F406174

General Info

Members Datasets Scaffolds Average Seq Length
321 205 303 153

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0279184|Ga0501074_0279184_395_925
Length 176
Sequence MAKRQERHVKRVSRSGGPAKATNAASPGERLTQLGRQVAQPASPDKAVLEAVPNPHPDADYVVRFTAPEFTTLCPITGQPDFAHFVIDYVPGRSIVESKSLKLYLTSFRNVGSFHEATTIAIAKRIVAACRPKYLRIGGYWYPRGGIPIDVFWQTGRLPKGVWLPDPGVAPYKGRG

Samples

Sample ID Description Type Environment
1 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
2 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
3 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
4 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
5 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
6 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
7 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
184 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
185 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
190 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
191 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
196 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
197 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
198 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
199 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
200 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
201 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
202 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
203 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
204 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
205 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.39
Metatranscriptomes 0
Isolates 5.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.36
Nodule 5.3
Rhizoplane 6.23
Rhizosphere 81.93
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10092947 3300002459 Bacteria 628
2 Ga0070658_10073511 3300005327 Bacteria 2803
3 Ga0070658_10104705 3300005327 Bacteria 2341
4 Ga0070658_10261212 3300005327 Bacteria 1471
5 Ga0070658_10812852 3300005327 Bacteria 812
6 Ga0070683_100456336 3300005329 Bacteria 1220
7 Ga0070670_100005265 3300005331 Bacteria 10896
8 Ga0070670_100185748 3300005331 Bacteria 1805
9 Ga0070666_10003181 3300005335 Bacteria 9975
10 Ga0068868_100033560 3300005338 Bacteria 3956
11 Ga0070689_100508481 3300005340 Bacteria 1033
12 Ga0070691_10820892 3300005341 Bacteria 568
13 Ga0070661_100000019 3300005344 Bacteria 132428
14 Ga0070659_100799686 3300005366 Bacteria 820
15 Ga0070667_100081464 3300005367 Bacteria 2770
16 Ga0070714_100056762 3300005435 Bacteria 3350
17 Ga0070710_10048707 3300005437 Bacteria 2368
18 Ga0070711_100297643 3300005439 Bacteria 1282
19 Ga0070711_100329175 3300005439 Bacteria 1222
20 Ga0070711_100651761 3300005439 Bacteria 883
21 Ga0070663_100532607 3300005455 Bacteria 979
22 Ga0070663_100737486 3300005455 Bacteria 840
23 Ga0070678_100699927 3300005456 Bacteria 913
24 Ga0070681_11103866 3300005458 Bacteria 714
25 Ga0070698_100189095 3300005471 Bacteria 1997
26 Ga0070679_100206729 3300005530 Bacteria 1927
27 Ga0070679_100240701 3300005530 Bacteria 1767
28 Ga0070679_100940396 3300005530 Bacteria 808
29 Ga0070693_100173448 3300005547 Bacteria 1383
30 Ga0070665_100872592 3300005548 Bacteria 913
31 Ga0068855_100065220 3300005563 Bacteria 4246
32 Ga0068855_100078236 3300005563 Bacteria 3837
33 Ga0068855_100168358 3300005563 Bacteria 2482
34 Ga0068855_100669679 3300005563 Bacteria 1113
35 Ga0068852_100271299 3300005616 Bacteria 1632
36 Ga0081455_10001970 3300005937 Bacteria 24598
37 Ga0081455_10049676 3300005937 Bacteria 3614
38 Ga0070716_100963998 3300006173 Bacteria 672
39 Ga0070712_100009901 3300006175 Bacteria 6010
40 Ga0097621_100829933 3300006237 Bacteria 858
41 Ga0068871_100099837 3300006358 Bacteria 2430
42 Ga0099794_10246234 3300007265 Bacteria 921
43 Ga0099795_10000230 3300007788 Bacteria 9773
44 Ga0099795_10090927 3300007788 Bacteria 1183
45 Ga0099795_10203019 3300007788 Bacteria 837
46 Ga0105240_10042474 3300009093 Bacteria 5793
47 Ga0105240_10066210 3300009093 Bacteria 4483
48 Ga0105240_10288062 3300009093 Bacteria 1884
49 Ga0105240_10375312 3300009093 Bacteria 1607
50 Ga0105240_11147642 3300009093 Bacteria 825
51 Ga0105240_11432570 3300009093 Bacteria 726
52 Ga0105245_10072752 3300009098 Bacteria 3124
53 Ga0105245_10153648 3300009098 Bacteria 2178
54 Ga0105247_10089750 3300009101 Bacteria 1949
55 Ga0105243_10875462 3300009148 Bacteria 891
56 Ga0105241_10428944 3300009174 Bacteria 1165
57 Ga0105248_10352596 3300009177 Bacteria 1657
58 Ga0105248_12559892 3300009177 Bacteria 582
59 Ga0105237_10235663 3300009545 Bacteria 1831
60 Ga0105237_10246571 3300009545 Bacteria 1788
61 Ga0105237_10256607 3300009545 Bacteria 1750
62 Ga0105237_10539228 3300009545 Bacteria 1173
63 Ga0105237_11105021 3300009545 Bacteria 800
64 Ga0105238_10322242 3300009551 Bacteria 1532
65 Ga0105238_10622544 3300009551 Bacteria 1088
66 Ga0105249_10225608 3300009553 Bacteria 1845
67 Ga0099796_10010695 3300010159 Bacteria 2532
68 Ga0105239_10011951 3300010375 Bacteria 9682
69 Ga0105239_10067115 3300010375 Bacteria 3940
70 Ga0105239_10143406 3300010375 Bacteria 2662
71 Ga0105239_10181329 3300010375 Bacteria 2356
72 Ga0105239_10355990 3300010375 Bacteria 1653
73 Ga0105239_10594294 3300010375 Bacteria 1262
74 Ga0105239_10750223 3300010375 Bacteria 1117
75 Ga0105246_10137101 3300011119 Bacteria 1835
76 Ga0105246_10677362 3300011119 Bacteria 901
77 Ga0157370_10141037 3300013104 Bacteria 2245
78 Ga0157370_10161691 3300013104 Bacteria 2083
79 Ga0157370_10383113 3300013104 Bacteria 1295
80 Ga0157370_10811612 3300013104 Bacteria 851
81 Ga0157370_11444460 3300013104 Bacteria 619
82 Ga0157369_10152283 3300013105 Bacteria 2444
83 Ga0157374_10277356 3300013296 Bacteria 1654
84 Ga0157378_10037828 3300013297 Bacteria 4276
85 Ga0163162_10048143 3300013306 Bacteria 4271
86 Ga0163163_10481477 3300014325 Bacteria 1302
87 Ga0163163_10661975 3300014325 Bacteria 1108
88 Ga0157376_10064973 3300014969 Bacteria 3079
89 Ga0157376_10126801 3300014969 Bacteria 2272
90 Ga0209455_1030536 3300025272 Bacteria 917
91 Ga0207697_10076095 3300025315 Bacteria 1410
92 Ga0207692_10009018 3300025898 Bacteria 4152
93 Ga0207680_10009465 3300025903 Bacteria 4835
94 Ga0207705_10216833 3300025909 Bacteria 1452
95 Ga0207705_10313213 3300025909 Bacteria 1205
96 Ga0207654_10231877 3300025911 Bacteria 1230
97 Ga0207707_10512166 3300025912 Bacteria 1022
98 Ga0207695_10012690 3300025913 Bacteria 10091
99 Ga0207695_10049960 3300025913 Bacteria 4402
100 Ga0207695_10060325 3300025913 Bacteria 3927
101 Ga0207671_10146455 3300025914 Bacteria 1822
102 Ga0207671_10241395 3300025914 Bacteria 1419
103 Ga0207671_10281386 3300025914 Bacteria 1312
104 Ga0207671_10879622 3300025914 Bacteria 709
105 Ga0207671_11351519 3300025914 Bacteria 554
106 Ga0207693_10051456 3300025915 Bacteria 3232
107 Ga0207693_10329938 3300025915 Bacteria 1194
108 Ga0207663_10278300 3300025916 Bacteria 1242
109 Ga0207660_10302978 3300025917 Bacteria 1273
110 Ga0207657_10711785 3300025919 Bacteria 779
111 Ga0207649_10000382 3300025920 Bacteria 33119
112 Ga0207694_10075570 3300025924 Bacteria 2637
113 Ga0207694_10437587 3300025924 Bacteria 1091
114 Ga0207694_11288833 3300025924 Bacteria 618
115 Ga0207659_10245781 3300025926 Bacteria 1450
116 Ga0207687_10100480 3300025927 Bacteria 2128
117 Ga0207700_10125453 3300025928 Bacteria 2088
118 Ga0207700_10307717 3300025928 Bacteria 1370
119 Ga0207664_10025604 3300025929 Bacteria 4449
120 Ga0207664_10049328 3300025929 Bacteria 3314
121 Ga0207690_10060145 3300025932 Bacteria 2577
122 Ga0207709_10988388 3300025935 Bacteria 687
123 Ga0207670_10372877 3300025936 Bacteria 1135
124 Ga0207704_10561066 3300025938 Bacteria 929
125 Ga0207665_10440586 3300025939 Bacteria 998
126 Ga0207691_10537611 3300025940 Bacteria 991
127 Ga0207711_11661760 3300025941 Bacteria 582
128 Ga0207689_10184655 3300025942 Bacteria 1720
129 Ga0207679_10235002 3300025945 Bacteria 1550
130 Ga0207667_10090592 3300025949 Bacteria 3160
131 Ga0207667_10494956 3300025949 Bacteria 1240
132 Ga0207667_10570640 3300025949 Bacteria 1143
133 Ga0207651_11305137 3300025960 Bacteria 652
134 Ga0207668_11008582 3300025972 Bacteria 744
135 Ga0207658_10063343 3300025986 Bacteria 2771
136 Ga0207677_10288864 3300026023 Bacteria 1350
137 Ga0207639_10438395 3300026041 Bacteria 1184
138 Ga0207639_10706911 3300026041 Bacteria 935
139 Ga0207678_10014082 3300026067 Bacteria 7032
140 Ga0207702_10197498 3300026078 Bacteria 1863
141 Ga0207676_10116748 3300026095 Bacteria 2243
142 Ga0207674_10117037 3300026116 Bacteria 2636
143 Ga0207683_10747041 3300026121 Bacteria 908
144 Ga0207698_10387529 3300026142 Bacteria 1331
145 Ga0207698_11140949 3300026142 Bacteria 793
146 Ga0268266_10279216 3300028379 Bacteria 1552
147 Ga0268266_10534124 3300028379 Bacteria 1122
148 Ga0265318_10000839 3300028577 Bacteria 20229
149 Ga0265325_10010531 3300031241 Bacteria 5351
150 Ga0265340_10048261 3300031247 Bacteria 2071
151 Ga0265339_10054770 3300031249 Bacteria 2165
152 Ga0265339_10104596 3300031249 Bacteria 1470
153 Ga0265331_10022157 3300031250 Bacteria 3244
154 Ga0265331_10029275 3300031250 Bacteria 2750
155 Ga0265316_10017222 3300031344 Bacteria 6252
156 Ga0265313_10002435 3300031595 Bacteria 16058
157 Ga0265313_10005168 3300031595 Bacteria 9695
158 Ga0265314_10006433 3300031711 Bacteria 10403
159 Ga0265314_10016266 3300031711 Bacteria 5884
160 Ga0265314_10080612 3300031711 Bacteria 2149
161 Ga0265314_10290957 3300031711 Bacteria 920
162 Ga0265342_10224166 3300031712 Bacteria 1012
163 Ga0265342_10477722 3300031712 Bacteria 637
164 Ga0373940_0155600 3300035088 Bacteria 731
165 Ga0373957_0249865 3300035120 Bacteria 746
166 Ga0373946_0082554 3300035171 Bacteria 1410
167 Ga0373931_1026454 3300035691 Bacteria 559
168 Ga0373935_0570694 3300035692 Bacteria 826
169 Ga0373927_0549234 3300035695 Bacteria 763
170 Ga0373937_0010772 3300036401 Bacteria 8003
171 Ga0373937_0550619 3300036401 Bacteria 1096
172 Ga0373925_0251681 3300037068 Bacteria 1417
173 Ga0373925_1329503 3300037068 Bacteria 589
174 Ga0395898_0655694 3300037466 Bacteria 992
175 Ga0436363_1086022 3300039450 Bacteria 634
176 Ga0451793_1758379 3300041452 Bacteria 763
177 Ga0495662_0086231 3300046476 Bacteria 1529
178 Ga0495585_0313195 3300046492 Bacteria 769
179 Ga0495618_0014379 3300046514 Bacteria 4822
180 Ga0495665_0131560 3300046531 Bacteria 1310
181 Ga0495640_0025682 3300046533 Bacteria 4268
182 Ga0495622_0448694 3300046557 Bacteria 553
183 Ga0495667_0396731 3300046559 Bacteria 869
184 Ga0495668_0389061 3300046616 Bacteria 766
185 Ga0495634_0158696 3300046642 Bacteria 1427
186 Ga0495658_0202579 3300046683 Bacteria 1237
187 Ga0495613_0072381 3300046689 Bacteria 2512
188 Ga0495624_0179221 3300046690 Bacteria 1292
189 Ga0495600_0204528 3300046809 Bacteria 1267
190 Ga0495581_0623112 3300047315 Bacteria 624
191 Ga0495604_0292356 3300047317 Bacteria 1097
192 Ga0495680_0487357 3300047322 Bacteria 839
193 Ga0495680_0979483 3300047322 Bacteria 541
194 Ga0495675_0225033 3300047444 Bacteria 1134
195 Ga0495593_0002840 3300047673 Bacteria 10434
196 Ga0495602_0490877 3300048088 Bacteria 860
197 Ga0496100_0018161 3300048903 Bacteria 4167
198 Ga0496101_0003260 3300048904 Bacteria 10084
199 Ga0496102_0178801 3300048905 Bacteria 1998
200 Ga0496102_0908572 3300048905 Bacteria 802
201 Ga0496104_0163662 3300048907 Bacteria 2133
202 Ga0496104_0179807 3300048907 Bacteria 2025
203 Ga0496105_0377493 3300048908 Bacteria 1128
204 Ga0496106_0301371 3300048909 Bacteria 1285
205 Ga0496108_0026814 3300048911 Bacteria 4755
206 Ga0496108_0138179 3300048911 Bacteria 2098
207 Ga0496109_0028567 3300048912 Bacteria 4988
208 Ga0496109_0771392 3300048912 Bacteria 899
209 Ga0496110_0091693 3300048913 Bacteria 2718
210 Ga0496112_0259195 3300048915 Bacteria 1688
211 Ga0496113_0113333 3300048916 Bacteria 2113
212 Ga0496114_0101783 3300048917 Bacteria 2453
213 Ga0496115_0009324 3300048918 Bacteria 7292
214 Ga0496115_0025001 3300048918 Bacteria 4646
215 Ga0496115_0033725 3300048918 Bacteria 4043
216 Ga0496120_0181417 3300048923 Bacteria 1033
217 Ga0496125_0380105 3300048928 Bacteria 833
218 Ga0496126_0019887 3300048929 Bacteria 6602
219 Ga0496126_0125167 3300048929 Bacteria 2226
220 Ga0496126_1184648 3300048929 Bacteria 563
221 Ga0501031_0087528 3300049568 Bacteria 2031
222 Ga0501032_0091759 3300049569 Bacteria 2014
223 Ga0501032_0298919 3300049569 Bacteria 1041
224 Ga0501032_0472483 3300049569 Bacteria 802
225 Ga0501033_0007810 3300049570 Bacteria 8290
226 Ga0501033_0046749 3300049570 Bacteria 3218
227 Ga0501033_0089308 3300049570 Bacteria 2254
228 Ga0501033_0116275 3300049570 Bacteria 1943
229 Ga0501033_0120273 3300049570 Bacteria 1906
230 Ga0501033_0129560 3300049570 Bacteria 1828
231 Ga0501034_0097308 3300049571 Bacteria 2939
232 Ga0501034_0103505 3300049571 Bacteria 2840
233 Ga0501034_0135233 3300049571 Bacteria 2446
234 Ga0501036_0034847 3300049572 Bacteria 4258
235 Ga0501036_0130466 3300049572 Bacteria 2122
236 Ga0501037_0045731 3300049573 Bacteria 3212
237 Ga0501038_0088706 3300049574 Bacteria 2596
238 Ga0501038_0114977 3300049574 Bacteria 2225
239 Ga0501038_0649219 3300049574 Bacteria 794
240 Ga0501039_0000973 3300049575 Bacteria 20799
241 Ga0501043_0066136 3300049579 Bacteria 2839
242 Ga0501043_0222222 3300049579 Bacteria 1461
243 Ga0501046_0003969 3300049580 Bacteria 13505
244 Ga0501046_0014477 3300049580 Bacteria 6655
245 Ga0501046_0500725 3300049580 Bacteria 870
246 Ga0501047_0007423 3300049581 Bacteria 10317
247 Ga0501047_0030776 3300049581 Bacteria 5173
248 Ga0501047_0035806 3300049581 Bacteria 4796
249 Ga0501047_0042535 3300049581 Bacteria 4390
250 Ga0501047_0084807 3300049581 Bacteria 3044
251 Ga0501047_1082229 3300049581 Bacteria 615
252 Ga0501047_1089558 3300049581 Bacteria 612
253 Ga0501048_0002706 3300049582 Bacteria 13521
254 Ga0501067_0000451 3300049583 Bacteria 22561
255 Ga0501068_0071363 3300049584 Bacteria 2120
256 Ga0501069_0023094 3300049585 Bacteria 3388
257 Ga0501070_0016828 3300049586 Bacteria 6138
258 Ga0501070_0121577 3300049586 Bacteria 2158
259 Ga0501073_0033222 3300049589 Bacteria 3674
260 Ga0501074_0071577 3300049590 Bacteria 2492
261 Ga0501074_0279184 3300049590 Bacteria 1188
262 Ga0501074_0512937 3300049590 Bacteria 849
263 Ga0501076_0230588 3300049592 Bacteria 1513
264 Ga0501079_0069245 3300049741 Bacteria 2723
265 Ga0501080_0145943 3300049742 Bacteria 2187
266 Ga0501080_0211919 3300049742 Bacteria 1775
267 Ga0501080_0474343 3300049742 Bacteria 1120
268 Ga0501083_0005421 3300049744 Bacteria 9034
269 Ga0501083_0470511 3300049744 Bacteria 818
270 Ga0501035_0001972 3300049822 Bacteria 20546
271 Ga0501035_0022013 3300049822 Bacteria 5856
272 Ga0501035_0082626 3300049822 Bacteria 2834
273 Ga0501035_0091006 3300049822 Bacteria 2685
274 Ga0501044_0010404 3300049823 Bacteria 10094
275 Ga0501044_0017042 3300049823 Bacteria 7795
276 Ga0501044_0053462 3300049823 Bacteria 4155
277 Ga0501044_0077907 3300049823 Bacteria 3360
278 Ga0501044_0118381 3300049823 Bacteria 2652
279 Ga0501044_0190153 3300049823 Bacteria 2016
280 Ga0501044_0278898 3300049823 Bacteria 1605
281 Ga0501044_0592334 3300049823 Bacteria 1002
282 Ga0501044_0706151 3300049823 Bacteria 893
283 Ga0501045_0022105 3300049824 Bacteria 4551
284 nmdc:mga00v17_391687_c1 3300050491 Bacteria 903
285 nmdc:mga08x19_838981_c1 3300050514 Bacteria 653
286 Ga0495601_0788062 3300053077 Bacteria 604
287 Ga0495595_0168193 3300053084 Bacteria 1084
288 Ga0495619_0036750 3300053085 Bacteria 3190
289 Ga0495619_0247383 3300053085 Bacteria 1235
290 Ga0500646_0068632 3300053090 Bacteria 1059
291 Ga0500554_084451 3300053102 Bacteria 1049
292 Ga0500593_163502 3300053117 Bacteria 848
293 Ga0500595_001332 3300053119 Bacteria 13364
294 Ga0500559_0065121 3300053136 Bacteria 1632
295 Ga0500559_0143182 3300053136 Bacteria 1120
296 Ga0500568_0027671 3300053139 Bacteria 2369
297 Ga0500568_0124848 3300053139 Bacteria 958
298 Ga0500603_139935 3300053150 Bacteria 744
299 Ga0500638_000810 3300053162 Bacteria 8620
300 Ga0500637_0000716 3300053178 Bacteria 13237
301 Ga0501084_0015981 3300054114 Bacteria 6229
302 Ga0500661_000675 3300055283 Bacteria 6405
303 Ga0501082_0037374 3300060353 Bacteria 4185

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_11008582 Ga0207668_110085822 142
2 3300053084 Ga0495595_0168193 Ga0495595_0168193_259_690 143
3 3300053085 Ga0495619_0247383 Ga0495619_0247383_67_498 143
4 3300005437 Ga0070710_10048707 Ga0070710_100487072 144
5 3300005439 Ga0070711_100297643 Ga0070711_1002976431 144
6 3300006173 Ga0070716_100963998 Ga0070716_1009639981 144
7 3300006175 Ga0070712_100009901 Ga0070712_1000099015 144
8 3300025898 Ga0207692_10009018 Ga0207692_100090182 144
9 3300025915 Ga0207693_10051456 Ga0207693_100514562 144
10 3300025939 Ga0207665_10440586 Ga0207665_104405862 144
11 iso_pu_bacteria 8016522445 8016530239 146
12 iso_pu_bacteria 8016530956 8016535498 146
13 iso_pu_bacteria 8016539877 8016548692 146
14 iso_pu_bacteria 8016548790 8016553441 146
15 iso_pu_bacteria 8016557553 8016561820 146
16 iso_pu_bacteria 8016566248 8016573828 146
17 iso_pu_bacteria 8016575299 8016577953 146
18 iso_pu_bacteria 8016595262 8016599652 146
19 iso_pu_bacteria 8016622563 8016627344 146
20 iso_pu_bacteria 8019530166 8019535230 146
21 iso_pu_bacteria 8019547302 8019554448 146
22 3300005327 Ga0070658_10812852 Ga0070658_108128521 149
23 3300005548 Ga0070665_100872592 Ga0070665_1008725922 149
24 3300005937 Ga0081455_10001970 Ga0081455_1000197011 149
25 3300005937 Ga0081455_10049676 Ga0081455_100496762 149
26 3300009093 Ga0105240_11432570 Ga0105240_114325702 149
27 3300013104 Ga0157370_11444460 Ga0157370_114444601 149
28 3300014325 Ga0163163_10481477 Ga0163163_104814773 149
29 3300025914 Ga0207671_10879622 Ga0207671_108796222 149
30 3300025928 Ga0207700_10307717 Ga0207700_103077172 149
31 3300026121 Ga0207683_10747041 Ga0207683_107470411 149
32 3300039450 Ga0436363_1086022 Ga0436363_1086022_75_527 149
33 3300046616 Ga0495668_0389061 Ga0495668_0389061_276_755 149
34 3300048907 Ga0496104_0163662 Ga0496104_0163662_26_475 149
35 3300048911 Ga0496108_0138179 Ga0496108_0138179_661_1110 149
36 3300048912 Ga0496109_0028567 Ga0496109_0028567_3672_4121 149
37 3300048913 Ga0496110_0091693 Ga0496110_0091693_1625_2074 149
38 3300048915 Ga0496112_0259195 Ga0496112_0259195_691_1140 149
39 3300048916 Ga0496113_0113333 Ga0496113_0113333_1609_2058 149
40 3300053139 Ga0500568_0124848 Ga0500568_0124848_465_917 149
41 iso_pu_bacteria 2897803580 2897805518 149
42 3300002459 JGI24751J29686_10092947 JGI24751J29686_100929471 150
43 3300005327 Ga0070658_10073511 Ga0070658_100735111 150
44 3300005327 Ga0070658_10104705 Ga0070658_101047053 150
45 3300005327 Ga0070658_10261212 Ga0070658_102612122 150
46 3300005329 Ga0070683_100456336 Ga0070683_1004563361 150
47 3300005331 Ga0070670_100005265 Ga0070670_1000052655 150
48 3300005331 Ga0070670_100185748 Ga0070670_1001857482 150
49 3300005335 Ga0070666_10003181 Ga0070666_100031813 150
50 3300005338 Ga0068868_100033560 Ga0068868_1000335601 150
51 3300005340 Ga0070689_100508481 Ga0070689_1005084811 150
52 3300005341 Ga0070691_10820892 Ga0070691_108208921 150
53 3300005344 Ga0070661_100000019 Ga0070661_100000019133 150
54 3300005366 Ga0070659_100799686 Ga0070659_1007996861 150
55 3300005367 Ga0070667_100081464 Ga0070667_1000814642 150
56 3300005435 Ga0070714_100056762 Ga0070714_1000567624 150
57 3300005439 Ga0070711_100329175 Ga0070711_1003291752 150
58 3300005439 Ga0070711_100651761 Ga0070711_1006517612 150
59 3300005455 Ga0070663_100532607 Ga0070663_1005326072 150
60 3300005455 Ga0070663_100737486 Ga0070663_1007374862 150
61 3300005456 Ga0070678_100699927 Ga0070678_1006999272 150
62 3300005458 Ga0070681_11103866 Ga0070681_111038662 150
63 3300005471 Ga0070698_100189095 Ga0070698_1001890952 150
64 3300005530 Ga0070679_100206729 Ga0070679_1002067292 150
65 3300005530 Ga0070679_100240701 Ga0070679_1002407012 150
66 3300005530 Ga0070679_100940396 Ga0070679_1009403962 150
67 3300005547 Ga0070693_100173448 Ga0070693_1001734483 150
68 3300005563 Ga0068855_100065220 Ga0068855_1000652206 150
69 3300005563 Ga0068855_100078236 Ga0068855_1000782363 150
70 3300005563 Ga0068855_100168358 Ga0068855_1001683583 150
71 3300005563 Ga0068855_100669679 Ga0068855_1006696791 150
72 3300005616 Ga0068852_100271299 Ga0068852_1002712992 150
73 3300006237 Ga0097621_100829933 Ga0097621_1008299332 150
74 3300006358 Ga0068871_100099837 Ga0068871_1000998374 150
75 3300007265 Ga0099794_10246234 Ga0099794_102462342 150
76 3300007788 Ga0099795_10000230 Ga0099795_1000023010 150
77 3300007788 Ga0099795_10090927 Ga0099795_100909272 150
78 3300007788 Ga0099795_10203019 Ga0099795_102030192 150
79 3300009093 Ga0105240_10042474 Ga0105240_100424747 150
80 3300009093 Ga0105240_10066210 Ga0105240_100662105 150
81 3300009093 Ga0105240_10288062 Ga0105240_102880624 150
82 3300009093 Ga0105240_10375312 Ga0105240_103753123 150
83 3300009093 Ga0105240_11147642 Ga0105240_111476422 150
84 3300009098 Ga0105245_10072752 Ga0105245_100727523 150
85 3300009098 Ga0105245_10153648 Ga0105245_101536482 150
86 3300009101 Ga0105247_10089750 Ga0105247_100897502 150
87 3300009148 Ga0105243_10875462 Ga0105243_108754621 150
88 3300009174 Ga0105241_10428944 Ga0105241_104289442 150
89 3300009177 Ga0105248_10352596 Ga0105248_103525962 150
90 3300009177 Ga0105248_12559892 Ga0105248_125598922 150
91 3300009545 Ga0105237_10235663 Ga0105237_102356633 150
92 3300009545 Ga0105237_10246571 Ga0105237_102465712 150
93 3300009545 Ga0105237_10256607 Ga0105237_102566072 150
94 3300009545 Ga0105237_10539228 Ga0105237_105392281 150
95 3300009545 Ga0105237_11105021 Ga0105237_111050212 150
96 3300009551 Ga0105238_10322242 Ga0105238_103222422 150
97 3300009551 Ga0105238_10622544 Ga0105238_106225442 150
98 3300009553 Ga0105249_10225608 Ga0105249_102256083 150
99 3300010159 Ga0099796_10010695 Ga0099796_100106952 150
100 3300010375 Ga0105239_10011951 Ga0105239_1001195110 150
101 3300010375 Ga0105239_10067115 Ga0105239_100671152 150
102 3300010375 Ga0105239_10143406 Ga0105239_101434062 150
103 3300010375 Ga0105239_10181329 Ga0105239_101813293 150
104 3300010375 Ga0105239_10355990 Ga0105239_103559903 150
105 3300010375 Ga0105239_10594294 Ga0105239_105942941 150
106 3300010375 Ga0105239_10750223 Ga0105239_107502232 150
107 3300011119 Ga0105246_10137101 Ga0105246_101371013 150
108 3300011119 Ga0105246_10677362 Ga0105246_106773622 150
109 3300013104 Ga0157370_10141037 Ga0157370_101410375 150
110 3300013104 Ga0157370_10161691 Ga0157370_101616912 150
111 3300013104 Ga0157370_10383113 Ga0157370_103831132 150
112 3300013104 Ga0157370_10811612 Ga0157370_108116122 150
113 3300013105 Ga0157369_10152283 Ga0157369_101522832 150
114 3300013296 Ga0157374_10277356 Ga0157374_102773562 150
115 3300013297 Ga0157378_10037828 Ga0157378_100378282 150
116 3300013306 Ga0163162_10048143 Ga0163162_100481432 150
117 3300014325 Ga0163163_10661975 Ga0163163_106619752 150
118 3300014969 Ga0157376_10064973 Ga0157376_100649734 150
119 3300014969 Ga0157376_10126801 Ga0157376_101268012 150
120 3300025272 Ga0209455_1030536 Ga0209455_10305362 150
121 3300025315 Ga0207697_10076095 Ga0207697_100760953 150
122 3300025903 Ga0207680_10009465 Ga0207680_100094656 150
123 3300025909 Ga0207705_10216833 Ga0207705_102168331 150
124 3300025909 Ga0207705_10313213 Ga0207705_103132132 150
125 3300025911 Ga0207654_10231877 Ga0207654_102318772 150
126 3300025912 Ga0207707_10512166 Ga0207707_105121662 150
127 3300025913 Ga0207695_10012690 Ga0207695_1001269012 150
128 3300025913 Ga0207695_10049960 Ga0207695_100499605 150
129 3300025913 Ga0207695_10060325 Ga0207695_100603253 150
130 3300025914 Ga0207671_10146455 Ga0207671_101464552 150
131 3300025914 Ga0207671_10241395 Ga0207671_102413952 150
132 3300025914 Ga0207671_10281386 Ga0207671_102813862 150
133 3300025914 Ga0207671_11351519 Ga0207671_113515191 150
134 3300025915 Ga0207693_10329938 Ga0207693_103299382 150
135 3300025916 Ga0207663_10278300 Ga0207663_102783002 150
136 3300025917 Ga0207660_10302978 Ga0207660_103029783 150
137 3300025919 Ga0207657_10711785 Ga0207657_107117852 150
138 3300025920 Ga0207649_10000382 Ga0207649_1000038211 150
139 3300025924 Ga0207694_10075570 Ga0207694_100755703 150
140 3300025924 Ga0207694_10437587 Ga0207694_104375871 150
141 3300025924 Ga0207694_11288833 Ga0207694_112888331 150
142 3300025926 Ga0207659_10245781 Ga0207659_102457812 150
143 3300025927 Ga0207687_10100480 Ga0207687_101004802 150
144 3300025928 Ga0207700_10125453 Ga0207700_101254532 150
145 3300025929 Ga0207664_10025604 Ga0207664_100256043 150
146 3300025929 Ga0207664_10049328 Ga0207664_100493282 150
147 3300025932 Ga0207690_10060145 Ga0207690_100601453 150
148 3300025935 Ga0207709_10988388 Ga0207709_109883881 150
149 3300025936 Ga0207670_10372877 Ga0207670_103728772 150
150 3300025938 Ga0207704_10561066 Ga0207704_105610662 150
151 3300025940 Ga0207691_10537611 Ga0207691_105376112 150
152 3300025941 Ga0207711_11661760 Ga0207711_116617602 150
153 3300025942 Ga0207689_10184655 Ga0207689_101846552 150
154 3300025945 Ga0207679_10235002 Ga0207679_102350021 150
155 3300025949 Ga0207667_10090592 Ga0207667_100905924 150
156 3300025949 Ga0207667_10494956 Ga0207667_104949562 150
157 3300025949 Ga0207667_10570640 Ga0207667_105706402 150
158 3300025960 Ga0207651_11305137 Ga0207651_113051371 150
159 3300025986 Ga0207658_10063343 Ga0207658_100633434 150
160 3300026023 Ga0207677_10288864 Ga0207677_102888642 150
161 3300026041 Ga0207639_10438395 Ga0207639_104383952 150
162 3300026041 Ga0207639_10706911 Ga0207639_107069111 150
163 3300026067 Ga0207678_10014082 Ga0207678_100140828 150
164 3300026078 Ga0207702_10197498 Ga0207702_101974983 150
165 3300026095 Ga0207676_10116748 Ga0207676_101167482 150
166 3300026116 Ga0207674_10117037 Ga0207674_101170373 150
167 3300026142 Ga0207698_10387529 Ga0207698_103875291 150
168 3300026142 Ga0207698_11140949 Ga0207698_111409492 150
169 3300028379 Ga0268266_10279216 Ga0268266_102792163 150
170 3300028379 Ga0268266_10534124 Ga0268266_105341241 150
171 3300028577 Ga0265318_10000839 Ga0265318_100008398 150
172 3300031241 Ga0265325_10010531 Ga0265325_100105313 150
173 3300031247 Ga0265340_10048261 Ga0265340_100482612 150
174 3300031249 Ga0265339_10054770 Ga0265339_100547702 150
175 3300031249 Ga0265339_10104596 Ga0265339_101045963 150
176 3300031250 Ga0265331_10022157 Ga0265331_100221575 150
177 3300031250 Ga0265331_10029275 Ga0265331_100292753 150
178 3300031344 Ga0265316_10017222 Ga0265316_100172224 150
179 3300031595 Ga0265313_10002435 Ga0265313_100024358 150
180 3300031595 Ga0265313_10005168 Ga0265313_1000516813 150
181 3300031711 Ga0265314_10006433 Ga0265314_100064339 150
182 3300031711 Ga0265314_10016266 Ga0265314_100162667 150
183 3300031711 Ga0265314_10080612 Ga0265314_100806122 150
184 3300031711 Ga0265314_10290957 Ga0265314_102909572 150
185 3300031712 Ga0265342_10224166 Ga0265342_102241662 150
186 3300031712 Ga0265342_10477722 Ga0265342_104777221 150
187 3300035088 Ga0373940_0155600 Ga0373940_0155600_166_627 150
188 3300035120 Ga0373957_0249865 Ga0373957_0249865_74_526 150
189 3300035171 Ga0373946_0082554 Ga0373946_0082554_31_492 150
190 3300035691 Ga0373931_1026454 Ga0373931_1026454_26_487 150
191 3300035692 Ga0373935_0570694 Ga0373935_0570694_76_537 150
192 3300035695 Ga0373927_0549234 Ga0373927_0549234_24_482 150
193 3300036401 Ga0373937_0010772 Ga0373937_0010772_1690_2142 150
194 3300036401 Ga0373937_0550619 Ga0373937_0550619_83_535 150
195 3300037068 Ga0373925_0251681 Ga0373925_0251681_65_541 150
196 3300037068 Ga0373925_1329503 Ga0373925_1329503_42_503 150
197 3300037466 Ga0395898_0655694 Ga0395898_0655694_195_710 150
198 3300041452 Ga0451793_1758379 Ga0451793_1758379_102_554 150
199 3300046476 Ga0495662_0086231 Ga0495662_0086231_975_1436 150
200 3300046492 Ga0495585_0313195 Ga0495585_0313195_93_569 150
201 3300046514 Ga0495618_0014379 Ga0495618_0014379_2483_2944 150
202 3300046531 Ga0495665_0131560 Ga0495665_0131560_184_645 150
203 3300046533 Ga0495640_0025682 Ga0495640_0025682_873_1334 150
204 3300046557 Ga0495622_0448694 Ga0495622_0448694_53_514 150
205 3300046559 Ga0495667_0396731 Ga0495667_0396731_380_841 150
206 3300046642 Ga0495634_0158696 Ga0495634_0158696_892_1353 150
207 3300046683 Ga0495658_0202579 Ga0495658_0202579_239_700 150
208 3300046689 Ga0495613_0072381 Ga0495613_0072381_1442_1903 150
209 3300046690 Ga0495624_0179221 Ga0495624_0179221_728_1189 150
210 3300046809 Ga0495600_0204528 Ga0495600_0204528_200_661 150
211 3300047315 Ga0495581_0623112 Ga0495581_0623112_152_613 150
212 3300047317 Ga0495604_0292356 Ga0495604_0292356_121_597 150
213 3300047322 Ga0495680_0487357 Ga0495680_0487357_220_672 150
214 3300047322 Ga0495680_0979483 Ga0495680_0979483_16_477 150
215 3300047444 Ga0495675_0225033 Ga0495675_0225033_79_531 150
216 3300047673 Ga0495593_0002840 Ga0495593_0002840_334_810 150
217 3300048088 Ga0495602_0490877 Ga0495602_0490877_49_501 150
218 3300048903 Ga0496100_0018161 Ga0496100_0018161_3384_3860 150
219 3300048904 Ga0496101_0003260 Ga0496101_0003260_3898_4374 150
220 3300048905 Ga0496102_0178801 Ga0496102_0178801_286_762 150
221 3300048905 Ga0496102_0908572 Ga0496102_0908572_105_581 150
222 3300048907 Ga0496104_0179807 Ga0496104_0179807_1067_1543 150
223 3300048908 Ga0496105_0377493 Ga0496105_0377493_464_940 150
224 3300048909 Ga0496106_0301371 Ga0496106_0301371_173_649 150
225 3300048911 Ga0496108_0026814 Ga0496108_0026814_1199_1675 150
226 3300048912 Ga0496109_0771392 Ga0496109_0771392_305_781 150
227 3300048917 Ga0496114_0101783 Ga0496114_0101783_1139_1600 150
228 3300048918 Ga0496115_0009324 Ga0496115_0009324_5069_5545 150
229 3300048918 Ga0496115_0025001 Ga0496115_0025001_2466_2927 150
230 3300048918 Ga0496115_0033725 Ga0496115_0033725_2753_3232 150
231 3300048923 Ga0496120_0181417 Ga0496120_0181417_428_916 150
232 3300048928 Ga0496125_0380105 Ga0496125_0380105_109_588 150
233 3300048929 Ga0496126_0019887 Ga0496126_0019887_4178_4630 150
234 3300048929 Ga0496126_0125167 Ga0496126_0125167_1415_1894 150
235 3300048929 Ga0496126_1184648 Ga0496126_1184648_31_483 150
236 3300049568 Ga0501031_0087528 Ga0501031_0087528_879_1346 150
237 3300049569 Ga0501032_0091759 Ga0501032_0091759_1195_1662 150
238 3300049569 Ga0501032_0298919 Ga0501032_0298919_566_1018 150
239 3300049569 Ga0501032_0472483 Ga0501032_0472483_119_571 150
240 3300049570 Ga0501033_0007810 Ga0501033_0007810_6429_6884 150
241 3300049570 Ga0501033_0046749 Ga0501033_0046749_263_718 150
242 3300049570 Ga0501033_0089308 Ga0501033_0089308_827_1279 150
243 3300049570 Ga0501033_0116275 Ga0501033_0116275_831_1283 150
244 3300049570 Ga0501033_0120273 Ga0501033_0120273_1215_1682 150
245 3300049570 Ga0501033_0129560 Ga0501033_0129560_225_677 150
246 3300049571 Ga0501034_0097308 Ga0501034_0097308_1996_2448 150
247 3300049571 Ga0501034_0103505 Ga0501034_0103505_1394_1861 150
248 3300049571 Ga0501034_0135233 Ga0501034_0135233_203_658 150
249 3300049572 Ga0501036_0034847 Ga0501036_0034847_3285_3752 150
250 3300049572 Ga0501036_0130466 Ga0501036_0130466_471_923 150
251 3300049573 Ga0501037_0045731 Ga0501037_0045731_1863_2330 150
252 3300049574 Ga0501038_0088706 Ga0501038_0088706_1890_2345 150
253 3300049574 Ga0501038_0114977 Ga0501038_0114977_980_1432 150
254 3300049574 Ga0501038_0649219 Ga0501038_0649219_249_701 150
255 3300049575 Ga0501039_0000973 Ga0501039_0000973_3051_3518 150
256 3300049579 Ga0501043_0066136 Ga0501043_0066136_438_893 150
257 3300049579 Ga0501043_0222222 Ga0501043_0222222_378_830 150
258 3300049580 Ga0501046_0003969 Ga0501046_0003969_3404_3871 150
259 3300049580 Ga0501046_0014477 Ga0501046_0014477_3685_4140 150
260 3300049580 Ga0501046_0500725 Ga0501046_0500725_81_533 150
261 3300049581 Ga0501047_0007423 Ga0501047_0007423_4239_4727 150
262 3300049581 Ga0501047_0030776 Ga0501047_0030776_2670_3134 150
263 3300049581 Ga0501047_0035806 Ga0501047_0035806_29_484 150
264 3300049581 Ga0501047_0042535 Ga0501047_0042535_1228_1680 150
265 3300049581 Ga0501047_0084807 Ga0501047_0084807_713_1180 150
266 3300049581 Ga0501047_1082229 Ga0501047_1082229_39_491 150
267 3300049581 Ga0501047_1089558 Ga0501047_1089558_150_602 150
268 3300049582 Ga0501048_0002706 Ga0501048_0002706_5037_5504 150
269 3300049583 Ga0501067_0000451 Ga0501067_0000451_1365_1832 150
270 3300049584 Ga0501068_0071363 Ga0501068_0071363_403_858 150
271 3300049585 Ga0501069_0023094 Ga0501069_0023094_1206_1673 150
272 3300049586 Ga0501070_0016828 Ga0501070_0016828_4960_5427 150
273 3300049586 Ga0501070_0121577 Ga0501070_0121577_1269_1724 150
274 3300049589 Ga0501073_0033222 Ga0501073_0033222_1993_2460 150
275 3300049590 Ga0501074_0071577 Ga0501074_0071577_353_820 150
276 3300049590 Ga0501074_0279184 Ga0501074_0279184_395_925 150
277 3300049590 Ga0501074_0512937 Ga0501074_0512937_266_721 150
278 3300049592 Ga0501076_0230588 Ga0501076_0230588_726_1193 150
279 3300049741 Ga0501079_0069245 Ga0501079_0069245_890_1357 150
280 3300049742 Ga0501080_0145943 Ga0501080_0145943_26_478 150
281 3300049742 Ga0501080_0211919 Ga0501080_0211919_881_1336 150
282 3300049742 Ga0501080_0474343 Ga0501080_0474343_394_846 150
283 3300049744 Ga0501083_0005421 Ga0501083_0005421_6969_7436 150
284 3300049744 Ga0501083_0470511 Ga0501083_0470511_151_603 150
285 3300049822 Ga0501035_0001972 Ga0501035_0001972_16030_16482 150
286 3300049822 Ga0501035_0022013 Ga0501035_0022013_1679_2143 150
287 3300049822 Ga0501035_0082626 Ga0501035_0082626_1782_2249 150
288 3300049822 Ga0501035_0091006 Ga0501035_0091006_1861_2313 150
289 3300049823 Ga0501044_0010404 Ga0501044_0010404_1981_2433 150
290 3300049823 Ga0501044_0017042 Ga0501044_0017042_4324_4791 150
291 3300049823 Ga0501044_0053462 Ga0501044_0053462_1648_2112 150
292 3300049823 Ga0501044_0077907 Ga0501044_0077907_2575_3027 150
293 3300049823 Ga0501044_0118381 Ga0501044_0118381_1837_2289 150
294 3300049823 Ga0501044_0190153 Ga0501044_0190153_1432_1887 150
295 3300049823 Ga0501044_0278898 Ga0501044_0278898_775_1227 150
296 3300049823 Ga0501044_0592334 Ga0501044_0592334_147_599 150
297 3300049823 Ga0501044_0706151 Ga0501044_0706151_203_658 150
298 3300049824 Ga0501045_0022105 Ga0501045_0022105_250_717 150
299 3300050491 nmdc:mga00v17_391687_c1 nmdc:mga00v17_391687_c1_257_709 150
300 3300050514 nmdc:mga08x19_838981_c1 nmdc:mga08x19_838981_c1_158_616 150
301 3300053077 Ga0495601_0788062 Ga0495601_0788062_23_484 150
302 3300053085 Ga0495619_0036750 Ga0495619_0036750_2079_2540 150
303 3300053090 Ga0500646_0068632 Ga0500646_0068632_339_791 150
304 3300053102 Ga0500554_084451 Ga0500554_084451_557_1033 150
305 3300053117 Ga0500593_163502 Ga0500593_163502_381_833 150
306 3300053119 Ga0500595_001332 Ga0500595_001332_4479_4955 150
307 3300053136 Ga0500559_0065121 Ga0500559_0065121_234_776 150
308 3300053136 Ga0500559_0143182 Ga0500559_0143182_452_928 150
309 3300053139 Ga0500568_0027671 Ga0500568_0027671_607_1059 150
310 3300053150 Ga0500603_139935 Ga0500603_139935_149_625 150
311 3300053162 Ga0500638_000810 Ga0500638_000810_3309_3785 150
312 3300053178 Ga0500637_0000716 Ga0500637_0000716_3162_3638 150
313 3300054114 Ga0501084_0015981 Ga0501084_0015981_4335_4802 150
314 3300055283 Ga0500661_000675 Ga0500661_000675_659_1135 150
315 3300060353 Ga0501082_0037374 Ga0501082_0037374_536_1003 150
316 iso_pu_bacteria 2932794094 2932800772 150
317 iso_pu_bacteria 2932801729 2932803390 150
318 iso_pu_bacteria 2935608549 2935611882 150
319 iso_pu_bacteria 2935819856 2935821362 150
320 iso_pu_bacteria 2935847175 2935850379 150
321 iso_pu_bacteria 2935883170 2935886462 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14489

QueF

QueF-like protein

80

160

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f8b-assembly1.cif.gz_B-2 crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef 0.9413 23 136
5k0p-assembly1.cif.gz_B crystal structure of the archaeosine synthase quef-like in the apo form 0.9143 32 133
3bp1-assembly1.cif.gz_D crystal structure of putative 7-cyano-7-deazaguanine reductase quef from vibrio cholerae o1 biovar eltor 0.9116 33 126
5k0p-assembly1.cif.gz_B crystal structure of the archaeosine synthase quef-like in the apo form 0.9057 32 133
7alc-assembly1.cif.gz_D-2 human gch-gfrp stimulatory complex 0.9026 25 130
ID Description Score Start End Superfamily
af_Q2G081_22_166_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9406 14 131 3.30.1130.10
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8568 33 130 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8317 24 126 3.30.1130.10
3bp1A01 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8312 17 113 3.30.1130.10
3rzpD02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8101 33 139 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A520IJI0-F1-model_v4 PreQ(1) synthase (EC 1.7.1.13) 0.9927 6 112 GO:0005737
GO:0008616
GO:0033739
AF-Q9RNJ7-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9926 7 115 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A3B8XPT8-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (EC 1.7.1.13) 0.9869 3 119 GO:0005737
GO:0008616
GO:0033739
AF-A0A7C0W7L9-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (EC 1.7.1.13) 0.9798 22 129 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-K1ZKZ5-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.979 23 130 GO:0005737
GO:0006400
GO:0008616
GO:0033739

Feature Viewer

pLDDT pTM Quality
90.37 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map