
485 Ga0373947_0108699
486 Ga0373937_0000428
487 Ga0373937_0016424
488 Ga0373937_0223905
489 Ga0373925_0490552
490 Ga0436365_0098838
491 Ga0436365_0498874
492 Ga0436361_0019133
493 Ga0436362_0761161
494 Ga0451577_0117857
495 Ga0451577_0215617
496 Ga0453683_0013371
497 Ga0453683_0092521
498 Ga0495592_0094239
499 Ga0495651_0116424
500 Ga0495599_0053141
501 Ga0495613_0397235
502 Ga0495602_0126988
503 Ga0496101_0520364
504 Ga0496104_0111095
505 Ga0496109_0607161
506 Ga0496109_0696728
507 Ga0496110_0140168
508 Ga0496110_0252293
509 Ga0496111_0260327
510 Ga0496112_0079639
511 Ga0496113_0518498
512 Ga0496114_0190199
513 Ga0501031_0002237
514 Ga0501031_0137354
515 Ga0501032_0031508
516 Ga0501032_0167079
517 Ga0501033_0002992
518 Ga0501033_0007137
519 Ga0501034_0009030
520 Ga0501034_0040914
521 Ga0501034_0049642
522 Ga0501034_0084568
523 Ga0501034_0173179
524 Ga0501036_0009529
525 Ga0501036_0013353
526 Ga0501036_0044427
527 Ga0501036_0090911
528 Ga0501036_0289122
529 Ga0501037_0025034
530 Ga0501037_0052431
531 Ga0501037_0156275
532 Ga0501038_0007135
533 Ga0501038_0048901
534 Ga0501038_0050627
535 Ga0501038_0153313
536 Ga0501038_0183805
537 Ga0501038_0387049
538 Ga0501039_0012558
539 Ga0501039_0016500
540 Ga0501039_0038093
541 Ga0501039_0147087
542 Ga0501039_0364435
543 Ga0501040_0009651
544 Ga0501040_0023052
545 Ga0501040_0410543
546 Ga0501042_0002398
547 Ga0501042_0057808
548 Ga0501042_0067863
549 Ga0501043_0000314
550 Ga0501043_0014106
551 Ga0501043_0019114
552 Ga0501043_0021374
553 Ga0501043_0031274
554 Ga0501046_0007465
555 Ga0501046_0022359
556 Ga0501046_0066923
557 Ga0501046_0102554
558 Ga0501046_0115173
559 Ga0501046_0437819
560 Ga0501047_0001063
561 Ga0501047_0003087
562 Ga0501047_0013666
563 Ga0501047_0022378
564 Ga0501047_0136864
565 Ga0501047_0212088
566 Ga0501048_0003908
567 Ga0501048_0007253
568 Ga0501048_0019899
569 Ga0501048_0026168
570 Ga0501067_0001488
571 Ga0501067_0002725
572 Ga0501067_0010123
573 Ga0501067_0024317
574 Ga0501067_0051473
575 Ga0501067_0224349
576 Ga0501067_0235018
577 Ga0501068_0001641
578 Ga0501068_0003527
579 Ga0501069_0001883
580 Ga0501069_0015410
581 Ga0501069_0213354
582 Ga0501070_0060414
583 Ga0501070_0160482
584 Ga0501071_0002655
585 Ga0501071_0232813
586 Ga0501072_0021161
587 Ga0501072_0077132
588 Ga0501072_0079745
589 Ga0501072_0095041
590 Ga0501073_0007710
591 Ga0501073_0016293
592 Ga0501073_0034435
593 Ga0501073_0215803
594 Ga0501074_0028550
595 Ga0501075_0009492
596 Ga0501076_0075610
597 Ga0501076_0078372
598 Ga0501076_0098037
599 Ga0501077_0020411
600 Ga0501077_0057292
601 Ga0501079_0003339
602 Ga0501079_0044033
603 Ga0501079_0194640
604 Ga0501080_0007068
605 Ga0501080_0020401
606 Ga0501080_0047070
607 Ga0501080_0151074
608 Ga0501080_0166521
609 Ga0501080_0201640
610 Ga0501081_0020808
611 Ga0501081_0075891
612 Ga0501083_0004931
613 Ga0501083_0146459
614 Ga0501035_0000755
615 Ga0501035_0025953
616 Ga0501035_0043884
617 Ga0501035_0077546
618 Ga0501035_0138447
619 Ga0501044_0023691
620 Ga0501044_0080939
621 Ga0501044_0158733
622 Ga0501044_0161134
623 Ga0501044_0383493
624 Ga0501045_0003446
625 Ga0501045_0093072
626 nmdc:mga05p37_44444_c1
627 nmdc:mga05p37_76112_c1
628 nmdc:mga0n895_115566_c1
629 nmdc:mga0n895_174700_c1
630 nmdc:mga0n895_552636_c1
631 nmdc:mga0a205_21041_c1
632 nmdc:mga0a205_658068_c1
633 Ga0495601_0187239
634 Ga0495595_0158181
635 Ga0501084_0001998
636 Ga0501084_0058877
637 Ga0501084_0080934
638 Ga0501084_0111047
639 Ga0501084_0275185
640 Ga0501082_0006679
641 Ga0501082_0035859
642 Ga0501082_0072594
643 Ga0530510_0000763
644 Ga0530510_0466234

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00950

ABC-3

ABC 3 transport family

1

251

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.8492 4 246
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.848 4 246
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.8216 4 246
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.8204 4 246
5b58-assembly1.cif.gz_B inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.7343 4 249
ID Description Score Start End Superfamily
af_Q2FY18_5_276_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9137 4 249 1.10.3470.10
af_O86339_1_133_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9119 124 249 1.10.1760.20
af_Q2G2D9_6_271_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.911 4 249 1.10.3470.10
af_P39832_7_260_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9108 5 248 1.10.3470.10
af_Q2FY18_5_276_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8932 4 249 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A1F3BQF1-F1-model_v4 High-affinity zinc uptake system membrane protein ZnuB 0.9779 1 248 GO:0006829
GO:0010043
GO:0043190
GO:0055085
AF-A0A349WX37-F1-model_v4 High-affinity zinc uptake system membrane protein ZnuB 0.9639 3 251 GO:0006829
GO:0010043
GO:0043190
GO:0055085
AF-A0A1F3BQF1-F1-model_v4 High-affinity zinc uptake system membrane protein ZnuB 0.9626 1 248 GO:0006829
GO:0010043
GO:0043190
GO:0055085
AF-A0A7C3MNW5-F1-model_v4 High-affinity zinc uptake system membrane protein ZnuB 0.9622 2 209 GO:0006829
GO:0010043
GO:0043190
GO:0055085
AF-A0A1G2C790-F1-model_v4 High-affinity zinc uptake system membrane protein ZnuB 0.9608 1 248 GO:0006829
GO:0010043
GO:0043190
GO:0055085

Map