F406243

General Info

Members Datasets Scaffolds Average Seq Length
321 223 254 371

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8008574985|8008576885
Length 392
Sequence GGRPGLIPRPEHPCQHGRVQPTPAQPHRAAHDREIESLAEFDEAVAEHGSLARFRVQAVDLTSRTDVLLRLDTTGAVFLGCPMDPEAAARVRASGALVFPPVPGLPFDPYRAFVYTPGELFESLDTGYEVTPDARAYAWFQRTKADGDVFSSMLRAIHDDAVSDALDELLAGARVVGVMGGHAMARGTDAYAGAARLGRELARAGYTVATGGGPGAMEAANLGAYAAPFADGMLDDALRLLAKAPSFRPSVSEWARAAFEVRERWPGGGDSVGIPTWFYGHEPPNAFAAHIAKYFANATREDGLLARSTAGVVFLPGAAGTVQEVFDNATPNYYESRGEPTPMVLVDGGHWTRELPVWPLLRSLARGRAMESRIALVDRIEQAPDALKRLGG

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
8 2643221647 Streptomyces sp. Root369 Isolate Unclassified
9 2643221670 Streptomyces sp. Root431 Isolate Unclassified
10 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
11 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
12 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
13 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
14 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
15 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
16 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
17 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
18 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
19 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
20 2808606448 Streptomyces sp. 193411 Isolate Unclassified
21 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
22 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
23 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
24 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
25 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
26 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
27 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
28 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
29 2862574272 Streptomyces sp. AcE210 Isolate Nodule
30 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
31 2867369537 Streptomyces sp. Z26 Isolate Unclassified
32 2867428634 Streptomyces sp. RP5T Isolate Unclassified
33 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
34 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
35 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
36 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
37 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
38 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
39 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
40 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
41 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
42 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
43 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
44 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
45 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
46 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
47 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
48 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
49 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
50 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
51 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
52 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
53 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
54 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
55 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
56 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
57 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
58 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
59 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
60 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
61 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
62 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
86 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
101 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
106 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
107 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
108 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
109 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
110 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
111 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
112 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
113 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
210 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
214 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
215 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
216 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
217 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
218 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
219 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
220 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
221 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
222 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
223 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.5
Metatranscriptomes 0.62
Isolates 20.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 1.25
Rhizoplane 0.93
Rhizosphere 76.64
Stem 0
Stem Tuber 0
Unclassified 18.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10016624 3300001989 Bacteria 2661
2 JGI24737J22298_10010475 3300001990 Bacteria 3059
3 rootH1_10052516 3300003323 Bacteria 2408
4 rootH1_10150603 3300003323 Bacteria 2054
5 rootH1_10170768 3300003323 Bacteria 2486
6 JGI25160J50197_1007177 3300003354 Bacteria 4390
7 Ga0006562J51391_1175159 3300003578 Bacteria 1881
8 Ga0006562J51391_1175160 3300003578 Bacteria 1940
9 Ga0070689_100033402 3300005340 Bacteria 3920
10 Ga0070688_100073502 3300005365 Bacteria 2193
11 Ga0068853_100084443 3300005539 Bacteria 2782
12 Ga0081455_10219543 3300005937 Bacteria 1410
13 Ga0070717_10104389 3300006028 Bacteria 2410
14 Ga0075368_10002883 3300006042 Bacteria 5680
15 Ga0075367_10029607 3300006178 Bacteria 3133
16 Ga0099826_10087284 3300006948 Bacteria 1920
17 Ga0105248_10536972 3300009177 Bacteria 1319
18 Ga0105246_10005458 3300011119 Bacteria 7743
19 Ga0157372_10100774 3300013307 Bacteria 3296
20 Ga0182008_10000192 3300014497 Bacteria 48269
21 Ga0182007_10000449 3300015262 Bacteria 24937
22 Ga0183367_1013 3300015688 Bacteria 334176
23 Ga0207426_1002296 3300025302 Bacteria 12608
24 Ga0207426_1003345 3300025302 Bacteria 8833
25 Ga0207426_1007818 3300025302 Bacteria 4421
26 Ga0207647_10007384 3300025904 Bacteria 7947
27 Ga0207670_10065599 3300025936 Bacteria 2492
28 Ga0207667_10109281 3300025949 Bacteria 2852
29 Ga0207639_10047724 3300026041 Bacteria 3238
30 Ga0209813_10001028 3300027866 Bacteria 6279
31 Ga0307517_10045680 3300028786 Bacteria 4593
32 Ga0307515_10003048 3300028794 Bacteria 35498
33 Ga0307515_10095903 3300028794 Bacteria 3644
34 Ga0307511_10012189 3300030521 Bacteria 8443
35 Ga0307511_10039766 3300030521 Bacteria 4010
36 Ga0307512_10002986 3300030522 Bacteria 20400
37 Ga0307512_10018974 3300030522 Bacteria 6274
38 Ga0307512_10161478 3300030522 Bacteria 1311
39 Ga0307513_10047163 3300031456 Bacteria 4689
40 Ga0307513_10054976 3300031456 Bacteria 4263
41 Ga0307509_10014720 3300031507 Bacteria 9175
42 Ga0307509_10021704 3300031507 Bacteria 7253
43 Ga0307509_10028890 3300031507 Bacteria 6160
44 Ga0307508_10010818 3300031616 Bacteria 8345
45 Ga0307508_10011188 3300031616 Bacteria 8209
46 Ga0307514_10052644 3300031649 Bacteria 3146
47 Ga0307514_10071307 3300031649 Bacteria 2606
48 Ga0307514_10073572 3300031649 Bacteria 2554
49 Ga0307514_10131484 3300031649 Bacteria 1722
50 Ga0316576_10018803 3300031727 Bacteria 4725
51 Ga0307516_10025291 3300031730 Bacteria 6047
52 Ga0307516_10081572 3300031730 Bacteria 3077
53 Ga0307518_10058619 3300031838 Bacteria 2796
54 Ga0307410_10098956 3300031852 Bacteria 2087
55 Ga0307415_100007415 3300032126 Bacteria 5999
56 Ga0307507_10010357 3300033179 Bacteria 12073
57 Ga0307507_10012239 3300033179 Bacteria 10642
58 Ga0307510_10037287 3300033180 Bacteria 5396
59 Ga0395898_0009407 3300037466 Bacteria 10263
60 Ga0395901_0128410 3300038443 Bacteria 2664
61 Ga0439436_0000779 3300041404 Bacteria 8637
62 Ga0439439_0002405 3300041406 Bacteria 3969
63 Ga0451853_4017805 3300041512 Bacteria 2981
64 Ga0439433_0003623 3300041999 Bacteria 3321
65 Ga0439449_0002853 3300042007 Bacteria 6724
66 Ga0439455_0005888 3300042012 Bacteria 2514
67 Ga0439457_002058 3300042014 Bacteria 5888
68 Ga0439457_007027 3300042014 Bacteria 2718
69 Ga0439462_0011246 3300042015 Bacteria 2277
70 Ga0450894_000143 3300042131 Bacteria 12616
71 Ga0450896_002366 3300042133 Bacteria 2425
72 Ga0450899_000704 3300042135 Bacteria 3822
73 Ga0450903_000128 3300042138 Bacteria 16569
74 Ga0450906_000570 3300042145 Bacteria 7807
75 Ga0439458_0002892 3300042157 Bacteria 4123
76 Ga0439458_0003482 3300042157 Bacteria 3674
77 Ga0466965_0081767 3300044683 Bacteria 1633
78 Ga0466966_0006907 3300044684 Bacteria 7519
79 Ga0466961_0003355 3300044693 Bacteria 9993
80 Ga0466963_0013375 3300044694 Bacteria 5038
81 Ga0466963_0175609 3300044694 Bacteria 1494
82 Ga0466964_0050019 3300044706 Bacteria 1712
83 Ga0466971_0001020 3300044719 Bacteria 11572
84 Ga0466970_0025520 3300044765 Bacteria 3094
85 Ga0466957_0005326 3300044842 Bacteria 7217
86 Ga0466957_0161596 3300044842 Bacteria 1455
87 Ga0466960_0004463 3300044901 Bacteria 5473
88 Ga0466959_0019445 3300045049 Bacteria 4994
89 Ga0466958_0007629 3300045836 Bacteria 5960
90 Ga0466967_0007388 3300045976 Bacteria 7920
91 Ga0495592_0097208 3300046454 Bacteria 2103
92 Ga0495603_0011959 3300046455 Bacteria 5252
93 Ga0495603_0067737 3300046455 Bacteria 2101
94 Ga0495603_0069354 3300046455 Bacteria 2073
95 Ga0495603_0083354 3300046455 Bacteria 1872
96 Ga0495629_0006683 3300046459 Bacteria 8533
97 Ga0495629_0008844 3300046459 Bacteria 7404
98 Ga0495629_0025111 3300046459 Bacteria 4238
99 Ga0495629_0031375 3300046459 Bacteria 3763
100 Ga0495629_0051967 3300046459 Bacteria 2867
101 Ga0495629_0075110 3300046459 Bacteria 2360
102 Ga0495651_0008010 3300046462 Bacteria 8101
103 Ga0495651_0053417 3300046462 Bacteria 3110
104 Ga0495651_0111763 3300046462 Bacteria 2019
105 Ga0495582_0037231 3300046473 Bacteria 2676
106 Ga0495639_0035460 3300046475 Bacteria 2232
107 Ga0495662_0003059 3300046476 Bacteria 8438
108 Ga0495662_0005303 3300046476 Bacteria 6460
109 Ga0495662_0008234 3300046476 Bacteria 5134
110 Ga0495662_0036503 3300046476 Bacteria 2371
111 Ga0495664_0000378 3300046477 Bacteria 21628
112 Ga0495585_0036948 3300046492 Bacteria 2752
113 Ga0495585_0101168 3300046492 Bacteria 1541
114 Ga0495594_0001533 3300046499 Bacteria 12005
115 Ga0495594_0013796 3300046499 Bacteria 4224
116 Ga0495594_0073052 3300046499 Bacteria 1908
117 Ga0495594_0170990 3300046499 Bacteria 1236
118 Ga0495607_0061029 3300046501 Bacteria 2143
119 Ga0495606_0027745 3300046507 Bacteria 4007
120 Ga0495608_0208304 3300046511 Bacteria 1230
121 Ga0495610_0082691 3300046512 Bacteria 1471
122 Ga0495616_0022711 3300046513 Bacteria 3384
123 Ga0495618_0183720 3300046514 Bacteria 1328
124 Ga0495628_0022039 3300046516 Bacteria 5236
125 Ga0495628_0045910 3300046516 Bacteria 3472
126 Ga0495630_0005572 3300046517 Bacteria 8889
127 Ga0495631_0030524 3300046518 Bacteria 2444
128 Ga0495643_0005349 3300046522 Bacteria 8694
129 Ga0495666_0013766 3300046526 Bacteria 4032
130 Ga0495666_0043471 3300046526 Bacteria 2171
131 Ga0495652_0039801 3300046529 Bacteria 4064
132 Ga0495652_0049325 3300046529 Bacteria 3605
133 Ga0495652_0211549 3300046529 Bacteria 1463
134 Ga0495640_0005011 3300046533 Bacteria 10522
135 Ga0495640_0005435 3300046533 Bacteria 10139
136 Ga0495640_0022776 3300046533 Bacteria 4574
137 Ga0495587_0001074 3300046536 Bacteria 17963
138 Ga0495597_0010907 3300046542 Bacteria 4421
139 Ga0495645_0016675 3300046543 Bacteria 5252
140 Ga0495645_0049572 3300046543 Bacteria 3058
141 Ga0495622_0007136 3300046557 Bacteria 5191
142 Ga0495622_0078756 3300046557 Bacteria 1517
143 Ga0495634_0007034 3300046642 Bacteria 8485
144 Ga0495634_0020982 3300046642 Bacteria 4626
145 Ga0495634_0061565 3300046642 Bacteria 2494
146 Ga0495611_0027192 3300046648 Bacteria 2499
147 Ga0495625_0056996 3300046660 Bacteria 2779
148 Ga0495625_0144940 3300046660 Bacteria 1599
149 Ga0495635_0007306 3300046663 Bacteria 7713
150 Ga0495588_0013017 3300046674 Bacteria 3952
151 Ga0495588_0048453 3300046674 Bacteria 2183
152 Ga0495657_0016703 3300046675 Bacteria 5340
153 Ga0495657_0040285 3300046675 Bacteria 3205
154 Ga0495657_0058069 3300046675 Bacteria 2570
155 Ga0495657_0062472 3300046675 Bacteria 2460
156 Ga0495623_0037603 3300046679 Bacteria 3096
157 Ga0495623_0052772 3300046679 Bacteria 2569
158 Ga0495646_0000250 3300046680 Bacteria 27112
159 Ga0495646_0164247 3300046680 Bacteria 1227
160 Ga0495658_0009108 3300046683 Bacteria 4936
161 Ga0495613_0008688 3300046689 Bacteria 7532
162 Ga0495613_0010902 3300046689 Bacteria 6747
163 Ga0495613_0017631 3300046689 Bacteria 5317
164 Ga0495613_0017760 3300046689 Bacteria 5301
165 Ga0495624_0065894 3300046690 Bacteria 2262
166 Ga0495671_0021328 3300046692 Bacteria 3405
167 Ga0495589_0009421 3300046794 Bacteria 5078
168 Ga0495589_0049916 3300046794 Bacteria 2070
169 Ga0495600_0001301 3300046809 Bacteria 13786
170 Ga0495600_0014184 3300046809 Bacteria 5020
171 Ga0495600_0072543 3300046809 Bacteria 2249
172 Ga0495581_0028652 3300047315 Bacteria 3228
173 Ga0495604_0036731 3300047317 Bacteria 3861
174 Ga0495604_0087190 3300047317 Bacteria 2325
175 Ga0495676_0009548 3300047321 Bacteria 8833
176 Ga0495676_0011066 3300047321 Bacteria 8155
177 Ga0495676_0012290 3300047321 Bacteria 7712
178 Ga0495676_0013056 3300047321 Bacteria 7473
179 Ga0495676_0017452 3300047321 Bacteria 6345
180 Ga0495676_0061336 3300047321 Bacteria 2941
181 Ga0495680_0005588 3300047322 Bacteria 11792
182 Ga0495683_0022154 3300047323 Bacteria 3269
183 Ga0495683_0038001 3300047323 Bacteria 2438
184 Ga0495687_002802 3300047443 Bacteria 13452
185 Ga0495687_004545 3300047443 Bacteria 9304
186 Ga0495675_0068748 3300047444 Bacteria 2237
187 Ga0495675_0081066 3300047444 Bacteria 2044
188 Ga0495685_008813 3300047447 Bacteria 3361
189 Ga0495685_012138 3300047447 Bacteria 2914
190 Ga0495685_014823 3300047447 Bacteria 2653
191 Ga0495681_0065177 3300047470 Bacteria 1666
192 Ga0495684_0055006 3300047471 Bacteria 3035
193 Ga0495686_0065634 3300047472 Bacteria 2243
194 Ga0495686_0071753 3300047472 Bacteria 2130
195 Ga0495593_0000952 3300047673 Bacteria 16909
196 Ga0495593_0015692 3300047673 Bacteria 4286
197 Ga0495593_0083216 3300047673 Bacteria 1653
198 Ga0495602_0007456 3300048088 Bacteria 11444
199 Ga0495614_0002999 3300048089 Bacteria 7525
200 Ga0495614_0004344 3300048089 Bacteria 6388
201 Ga0495614_0023711 3300048089 Bacteria 2648
202 Ga0496106_0006760 3300048909 Bacteria 8491
203 Ga0496109_0174661 3300048912 Bacteria 2016
204 Ga0501031_0001230 3300049568 Bacteria 15679
205 Ga0501031_0226589 3300049568 Bacteria 1217
206 Ga0501032_0000992 3300049569 Bacteria 22851
207 Ga0501032_0010427 3300049569 Bacteria 6701
208 Ga0501033_0038216 3300049570 Bacteria 3590
209 Ga0501033_0053949 3300049570 Bacteria 2975
210 Ga0501033_0058568 3300049570 Bacteria 2845
211 Ga0501034_0001415 3300049571 Bacteria 32122
212 Ga0501034_0015972 3300049571 Bacteria 7706
213 Ga0501034_0093653 3300049571 Bacteria 3001
214 Ga0501034_0119368 3300049571 Bacteria 2623
215 Ga0501036_0004483 3300049572 Bacteria 11291
216 Ga0501036_0125690 3300049572 Bacteria 2166
217 Ga0501037_0000989 3300049573 Bacteria 21064
218 Ga0501038_0003143 3300049574 Bacteria 15408
219 Ga0501038_0023111 3300049574 Bacteria 5563
220 Ga0501039_0019128 3300049575 Bacteria 5254
221 Ga0501042_0012766 3300049578 Bacteria 5701
222 Ga0501043_0002379 3300049579 Bacteria 15929
223 Ga0501043_0022010 3300049579 Bacteria 5001
224 Ga0501043_0024832 3300049579 Bacteria 4702
225 Ga0501046_0005965 3300049580 Bacteria 10840
226 Ga0501046_0006232 3300049580 Bacteria 10588
227 Ga0501047_0000826 3300049581 Bacteria 32127
228 Ga0501047_0020172 3300049581 Bacteria 6399
229 Ga0501047_0177629 3300049581 Bacteria 1996
230 Ga0501047_0202476 3300049581 Bacteria 1846
231 Ga0501048_0003265 3300049582 Bacteria 12350
232 Ga0501048_0167902 3300049582 Bacteria 1554
233 Ga0501067_0007675 3300049583 Bacteria 5998
234 Ga0501070_0022367 3300049586 Bacteria 5295
235 Ga0501071_0001692 3300049587 Bacteria 12934
236 Ga0501072_0002777 3300049588 Bacteria 13162
237 Ga0501073_0021313 3300049589 Bacteria 4671
238 Ga0501076_0034120 3300049592 Bacteria 3975
239 Ga0501077_0067902 3300049593 Bacteria 2260
240 Ga0501079_0110919 3300049741 Bacteria 2131
241 Ga0501080_0117932 3300049742 Bacteria 2460
242 Ga0501083_0040543 3300049744 Bacteria 3160
243 Ga0501035_0004728 3300049822 Bacteria 12928
244 Ga0501035_0025502 3300049822 Bacteria 5419
245 Ga0501044_0002530 3300049823 Bacteria 20819
246 Ga0501044_0006803 3300049823 Bacteria 12602
247 Ga0501044_0021111 3300049823 Bacteria 6952
248 Ga0501044_0062402 3300049823 Bacteria 3809
249 nmdc:mga06z11_532_c1 3300050494 Bacteria 14020
250 nmdc:mga04h51_1334_c1 3300050495 Bacteria 5685
251 Ga0500600_0075428 3300053149 Bacteria 1838
252 Ga0501084_0004457 3300054114 Bacteria 11430
253 Ga0466962_0000974 3300061719 Bacteria 13033
254 Ga0530510_0146474 3300061734 Bacteria 1742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0013796 Ga0495594_0013796_13_990 325
2 3300046511 Ga0495608_0208304 Ga0495608_0208304_243_1220 325
3 3300047471 Ga0495684_0055006 Ga0495684_0055006_2035_3012 325
4 3300049568 Ga0501031_0226589 Ga0501031_0226589_68_1048 325
5 3300053149 Ga0500600_0075428 Ga0500600_0075428_12_1001 325
6 3300046542 Ga0495597_0010907 Ga0495597_0010907_3391_4395 334
7 iso_pu_bacteria 2643221670 2644387162 344
8 3300046492 Ga0495585_0101168 Ga0495585_0101168_191_1237 347
9 3300013307 Ga0157372_10100774 Ga0157372_101007743 348
10 3300047673 Ga0495593_0015692 Ga0495593_0015692_1263_2342 350
11 3300048909 Ga0496106_0006760 Ga0496106_0006760_5063_6181 351
12 3300031616 Ga0307508_10011188 Ga0307508_100111886 355
13 iso_pu_bacteria 2935390628 2935395999 358
14 iso_pu_bacteria 2990088156 2990093877 359
15 iso_pu_bacteria 2791355406 2793979508 360
16 iso_pu_bacteria 8047893842 8047895807 360
17 iso_pu_bacteria 8048127548 8048129065 360
18 iso_pu_bacteria 8048356638 8048363127 360
19 iso_pu_bacteria 8048369669 8048372831 360
20 iso_pu_bacteria 8048379754 8048381765 360
21 3300031649 Ga0307514_10131484 Ga0307514_101314842 363
22 3300041512 Ga0451853_4017805 Ga0451853_4017805_801_1916 363
23 iso_pu_bacteria 2643221548 2643761536 363
24 iso_pu_bacteria 2643221682 2644458762 363
25 iso_pu_bacteria 2808606982 2811844117 363
26 iso_pu_bacteria 2818991463 2819698931 363
27 3300003323 rootH1_10170768 rootH1_101707682 364
28 3300005340 Ga0070689_100033402 Ga0070689_1000334023 364
29 3300005365 Ga0070688_100073502 Ga0070688_1000735022 364
30 3300006028 Ga0070717_10104389 Ga0070717_101043892 364
31 3300025936 Ga0207670_10065599 Ga0207670_100655992 364
32 3300026041 Ga0207639_10047724 Ga0207639_100477243 364
33 3300032126 Ga0307415_100007415 Ga0307415_1000074152 364
34 3300041404 Ga0439436_0000779 Ga0439436_0000779_6173_7285 364
35 3300041406 Ga0439439_0002405 Ga0439439_0002405_1491_2603 364
36 3300041999 Ga0439433_0003623 Ga0439433_0003623_1009_2121 364
37 3300042014 Ga0439457_002058 Ga0439457_002058_49_1161 364
38 3300042015 Ga0439462_0011246 Ga0439462_0011246_183_1295 364
39 3300047472 Ga0495686_0065634 Ga0495686_0065634_1026_2174 364
40 3300003354 JGI25160J50197_1007177 JGI25160J50197_10071774 365
41 3300025302 Ga0207426_1007818 Ga0207426_10078183 365
42 3300031852 Ga0307410_10098956 Ga0307410_100989562 365
43 3300046455 Ga0495603_0067737 Ga0495603_0067737_104_1216 365
44 3300046459 Ga0495629_0006683 Ga0495629_0006683_4513_5631 365
45 3300046492 Ga0495585_0036948 Ga0495585_0036948_251_1363 365
46 3300046499 Ga0495594_0001533 Ga0495594_0001533_2970_4088 365
47 3300046533 Ga0495640_0005435 Ga0495640_0005435_7727_8839 365
48 3300046557 Ga0495622_0007136 Ga0495622_0007136_2013_3131 365
49 3300047321 Ga0495676_0011066 Ga0495676_0011066_3337_4455 365
50 3300049568 Ga0501031_0001230 Ga0501031_0001230_6640_7752 365
51 3300049569 Ga0501032_0000992 Ga0501032_0000992_21142_22254 365
52 3300049570 Ga0501033_0038216 Ga0501033_0038216_149_1261 365
53 3300049571 Ga0501034_0001415 Ga0501034_0001415_8943_10055 365
54 3300049572 Ga0501036_0004483 Ga0501036_0004483_8940_10052 365
55 3300049573 Ga0501037_0000989 Ga0501037_0000989_8943_10055 365
56 3300049575 Ga0501039_0019128 Ga0501039_0019128_727_1839 365
57 3300049579 Ga0501043_0002379 Ga0501043_0002379_1040_2152 365
58 3300049580 Ga0501046_0006232 Ga0501046_0006232_557_1669 365
59 3300049581 Ga0501047_0000826 Ga0501047_0000826_22072_23184 365
60 3300049581 Ga0501047_0177629 Ga0501047_0177629_128_1240 365
61 3300049582 Ga0501048_0003265 Ga0501048_0003265_793_1905 365
62 3300049583 Ga0501067_0007675 Ga0501067_0007675_2327_3439 365
63 3300049586 Ga0501070_0022367 Ga0501070_0022367_4080_5192 365
64 3300049587 Ga0501071_0001692 Ga0501071_0001692_596_1708 365
65 3300049588 Ga0501072_0002777 Ga0501072_0002777_2326_3438 365
66 3300049589 Ga0501073_0021313 Ga0501073_0021313_201_1313 365
67 3300049592 Ga0501076_0034120 Ga0501076_0034120_2217_3329 365
68 3300049593 Ga0501077_0067902 Ga0501077_0067902_392_1504 365
69 3300049741 Ga0501079_0110919 Ga0501079_0110919_745_1857 365
70 3300049744 Ga0501083_0040543 Ga0501083_0040543_598_1710 365
71 3300049822 Ga0501035_0004728 Ga0501035_0004728_4996_6108 365
72 3300049823 Ga0501044_0002530 Ga0501044_0002530_10765_11877 365
73 3300054114 Ga0501084_0004457 Ga0501084_0004457_2202_3314 365
74 3300061734 Ga0530510_0146474 Ga0530510_0146474_150_1262 365
75 iso_pu_bacteria 2554235005 2554256005 365
76 iso_pu_bacteria 2862178590 2862181794 365
77 3300031727 Ga0316576_10018803 Ga0316576_100188034 366
78 iso_pu_bacteria 2784746763 2785340934 366
79 iso_pu_bacteria 2811994879 2812355686 366
80 iso_pu_bacteria 2997600082 2997604026 366
81 3300046462 Ga0495651_0111763 Ga0495651_0111763_133_1251 367
82 3300046499 Ga0495594_0170990 Ga0495594_0170990_70_1188 367
83 3300046514 Ga0495618_0183720 Ga0495618_0183720_141_1259 367
84 3300046516 Ga0495628_0045910 Ga0495628_0045910_1355_2473 367
85 3300046529 Ga0495652_0211549 Ga0495652_0211549_17_1135 367
86 3300046533 Ga0495640_0005011 Ga0495640_0005011_61_1179 367
87 3300046642 Ga0495634_0007034 Ga0495634_0007034_5558_6676 367
88 3300046675 Ga0495657_0016703 Ga0495657_0016703_3738_4856 367
89 3300046689 Ga0495613_0010902 Ga0495613_0010902_3859_4977 367
90 3300046690 Ga0495624_0065894 Ga0495624_0065894_611_1729 367
91 3300046809 Ga0495600_0014184 Ga0495600_0014184_3694_4812 367
92 3300047321 Ga0495676_0009548 Ga0495676_0009548_265_1383 367
93 3300047444 Ga0495675_0081066 Ga0495675_0081066_726_1844 367
94 iso_pu_bacteria 2616644814 2616700052 367
95 iso_pu_bacteria 2873151551 2873153806 367
96 iso_pu_bacteria 2966598605 2966600590 368
97 3300005539 Ga0068853_100084443 Ga0068853_1000844432 369
98 3300044842 Ga0466957_0161596 Ga0466957_0161596_142_1254 369
99 iso_pu_bacteria 2582581313 2585307751 369
100 iso_pu_bacteria 2582581314 2585316768 369
101 iso_pu_bacteria 2643221647 2644269603 369
102 iso_pu_bacteria 2784132148 2784590648 369
103 iso_pu_bacteria 2784746768 2785371821 369
104 iso_pu_bacteria 2786546132 2786672932 369
105 iso_pu_bacteria 2808606375 2808913897 369
106 iso_pu_bacteria 2811994917 2812478507 369
107 iso_pu_bacteria 2852635781 2852639739 369
108 iso_pu_bacteria 2862281513 2862284329 369
109 iso_pu_bacteria 2862382967 2862383284 369
110 iso_pu_bacteria 2863404153 2863408913 369
111 iso_pu_bacteria 2867428634 2867433173 369
112 iso_pu_bacteria 2877676314 2877678758 369
113 iso_pu_bacteria 2912723979 2912729902 369
114 iso_pu_bacteria 2946064051 2946070122 369
115 iso_pu_bacteria 2947224130 2947226670 369
116 iso_pu_bacteria 2954002825 2954005812 369
117 iso_pu_bacteria 2954380949 2954383737 369
118 iso_pu_bacteria 2954673503 2954679239 369
119 iso_pu_bacteria 2954682443 2954684914 369
120 iso_pu_bacteria 2954691527 2954694531 369
121 iso_pu_bacteria 2954701450 2954709735 369
122 iso_pu_bacteria 2954711539 2954714020 369
123 iso_pu_bacteria 2954721474 2954723989 369
124 iso_pu_bacteria 2954731030 2954737851 369
125 iso_pu_bacteria 2954740390 2954742886 369
126 iso_pu_bacteria 2954749733 2954756703 369
127 iso_pu_bacteria 2954759201 2954761843 369
128 iso_pu_bacteria 2990059506 2990062445 369
129 iso_pu_bacteria 8048406513 8048409801 369
130 3300003323 rootH1_10150603 rootH1_101506031 370
131 3300015688 Ga0183367_1013 Ga0183367_101384 370
132 3300031649 Ga0307514_10073572 Ga0307514_100735722 370
133 3300031730 Ga0307516_10081572 Ga0307516_100815723 370
134 3300042014 Ga0439457_007027 Ga0439457_007027_1425_2540 370
135 3300042131 Ga0450894_000143 Ga0450894_000143_1029_2144 370
136 3300042133 Ga0450896_002366 Ga0450896_002366_707_1822 370
137 3300042135 Ga0450899_000704 Ga0450899_000704_557_1672 370
138 3300042145 Ga0450906_000570 Ga0450906_000570_1761_2876 370
139 3300042157 Ga0439458_0002892 Ga0439458_0002892_946_2058 370
140 3300044683 Ga0466965_0081767 Ga0466965_0081767_69_1247 370
141 3300044684 Ga0466966_0006907 Ga0466966_0006907_3186_4364 370
142 3300044693 Ga0466961_0003355 Ga0466961_0003355_7718_8896 370
143 3300044694 Ga0466963_0175609 Ga0466963_0175609_269_1447 370
144 3300044706 Ga0466964_0050019 Ga0466964_0050019_271_1449 370
145 3300044719 Ga0466971_0001020 Ga0466971_0001020_2982_4160 370
146 3300044765 Ga0466970_0025520 Ga0466970_0025520_1632_2810 370
147 3300044842 Ga0466957_0005326 Ga0466957_0005326_1821_2999 370
148 3300045049 Ga0466959_0019445 Ga0466959_0019445_3379_4557 370
149 3300045836 Ga0466958_0007629 Ga0466958_0007629_1377_2555 370
150 3300061719 Ga0466962_0000974 Ga0466962_0000974_1627_2805 370
151 iso_pu_bacteria 2547132111 2547410589 370
152 iso_pu_bacteria 2643221587 2643943684 370
153 iso_pu_bacteria 2643221677 2644434057 370
154 iso_pu_bacteria 2643221678 2644437758 370
155 iso_pu_bacteria 2808606359 2808844321 370
156 iso_pu_bacteria 2867369537 2867374096 370
157 iso_pu_bacteria 2918501144 2918506792 370
158 iso_pu_bacteria 2919468124 2919472508 370
159 3300009177 Ga0105248_10536972 Ga0105248_105369721 371
160 3300046455 Ga0495603_0069354 Ga0495603_0069354_186_1301 371
161 3300046455 Ga0495603_0083354 Ga0495603_0083354_351_1466 371
162 3300046459 Ga0495629_0031375 Ga0495629_0031375_180_1295 371
163 3300046459 Ga0495629_0075110 Ga0495629_0075110_365_1480 371
164 3300046462 Ga0495651_0053417 Ga0495651_0053417_1180_2295 371
165 3300046476 Ga0495662_0005303 Ga0495662_0005303_212_1327 371
166 3300046476 Ga0495662_0036503 Ga0495662_0036503_431_1546 371
167 3300046499 Ga0495594_0073052 Ga0495594_0073052_437_1552 371
168 3300046501 Ga0495607_0061029 Ga0495607_0061029_901_2016 371
169 3300046507 Ga0495606_0027745 Ga0495606_0027745_2737_3852 371
170 3300046512 Ga0495610_0082691 Ga0495610_0082691_192_1307 371
171 3300046513 Ga0495616_0022711 Ga0495616_0022711_2176_3291 371
172 3300046516 Ga0495628_0022039 Ga0495628_0022039_3880_4995 371
173 3300046518 Ga0495631_0030524 Ga0495631_0030524_1194_2309 371
174 3300046522 Ga0495643_0005349 Ga0495643_0005349_520_1635 371
175 3300046526 Ga0495666_0013766 Ga0495666_0013766_2806_3921 371
176 3300046529 Ga0495652_0039801 Ga0495652_0039801_386_1501 371
177 3300046533 Ga0495640_0022776 Ga0495640_0022776_35_1150 371
178 3300046543 Ga0495645_0049572 Ga0495645_0049572_1066_2181 371
179 3300046642 Ga0495634_0061565 Ga0495634_0061565_787_1902 371
180 3300046660 Ga0495625_0056996 Ga0495625_0056996_1509_2624 371
181 3300046674 Ga0495588_0048453 Ga0495588_0048453_182_1297 371
182 3300046675 Ga0495657_0040285 Ga0495657_0040285_143_1258 371
183 3300046675 Ga0495657_0058069 Ga0495657_0058069_1317_2432 371
184 3300046675 Ga0495657_0062472 Ga0495657_0062472_898_2013 371
185 3300046679 Ga0495623_0037603 Ga0495623_0037603_1087_2202 371
186 3300046680 Ga0495646_0164247 Ga0495646_0164247_83_1198 371
187 3300046689 Ga0495613_0017631 Ga0495613_0017631_3896_5011 371
188 3300046689 Ga0495613_0017760 Ga0495613_0017760_351_1466 371
189 3300046794 Ga0495589_0049916 Ga0495589_0049916_546_1661 371
190 3300046809 Ga0495600_0072543 Ga0495600_0072543_1121_2236 371
191 3300047317 Ga0495604_0087190 Ga0495604_0087190_181_1296 371
192 3300047321 Ga0495676_0013056 Ga0495676_0013056_21_1136 371
193 3300047321 Ga0495676_0017452 Ga0495676_0017452_4526_5641 371
194 3300047322 Ga0495680_0005588 Ga0495680_0005588_7132_8247 371
195 3300047323 Ga0495683_0038001 Ga0495683_0038001_731_1846 371
196 3300047443 Ga0495687_004545 Ga0495687_004545_6233_7348 371
197 3300047444 Ga0495675_0068748 Ga0495675_0068748_864_1979 371
198 3300047447 Ga0495685_014823 Ga0495685_014823_485_1600 371
199 3300047470 Ga0495681_0065177 Ga0495681_0065177_518_1633 371
200 3300047472 Ga0495686_0071753 Ga0495686_0071753_85_1200 371
201 3300047673 Ga0495593_0083216 Ga0495593_0083216_338_1453 371
202 3300048089 Ga0495614_0023711 Ga0495614_0023711_257_1372 371
203 3300048912 Ga0496109_0174661 Ga0496109_0174661_609_1724 371
204 iso_pu_bacteria 2808606448 2809234340 371
205 iso_pu_bacteria 2862574272 2862577211 371
206 iso_pu_bacteria 2997451912 2997453125 371
207 iso_pu_bacteria 8023623736 8023625700 371
208 3300025302 Ga0207426_1002296 Ga0207426_10022966 372
209 3300025302 Ga0207426_1003345 Ga0207426_10033454 372
210 3300046648 Ga0495611_0027192 Ga0495611_0027192_1326_2465 372
211 3300046794 Ga0495589_0009421 Ga0495589_0009421_1337_2476 372
212 3300047321 Ga0495676_0061336 Ga0495676_0061336_1272_2411 372
213 3300047323 Ga0495683_0022154 Ga0495683_0022154_1725_2864 372
214 3300047447 Ga0495685_012138 Ga0495685_012138_195_1334 372
215 iso_pu_bacteria 8008558824 8008563066 372
216 iso_pu_bacteria 8054160619 8054163124 372
217 3300001989 JGI24739J22299_10016624 JGI24739J22299_100166243 373
218 3300001990 JGI24737J22298_10010475 JGI24737J22298_100104753 373
219 3300003323 rootH1_10052516 rootH1_100525162 373
220 3300003578 Ga0006562J51391_1175159 Ga0006562J51391_11751592 373
221 3300003578 Ga0006562J51391_1175160 Ga0006562J51391_11751602 373
222 3300005937 Ga0081455_10219543 Ga0081455_102195432 373
223 3300006042 Ga0075368_10002883 Ga0075368_100028832 373
224 3300006178 Ga0075367_10029607 Ga0075367_100296073 373
225 3300006948 Ga0099826_10087284 Ga0099826_100872842 373
226 3300011119 Ga0105246_10005458 Ga0105246_100054585 373
227 3300014497 Ga0182008_10000192 Ga0182008_100001923 373
228 3300015262 Ga0182007_10000449 Ga0182007_1000044926 373
229 3300025904 Ga0207647_10007384 Ga0207647_100073842 373
230 3300025949 Ga0207667_10109281 Ga0207667_101092813 373
231 3300027866 Ga0209813_10001028 Ga0209813_100010282 373
232 3300028786 Ga0307517_10045680 Ga0307517_100456803 373
233 3300028794 Ga0307515_10003048 Ga0307515_100030489 373
234 3300028794 Ga0307515_10095903 Ga0307515_100959033 373
235 3300030521 Ga0307511_10012189 Ga0307511_100121893 373
236 3300030521 Ga0307511_10039766 Ga0307511_100397663 373
237 3300030522 Ga0307512_10002986 Ga0307512_100029868 373
238 3300030522 Ga0307512_10018974 Ga0307512_100189743 373
239 3300030522 Ga0307512_10161478 Ga0307512_101614782 373
240 3300031456 Ga0307513_10047163 Ga0307513_100471632 373
241 3300031456 Ga0307513_10054976 Ga0307513_100549763 373
242 3300031507 Ga0307509_10014720 Ga0307509_100147205 373
243 3300031507 Ga0307509_10021704 Ga0307509_100217045 373
244 3300031507 Ga0307509_10028890 Ga0307509_100288905 373
245 3300031616 Ga0307508_10010818 Ga0307508_100108185 373
246 3300031649 Ga0307514_10052644 Ga0307514_100526443 373
247 3300031649 Ga0307514_10071307 Ga0307514_100713073 373
248 3300031730 Ga0307516_10025291 Ga0307516_100252914 373
249 3300031838 Ga0307518_10058619 Ga0307518_100586192 373
250 3300033179 Ga0307507_10010357 Ga0307507_1001035711 373
251 3300033179 Ga0307507_10012239 Ga0307507_100122395 373
252 3300033180 Ga0307510_10037287 Ga0307510_100372874 373
253 3300037466 Ga0395898_0009407 Ga0395898_0009407_8708_9832 373
254 3300038443 Ga0395901_0128410 Ga0395901_0128410_1072_2196 373
255 3300042007 Ga0439449_0002853 Ga0439449_0002853_4617_5747 373
256 3300042012 Ga0439455_0005888 Ga0439455_0005888_349_1470 373
257 3300042138 Ga0450903_000128 Ga0450903_000128_6945_8066 373
258 3300042157 Ga0439458_0003482 Ga0439458_0003482_1869_2990 373
259 3300044694 Ga0466963_0013375 Ga0466963_0013375_181_1308 373
260 3300044901 Ga0466960_0004463 Ga0466960_0004463_1391_2515 373
261 3300045976 Ga0466967_0007388 Ga0466967_0007388_2622_3743 373
262 3300046454 Ga0495592_0097208 Ga0495592_0097208_90_1211 373
263 3300046455 Ga0495603_0011959 Ga0495603_0011959_4077_5198 373
264 3300046459 Ga0495629_0008844 Ga0495629_0008844_2675_3796 373
265 3300046459 Ga0495629_0025111 Ga0495629_0025111_2513_3634 373
266 3300046459 Ga0495629_0051967 Ga0495629_0051967_1155_2276 373
267 3300046462 Ga0495651_0008010 Ga0495651_0008010_1688_2809 373
268 3300046473 Ga0495582_0037231 Ga0495582_0037231_1190_2311 373
269 3300046475 Ga0495639_0035460 Ga0495639_0035460_209_1330 373
270 3300046476 Ga0495662_0003059 Ga0495662_0003059_2936_4057 373
271 3300046476 Ga0495662_0008234 Ga0495662_0008234_569_1690 373
272 3300046477 Ga0495664_0000378 Ga0495664_0000378_17057_18178 373
273 3300046517 Ga0495630_0005572 Ga0495630_0005572_3008_4129 373
274 3300046526 Ga0495666_0043471 Ga0495666_0043471_960_2081 373
275 3300046529 Ga0495652_0049325 Ga0495652_0049325_343_1464 373
276 3300046536 Ga0495587_0001074 Ga0495587_0001074_13067_14188 373
277 3300046543 Ga0495645_0016675 Ga0495645_0016675_787_1908 373
278 3300046557 Ga0495622_0078756 Ga0495622_0078756_384_1505 373
279 3300046642 Ga0495634_0020982 Ga0495634_0020982_2687_3808 373
280 3300046660 Ga0495625_0144940 Ga0495625_0144940_449_1570 373
281 3300046663 Ga0495635_0007306 Ga0495635_0007306_1112_2233 373
282 3300046674 Ga0495588_0013017 Ga0495588_0013017_1234_2355 373
283 3300046679 Ga0495623_0052772 Ga0495623_0052772_899_2020 373
284 3300046680 Ga0495646_0000250 Ga0495646_0000250_11378_12499 373
285 3300046683 Ga0495658_0009108 Ga0495658_0009108_2796_3917 373
286 3300046689 Ga0495613_0008688 Ga0495613_0008688_5264_6385 373
287 3300046692 Ga0495671_0021328 Ga0495671_0021328_666_1787 373
288 3300046809 Ga0495600_0001301 Ga0495600_0001301_1112_2233 373
289 3300047315 Ga0495581_0028652 Ga0495581_0028652_1148_2269 373
290 3300047317 Ga0495604_0036731 Ga0495604_0036731_1295_2416 373
291 3300047321 Ga0495676_0012290 Ga0495676_0012290_3026_4147 373
292 3300047443 Ga0495687_002802 Ga0495687_002802_8316_9437 373
293 3300047447 Ga0495685_008813 Ga0495685_008813_634_1755 373
294 3300047673 Ga0495593_0000952 Ga0495593_0000952_12657_13778 373
295 3300048088 Ga0495602_0007456 Ga0495602_0007456_9290_10411 373
296 3300048089 Ga0495614_0002999 Ga0495614_0002999_3223_4344 373
297 3300048089 Ga0495614_0004344 Ga0495614_0004344_2062_3183 373
298 3300049569 Ga0501032_0010427 Ga0501032_0010427_1082_2209 373
299 3300049570 Ga0501033_0053949 Ga0501033_0053949_1002_2129 373
300 3300049570 Ga0501033_0058568 Ga0501033_0058568_916_2043 373
301 3300049571 Ga0501034_0015972 Ga0501034_0015972_2116_3243 373
302 3300049571 Ga0501034_0093653 Ga0501034_0093653_1012_2139 373
303 3300049571 Ga0501034_0119368 Ga0501034_0119368_415_1539 373
304 3300049572 Ga0501036_0125690 Ga0501036_0125690_473_1597 373
305 3300049574 Ga0501038_0003143 Ga0501038_0003143_3839_4963 373
306 3300049574 Ga0501038_0023111 Ga0501038_0023111_3300_4427 373
307 3300049578 Ga0501042_0012766 Ga0501042_0012766_3362_4489 373
308 3300049579 Ga0501043_0022010 Ga0501043_0022010_410_1534 373
309 3300049579 Ga0501043_0024832 Ga0501043_0024832_1431_2558 373
310 3300049580 Ga0501046_0005965 Ga0501046_0005965_1994_3121 373
311 3300049581 Ga0501047_0020172 Ga0501047_0020172_4831_5955 373
312 3300049581 Ga0501047_0202476 Ga0501047_0202476_10_1149 373
313 3300049582 Ga0501048_0167902 Ga0501048_0167902_403_1527 373
314 3300049742 Ga0501080_0117932 Ga0501080_0117932_1097_2221 373
315 3300049822 Ga0501035_0025502 Ga0501035_0025502_2185_3309 373
316 3300049823 Ga0501044_0006803 Ga0501044_0006803_3522_4661 373
317 3300049823 Ga0501044_0021111 Ga0501044_0021111_5451_6575 373
318 3300049823 Ga0501044_0062402 Ga0501044_0062402_2637_3767 373
319 3300050494 nmdc:mga06z11_532_c1 nmdc:mga06z11_532_c1_787_1908 373
320 3300050495 nmdc:mga04h51_1334_c1 nmdc:mga04h51_1334_c1_453_1574 373
321 iso_pu_bacteria 8008574985 8008576885 373

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18306

LDcluster4

SLOG cluster4 family

173

233

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wek-assembly1.cif.gz_B crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.8334 128 368
1wek-assembly1.cif.gz_E crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.8257 124 368
5wq3-assembly1.cif.gz_B-2 crystal structure of type-ii log from corynebacterium glutamicum 0.8214 134 370
5wq3-assembly1.cif.gz_C-3 crystal structure of type-ii log from corynebacterium glutamicum 0.8134 123 370
1wek-assembly1.cif.gz_F crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.8114 124 368
ID Description Score Start End Superfamily
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8232 135 370 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8152 135 368 3.40.50.450
af_Q8I1V0_170_336_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8055 186 368 3.40.50.450
af_A4HWA1_166_331_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8051 187 368 3.40.50.450
1wehB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8007 154 368 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A4V3DU40-F1-model_v4 deleted 0.9908 164 372
AF-A0A1U9R340-F1-model_v4 Rossmann fold nucleotide-binding protein 0.9863 14 372 GO:0005829
AF-A0A4V3DU40-F1-model_v4 deleted 0.9861 164 372
AF-D9W0V4-F1-model_v4 Rossmann fold nucleotide-binding protein 0.9788 44 370 GO:0005829
AF-A0A6B3HT42-F1-model_v4 Rossmann fold nucleotide-binding protein 0.9786 50 312 GO:0005829

Feature Viewer

pLDDT pTM Quality
91.76 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map