F406174
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 321 | 205 | 303 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300049590|Ga0501074_0279184|Ga0501074_0279184_395_925 |
| Length | 176 |
| Sequence | MAKRQERHVKRVSRSGGPAKATNAASPGERLTQLGRQVAQPASPDKAVLEAVPNPHPDADYVVRFTAPEFTTLCPITGQPDFAHFVIDYVPGRSIVESKSLKLYLTSFRNVGSFHEATTIAIAKRIVAACRPKYLRIGGYWYPRGGIPIDVFWQTGRLPKGVWLPDPGVAPYKGRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 2 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 3 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 4 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 5 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 6 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 7 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 37 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 99 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 100 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 101 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 103 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 107 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 108 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 109 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 110 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 112 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 113 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 116 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 117 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 118 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 140 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 141 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 142 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 143 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 146 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 147 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 148 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 149 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 150 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 151 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 152 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 153 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 179 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 184 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 185 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 186 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 187 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 188 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 189 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 190 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 191 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 192 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 194 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 196 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 197 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 198 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 199 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 200 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 201 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 202 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 203 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 204 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 205 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.39 |
| Metatranscriptomes | 0 |
| Isolates | 5.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.36 |
| Nodule | 5.3 |
| Rhizoplane | 6.23 |
| Rhizosphere | 81.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10092947 | 3300002459 | Bacteria | 628 |
| 2 | Ga0070658_10073511 | 3300005327 | Bacteria | 2803 |
| 3 | Ga0070658_10104705 | 3300005327 | Bacteria | 2341 |
| 4 | Ga0070658_10261212 | 3300005327 | Bacteria | 1471 |
| 5 | Ga0070658_10812852 | 3300005327 | Bacteria | 812 |
| 6 | Ga0070683_100456336 | 3300005329 | Bacteria | 1220 |
| 7 | Ga0070670_100005265 | 3300005331 | Bacteria | 10896 |
| 8 | Ga0070670_100185748 | 3300005331 | Bacteria | 1805 |
| 9 | Ga0070666_10003181 | 3300005335 | Bacteria | 9975 |
| 10 | Ga0068868_100033560 | 3300005338 | Bacteria | 3956 |
| 11 | Ga0070689_100508481 | 3300005340 | Bacteria | 1033 |
| 12 | Ga0070691_10820892 | 3300005341 | Bacteria | 568 |
| 13 | Ga0070661_100000019 | 3300005344 | Bacteria | 132428 |
| 14 | Ga0070659_100799686 | 3300005366 | Bacteria | 820 |
| 15 | Ga0070667_100081464 | 3300005367 | Bacteria | 2770 |
| 16 | Ga0070714_100056762 | 3300005435 | Bacteria | 3350 |
| 17 | Ga0070710_10048707 | 3300005437 | Bacteria | 2368 |
| 18 | Ga0070711_100297643 | 3300005439 | Bacteria | 1282 |
| 19 | Ga0070711_100329175 | 3300005439 | Bacteria | 1222 |
| 20 | Ga0070711_100651761 | 3300005439 | Bacteria | 883 |
| 21 | Ga0070663_100532607 | 3300005455 | Bacteria | 979 |
| 22 | Ga0070663_100737486 | 3300005455 | Bacteria | 840 |
| 23 | Ga0070678_100699927 | 3300005456 | Bacteria | 913 |
| 24 | Ga0070681_11103866 | 3300005458 | Bacteria | 714 |
| 25 | Ga0070698_100189095 | 3300005471 | Bacteria | 1997 |
| 26 | Ga0070679_100206729 | 3300005530 | Bacteria | 1927 |
| 27 | Ga0070679_100240701 | 3300005530 | Bacteria | 1767 |
| 28 | Ga0070679_100940396 | 3300005530 | Bacteria | 808 |
| 29 | Ga0070693_100173448 | 3300005547 | Bacteria | 1383 |
| 30 | Ga0070665_100872592 | 3300005548 | Bacteria | 913 |
| 31 | Ga0068855_100065220 | 3300005563 | Bacteria | 4246 |
| 32 | Ga0068855_100078236 | 3300005563 | Bacteria | 3837 |
| 33 | Ga0068855_100168358 | 3300005563 | Bacteria | 2482 |
| 34 | Ga0068855_100669679 | 3300005563 | Bacteria | 1113 |
| 35 | Ga0068852_100271299 | 3300005616 | Bacteria | 1632 |
| 36 | Ga0081455_10001970 | 3300005937 | Bacteria | 24598 |
| 37 | Ga0081455_10049676 | 3300005937 | Bacteria | 3614 |
| 38 | Ga0070716_100963998 | 3300006173 | Bacteria | 672 |
| 39 | Ga0070712_100009901 | 3300006175 | Bacteria | 6010 |
| 40 | Ga0097621_100829933 | 3300006237 | Bacteria | 858 |
| 41 | Ga0068871_100099837 | 3300006358 | Bacteria | 2430 |
| 42 | Ga0099794_10246234 | 3300007265 | Bacteria | 921 |
| 43 | Ga0099795_10000230 | 3300007788 | Bacteria | 9773 |
| 44 | Ga0099795_10090927 | 3300007788 | Bacteria | 1183 |
| 45 | Ga0099795_10203019 | 3300007788 | Bacteria | 837 |
| 46 | Ga0105240_10042474 | 3300009093 | Bacteria | 5793 |
| 47 | Ga0105240_10066210 | 3300009093 | Bacteria | 4483 |
| 48 | Ga0105240_10288062 | 3300009093 | Bacteria | 1884 |
| 49 | Ga0105240_10375312 | 3300009093 | Bacteria | 1607 |
| 50 | Ga0105240_11147642 | 3300009093 | Bacteria | 825 |
| 51 | Ga0105240_11432570 | 3300009093 | Bacteria | 726 |
| 52 | Ga0105245_10072752 | 3300009098 | Bacteria | 3124 |
| 53 | Ga0105245_10153648 | 3300009098 | Bacteria | 2178 |
| 54 | Ga0105247_10089750 | 3300009101 | Bacteria | 1949 |
| 55 | Ga0105243_10875462 | 3300009148 | Bacteria | 891 |
| 56 | Ga0105241_10428944 | 3300009174 | Bacteria | 1165 |
| 57 | Ga0105248_10352596 | 3300009177 | Bacteria | 1657 |
| 58 | Ga0105248_12559892 | 3300009177 | Bacteria | 582 |
| 59 | Ga0105237_10235663 | 3300009545 | Bacteria | 1831 |
| 60 | Ga0105237_10246571 | 3300009545 | Bacteria | 1788 |
| 61 | Ga0105237_10256607 | 3300009545 | Bacteria | 1750 |
| 62 | Ga0105237_10539228 | 3300009545 | Bacteria | 1173 |
| 63 | Ga0105237_11105021 | 3300009545 | Bacteria | 800 |
| 64 | Ga0105238_10322242 | 3300009551 | Bacteria | 1532 |
| 65 | Ga0105238_10622544 | 3300009551 | Bacteria | 1088 |
| 66 | Ga0105249_10225608 | 3300009553 | Bacteria | 1845 |
| 67 | Ga0099796_10010695 | 3300010159 | Bacteria | 2532 |
| 68 | Ga0105239_10011951 | 3300010375 | Bacteria | 9682 |
| 69 | Ga0105239_10067115 | 3300010375 | Bacteria | 3940 |
| 70 | Ga0105239_10143406 | 3300010375 | Bacteria | 2662 |
| 71 | Ga0105239_10181329 | 3300010375 | Bacteria | 2356 |
| 72 | Ga0105239_10355990 | 3300010375 | Bacteria | 1653 |
| 73 | Ga0105239_10594294 | 3300010375 | Bacteria | 1262 |
| 74 | Ga0105239_10750223 | 3300010375 | Bacteria | 1117 |
| 75 | Ga0105246_10137101 | 3300011119 | Bacteria | 1835 |
| 76 | Ga0105246_10677362 | 3300011119 | Bacteria | 901 |
| 77 | Ga0157370_10141037 | 3300013104 | Bacteria | 2245 |
| 78 | Ga0157370_10161691 | 3300013104 | Bacteria | 2083 |
| 79 | Ga0157370_10383113 | 3300013104 | Bacteria | 1295 |
| 80 | Ga0157370_10811612 | 3300013104 | Bacteria | 851 |
| 81 | Ga0157370_11444460 | 3300013104 | Bacteria | 619 |
| 82 | Ga0157369_10152283 | 3300013105 | Bacteria | 2444 |
| 83 | Ga0157374_10277356 | 3300013296 | Bacteria | 1654 |
| 84 | Ga0157378_10037828 | 3300013297 | Bacteria | 4276 |
| 85 | Ga0163162_10048143 | 3300013306 | Bacteria | 4271 |
| 86 | Ga0163163_10481477 | 3300014325 | Bacteria | 1302 |
| 87 | Ga0163163_10661975 | 3300014325 | Bacteria | 1108 |
| 88 | Ga0157376_10064973 | 3300014969 | Bacteria | 3079 |
| 89 | Ga0157376_10126801 | 3300014969 | Bacteria | 2272 |
| 90 | Ga0209455_1030536 | 3300025272 | Bacteria | 917 |
| 91 | Ga0207697_10076095 | 3300025315 | Bacteria | 1410 |
| 92 | Ga0207692_10009018 | 3300025898 | Bacteria | 4152 |
| 93 | Ga0207680_10009465 | 3300025903 | Bacteria | 4835 |
| 94 | Ga0207705_10216833 | 3300025909 | Bacteria | 1452 |
| 95 | Ga0207705_10313213 | 3300025909 | Bacteria | 1205 |
| 96 | Ga0207654_10231877 | 3300025911 | Bacteria | 1230 |
| 97 | Ga0207707_10512166 | 3300025912 | Bacteria | 1022 |
| 98 | Ga0207695_10012690 | 3300025913 | Bacteria | 10091 |
| 99 | Ga0207695_10049960 | 3300025913 | Bacteria | 4402 |
| 100 | Ga0207695_10060325 | 3300025913 | Bacteria | 3927 |
| 101 | Ga0207671_10146455 | 3300025914 | Bacteria | 1822 |
| 102 | Ga0207671_10241395 | 3300025914 | Bacteria | 1419 |
| 103 | Ga0207671_10281386 | 3300025914 | Bacteria | 1312 |
| 104 | Ga0207671_10879622 | 3300025914 | Bacteria | 709 |
| 105 | Ga0207671_11351519 | 3300025914 | Bacteria | 554 |
| 106 | Ga0207693_10051456 | 3300025915 | Bacteria | 3232 |
| 107 | Ga0207693_10329938 | 3300025915 | Bacteria | 1194 |
| 108 | Ga0207663_10278300 | 3300025916 | Bacteria | 1242 |
| 109 | Ga0207660_10302978 | 3300025917 | Bacteria | 1273 |
| 110 | Ga0207657_10711785 | 3300025919 | Bacteria | 779 |
| 111 | Ga0207649_10000382 | 3300025920 | Bacteria | 33119 |
| 112 | Ga0207694_10075570 | 3300025924 | Bacteria | 2637 |
| 113 | Ga0207694_10437587 | 3300025924 | Bacteria | 1091 |
| 114 | Ga0207694_11288833 | 3300025924 | Bacteria | 618 |
| 115 | Ga0207659_10245781 | 3300025926 | Bacteria | 1450 |
| 116 | Ga0207687_10100480 | 3300025927 | Bacteria | 2128 |
| 117 | Ga0207700_10125453 | 3300025928 | Bacteria | 2088 |
| 118 | Ga0207700_10307717 | 3300025928 | Bacteria | 1370 |
| 119 | Ga0207664_10025604 | 3300025929 | Bacteria | 4449 |
| 120 | Ga0207664_10049328 | 3300025929 | Bacteria | 3314 |
| 121 | Ga0207690_10060145 | 3300025932 | Bacteria | 2577 |
| 122 | Ga0207709_10988388 | 3300025935 | Bacteria | 687 |
| 123 | Ga0207670_10372877 | 3300025936 | Bacteria | 1135 |
| 124 | Ga0207704_10561066 | 3300025938 | Bacteria | 929 |
| 125 | Ga0207665_10440586 | 3300025939 | Bacteria | 998 |
| 126 | Ga0207691_10537611 | 3300025940 | Bacteria | 991 |
| 127 | Ga0207711_11661760 | 3300025941 | Bacteria | 582 |
| 128 | Ga0207689_10184655 | 3300025942 | Bacteria | 1720 |
| 129 | Ga0207679_10235002 | 3300025945 | Bacteria | 1550 |
| 130 | Ga0207667_10090592 | 3300025949 | Bacteria | 3160 |
| 131 | Ga0207667_10494956 | 3300025949 | Bacteria | 1240 |
| 132 | Ga0207667_10570640 | 3300025949 | Bacteria | 1143 |
| 133 | Ga0207651_11305137 | 3300025960 | Bacteria | 652 |
| 134 | Ga0207668_11008582 | 3300025972 | Bacteria | 744 |
| 135 | Ga0207658_10063343 | 3300025986 | Bacteria | 2771 |
| 136 | Ga0207677_10288864 | 3300026023 | Bacteria | 1350 |
| 137 | Ga0207639_10438395 | 3300026041 | Bacteria | 1184 |
| 138 | Ga0207639_10706911 | 3300026041 | Bacteria | 935 |
| 139 | Ga0207678_10014082 | 3300026067 | Bacteria | 7032 |
| 140 | Ga0207702_10197498 | 3300026078 | Bacteria | 1863 |
| 141 | Ga0207676_10116748 | 3300026095 | Bacteria | 2243 |
| 142 | Ga0207674_10117037 | 3300026116 | Bacteria | 2636 |
| 143 | Ga0207683_10747041 | 3300026121 | Bacteria | 908 |
| 144 | Ga0207698_10387529 | 3300026142 | Bacteria | 1331 |
| 145 | Ga0207698_11140949 | 3300026142 | Bacteria | 793 |
| 146 | Ga0268266_10279216 | 3300028379 | Bacteria | 1552 |
| 147 | Ga0268266_10534124 | 3300028379 | Bacteria | 1122 |
| 148 | Ga0265318_10000839 | 3300028577 | Bacteria | 20229 |
| 149 | Ga0265325_10010531 | 3300031241 | Bacteria | 5351 |
| 150 | Ga0265340_10048261 | 3300031247 | Bacteria | 2071 |
| 151 | Ga0265339_10054770 | 3300031249 | Bacteria | 2165 |
| 152 | Ga0265339_10104596 | 3300031249 | Bacteria | 1470 |
| 153 | Ga0265331_10022157 | 3300031250 | Bacteria | 3244 |
| 154 | Ga0265331_10029275 | 3300031250 | Bacteria | 2750 |
| 155 | Ga0265316_10017222 | 3300031344 | Bacteria | 6252 |
| 156 | Ga0265313_10002435 | 3300031595 | Bacteria | 16058 |
| 157 | Ga0265313_10005168 | 3300031595 | Bacteria | 9695 |
| 158 | Ga0265314_10006433 | 3300031711 | Bacteria | 10403 |
| 159 | Ga0265314_10016266 | 3300031711 | Bacteria | 5884 |
| 160 | Ga0265314_10080612 | 3300031711 | Bacteria | 2149 |
| 161 | Ga0265314_10290957 | 3300031711 | Bacteria | 920 |
| 162 | Ga0265342_10224166 | 3300031712 | Bacteria | 1012 |
| 163 | Ga0265342_10477722 | 3300031712 | Bacteria | 637 |
| 164 | Ga0373940_0155600 | 3300035088 | Bacteria | 731 |
| 165 | Ga0373957_0249865 | 3300035120 | Bacteria | 746 |
| 166 | Ga0373946_0082554 | 3300035171 | Bacteria | 1410 |
| 167 | Ga0373931_1026454 | 3300035691 | Bacteria | 559 |
| 168 | Ga0373935_0570694 | 3300035692 | Bacteria | 826 |
| 169 | Ga0373927_0549234 | 3300035695 | Bacteria | 763 |
| 170 | Ga0373937_0010772 | 3300036401 | Bacteria | 8003 |
| 171 | Ga0373937_0550619 | 3300036401 | Bacteria | 1096 |
| 172 | Ga0373925_0251681 | 3300037068 | Bacteria | 1417 |
| 173 | Ga0373925_1329503 | 3300037068 | Bacteria | 589 |
| 174 | Ga0395898_0655694 | 3300037466 | Bacteria | 992 |
| 175 | Ga0436363_1086022 | 3300039450 | Bacteria | 634 |
| 176 | Ga0451793_1758379 | 3300041452 | Bacteria | 763 |
| 177 | Ga0495662_0086231 | 3300046476 | Bacteria | 1529 |
| 178 | Ga0495585_0313195 | 3300046492 | Bacteria | 769 |
| 179 | Ga0495618_0014379 | 3300046514 | Bacteria | 4822 |
| 180 | Ga0495665_0131560 | 3300046531 | Bacteria | 1310 |
| 181 | Ga0495640_0025682 | 3300046533 | Bacteria | 4268 |
| 182 | Ga0495622_0448694 | 3300046557 | Bacteria | 553 |
| 183 | Ga0495667_0396731 | 3300046559 | Bacteria | 869 |
| 184 | Ga0495668_0389061 | 3300046616 | Bacteria | 766 |
| 185 | Ga0495634_0158696 | 3300046642 | Bacteria | 1427 |
| 186 | Ga0495658_0202579 | 3300046683 | Bacteria | 1237 |
| 187 | Ga0495613_0072381 | 3300046689 | Bacteria | 2512 |
| 188 | Ga0495624_0179221 | 3300046690 | Bacteria | 1292 |
| 189 | Ga0495600_0204528 | 3300046809 | Bacteria | 1267 |
| 190 | Ga0495581_0623112 | 3300047315 | Bacteria | 624 |
| 191 | Ga0495604_0292356 | 3300047317 | Bacteria | 1097 |
| 192 | Ga0495680_0487357 | 3300047322 | Bacteria | 839 |
| 193 | Ga0495680_0979483 | 3300047322 | Bacteria | 541 |
| 194 | Ga0495675_0225033 | 3300047444 | Bacteria | 1134 |
| 195 | Ga0495593_0002840 | 3300047673 | Bacteria | 10434 |
| 196 | Ga0495602_0490877 | 3300048088 | Bacteria | 860 |
| 197 | Ga0496100_0018161 | 3300048903 | Bacteria | 4167 |
| 198 | Ga0496101_0003260 | 3300048904 | Bacteria | 10084 |
| 199 | Ga0496102_0178801 | 3300048905 | Bacteria | 1998 |
| 200 | Ga0496102_0908572 | 3300048905 | Bacteria | 802 |
| 201 | Ga0496104_0163662 | 3300048907 | Bacteria | 2133 |
| 202 | Ga0496104_0179807 | 3300048907 | Bacteria | 2025 |
| 203 | Ga0496105_0377493 | 3300048908 | Bacteria | 1128 |
| 204 | Ga0496106_0301371 | 3300048909 | Bacteria | 1285 |
| 205 | Ga0496108_0026814 | 3300048911 | Bacteria | 4755 |
| 206 | Ga0496108_0138179 | 3300048911 | Bacteria | 2098 |
| 207 | Ga0496109_0028567 | 3300048912 | Bacteria | 4988 |
| 208 | Ga0496109_0771392 | 3300048912 | Bacteria | 899 |
| 209 | Ga0496110_0091693 | 3300048913 | Bacteria | 2718 |
| 210 | Ga0496112_0259195 | 3300048915 | Bacteria | 1688 |
| 211 | Ga0496113_0113333 | 3300048916 | Bacteria | 2113 |
| 212 | Ga0496114_0101783 | 3300048917 | Bacteria | 2453 |
| 213 | Ga0496115_0009324 | 3300048918 | Bacteria | 7292 |
| 214 | Ga0496115_0025001 | 3300048918 | Bacteria | 4646 |
| 215 | Ga0496115_0033725 | 3300048918 | Bacteria | 4043 |
| 216 | Ga0496120_0181417 | 3300048923 | Bacteria | 1033 |
| 217 | Ga0496125_0380105 | 3300048928 | Bacteria | 833 |
| 218 | Ga0496126_0019887 | 3300048929 | Bacteria | 6602 |
| 219 | Ga0496126_0125167 | 3300048929 | Bacteria | 2226 |
| 220 | Ga0496126_1184648 | 3300048929 | Bacteria | 563 |
| 221 | Ga0501031_0087528 | 3300049568 | Bacteria | 2031 |
| 222 | Ga0501032_0091759 | 3300049569 | Bacteria | 2014 |
| 223 | Ga0501032_0298919 | 3300049569 | Bacteria | 1041 |
| 224 | Ga0501032_0472483 | 3300049569 | Bacteria | 802 |
| 225 | Ga0501033_0007810 | 3300049570 | Bacteria | 8290 |
| 226 | Ga0501033_0046749 | 3300049570 | Bacteria | 3218 |
| 227 | Ga0501033_0089308 | 3300049570 | Bacteria | 2254 |
| 228 | Ga0501033_0116275 | 3300049570 | Bacteria | 1943 |
| 229 | Ga0501033_0120273 | 3300049570 | Bacteria | 1906 |
| 230 | Ga0501033_0129560 | 3300049570 | Bacteria | 1828 |
| 231 | Ga0501034_0097308 | 3300049571 | Bacteria | 2939 |
| 232 | Ga0501034_0103505 | 3300049571 | Bacteria | 2840 |
| 233 | Ga0501034_0135233 | 3300049571 | Bacteria | 2446 |
| 234 | Ga0501036_0034847 | 3300049572 | Bacteria | 4258 |
| 235 | Ga0501036_0130466 | 3300049572 | Bacteria | 2122 |
| 236 | Ga0501037_0045731 | 3300049573 | Bacteria | 3212 |
| 237 | Ga0501038_0088706 | 3300049574 | Bacteria | 2596 |
| 238 | Ga0501038_0114977 | 3300049574 | Bacteria | 2225 |
| 239 | Ga0501038_0649219 | 3300049574 | Bacteria | 794 |
| 240 | Ga0501039_0000973 | 3300049575 | Bacteria | 20799 |
| 241 | Ga0501043_0066136 | 3300049579 | Bacteria | 2839 |
| 242 | Ga0501043_0222222 | 3300049579 | Bacteria | 1461 |
| 243 | Ga0501046_0003969 | 3300049580 | Bacteria | 13505 |
| 244 | Ga0501046_0014477 | 3300049580 | Bacteria | 6655 |
| 245 | Ga0501046_0500725 | 3300049580 | Bacteria | 870 |
| 246 | Ga0501047_0007423 | 3300049581 | Bacteria | 10317 |
| 247 | Ga0501047_0030776 | 3300049581 | Bacteria | 5173 |
| 248 | Ga0501047_0035806 | 3300049581 | Bacteria | 4796 |
| 249 | Ga0501047_0042535 | 3300049581 | Bacteria | 4390 |
| 250 | Ga0501047_0084807 | 3300049581 | Bacteria | 3044 |
| 251 | Ga0501047_1082229 | 3300049581 | Bacteria | 615 |
| 252 | Ga0501047_1089558 | 3300049581 | Bacteria | 612 |
| 253 | Ga0501048_0002706 | 3300049582 | Bacteria | 13521 |
| 254 | Ga0501067_0000451 | 3300049583 | Bacteria | 22561 |
| 255 | Ga0501068_0071363 | 3300049584 | Bacteria | 2120 |
| 256 | Ga0501069_0023094 | 3300049585 | Bacteria | 3388 |
| 257 | Ga0501070_0016828 | 3300049586 | Bacteria | 6138 |
| 258 | Ga0501070_0121577 | 3300049586 | Bacteria | 2158 |
| 259 | Ga0501073_0033222 | 3300049589 | Bacteria | 3674 |
| 260 | Ga0501074_0071577 | 3300049590 | Bacteria | 2492 |
| 261 | Ga0501074_0279184 | 3300049590 | Bacteria | 1188 |
| 262 | Ga0501074_0512937 | 3300049590 | Bacteria | 849 |
| 263 | Ga0501076_0230588 | 3300049592 | Bacteria | 1513 |
| 264 | Ga0501079_0069245 | 3300049741 | Bacteria | 2723 |
| 265 | Ga0501080_0145943 | 3300049742 | Bacteria | 2187 |
| 266 | Ga0501080_0211919 | 3300049742 | Bacteria | 1775 |
| 267 | Ga0501080_0474343 | 3300049742 | Bacteria | 1120 |
| 268 | Ga0501083_0005421 | 3300049744 | Bacteria | 9034 |
| 269 | Ga0501083_0470511 | 3300049744 | Bacteria | 818 |
| 270 | Ga0501035_0001972 | 3300049822 | Bacteria | 20546 |
| 271 | Ga0501035_0022013 | 3300049822 | Bacteria | 5856 |
| 272 | Ga0501035_0082626 | 3300049822 | Bacteria | 2834 |
| 273 | Ga0501035_0091006 | 3300049822 | Bacteria | 2685 |
| 274 | Ga0501044_0010404 | 3300049823 | Bacteria | 10094 |
| 275 | Ga0501044_0017042 | 3300049823 | Bacteria | 7795 |
| 276 | Ga0501044_0053462 | 3300049823 | Bacteria | 4155 |
| 277 | Ga0501044_0077907 | 3300049823 | Bacteria | 3360 |
| 278 | Ga0501044_0118381 | 3300049823 | Bacteria | 2652 |
| 279 | Ga0501044_0190153 | 3300049823 | Bacteria | 2016 |
| 280 | Ga0501044_0278898 | 3300049823 | Bacteria | 1605 |
| 281 | Ga0501044_0592334 | 3300049823 | Bacteria | 1002 |
| 282 | Ga0501044_0706151 | 3300049823 | Bacteria | 893 |
| 283 | Ga0501045_0022105 | 3300049824 | Bacteria | 4551 |
| 284 | nmdc:mga00v17_391687_c1 | 3300050491 | Bacteria | 903 |
| 285 | nmdc:mga08x19_838981_c1 | 3300050514 | Bacteria | 653 |
| 286 | Ga0495601_0788062 | 3300053077 | Bacteria | 604 |
| 287 | Ga0495595_0168193 | 3300053084 | Bacteria | 1084 |
| 288 | Ga0495619_0036750 | 3300053085 | Bacteria | 3190 |
| 289 | Ga0495619_0247383 | 3300053085 | Bacteria | 1235 |
| 290 | Ga0500646_0068632 | 3300053090 | Bacteria | 1059 |
| 291 | Ga0500554_084451 | 3300053102 | Bacteria | 1049 |
| 292 | Ga0500593_163502 | 3300053117 | Bacteria | 848 |
| 293 | Ga0500595_001332 | 3300053119 | Bacteria | 13364 |
| 294 | Ga0500559_0065121 | 3300053136 | Bacteria | 1632 |
| 295 | Ga0500559_0143182 | 3300053136 | Bacteria | 1120 |
| 296 | Ga0500568_0027671 | 3300053139 | Bacteria | 2369 |
| 297 | Ga0500568_0124848 | 3300053139 | Bacteria | 958 |
| 298 | Ga0500603_139935 | 3300053150 | Bacteria | 744 |
| 299 | Ga0500638_000810 | 3300053162 | Bacteria | 8620 |
| 300 | Ga0500637_0000716 | 3300053178 | Bacteria | 13237 |
| 301 | Ga0501084_0015981 | 3300054114 | Bacteria | 6229 |
| 302 | Ga0500661_000675 | 3300055283 | Bacteria | 6405 |
| 303 | Ga0501082_0037374 | 3300060353 | Bacteria | 4185 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025972 | Ga0207668_11008582 | Ga0207668_110085822 | 142 |
| 2 | 3300053084 | Ga0495595_0168193 | Ga0495595_0168193_259_690 | 143 |
| 3 | 3300053085 | Ga0495619_0247383 | Ga0495619_0247383_67_498 | 143 |
| 4 | 3300005437 | Ga0070710_10048707 | Ga0070710_100487072 | 144 |
| 5 | 3300005439 | Ga0070711_100297643 | Ga0070711_1002976431 | 144 |
| 6 | 3300006173 | Ga0070716_100963998 | Ga0070716_1009639981 | 144 |
| 7 | 3300006175 | Ga0070712_100009901 | Ga0070712_1000099015 | 144 |
| 8 | 3300025898 | Ga0207692_10009018 | Ga0207692_100090182 | 144 |
| 9 | 3300025915 | Ga0207693_10051456 | Ga0207693_100514562 | 144 |
| 10 | 3300025939 | Ga0207665_10440586 | Ga0207665_104405862 | 144 |
| 11 | iso_pu_bacteria | 8016522445 | 8016530239 | 146 |
| 12 | iso_pu_bacteria | 8016530956 | 8016535498 | 146 |
| 13 | iso_pu_bacteria | 8016539877 | 8016548692 | 146 |
| 14 | iso_pu_bacteria | 8016548790 | 8016553441 | 146 |
| 15 | iso_pu_bacteria | 8016557553 | 8016561820 | 146 |
| 16 | iso_pu_bacteria | 8016566248 | 8016573828 | 146 |
| 17 | iso_pu_bacteria | 8016575299 | 8016577953 | 146 |
| 18 | iso_pu_bacteria | 8016595262 | 8016599652 | 146 |
| 19 | iso_pu_bacteria | 8016622563 | 8016627344 | 146 |
| 20 | iso_pu_bacteria | 8019530166 | 8019535230 | 146 |
| 21 | iso_pu_bacteria | 8019547302 | 8019554448 | 146 |
| 22 | 3300005327 | Ga0070658_10812852 | Ga0070658_108128521 | 149 |
| 23 | 3300005548 | Ga0070665_100872592 | Ga0070665_1008725922 | 149 |
| 24 | 3300005937 | Ga0081455_10001970 | Ga0081455_1000197011 | 149 |
| 25 | 3300005937 | Ga0081455_10049676 | Ga0081455_100496762 | 149 |
| 26 | 3300009093 | Ga0105240_11432570 | Ga0105240_114325702 | 149 |
| 27 | 3300013104 | Ga0157370_11444460 | Ga0157370_114444601 | 149 |
| 28 | 3300014325 | Ga0163163_10481477 | Ga0163163_104814773 | 149 |
| 29 | 3300025914 | Ga0207671_10879622 | Ga0207671_108796222 | 149 |
| 30 | 3300025928 | Ga0207700_10307717 | Ga0207700_103077172 | 149 |
| 31 | 3300026121 | Ga0207683_10747041 | Ga0207683_107470411 | 149 |
| 32 | 3300039450 | Ga0436363_1086022 | Ga0436363_1086022_75_527 | 149 |
| 33 | 3300046616 | Ga0495668_0389061 | Ga0495668_0389061_276_755 | 149 |
| 34 | 3300048907 | Ga0496104_0163662 | Ga0496104_0163662_26_475 | 149 |
| 35 | 3300048911 | Ga0496108_0138179 | Ga0496108_0138179_661_1110 | 149 |
| 36 | 3300048912 | Ga0496109_0028567 | Ga0496109_0028567_3672_4121 | 149 |
| 37 | 3300048913 | Ga0496110_0091693 | Ga0496110_0091693_1625_2074 | 149 |
| 38 | 3300048915 | Ga0496112_0259195 | Ga0496112_0259195_691_1140 | 149 |
| 39 | 3300048916 | Ga0496113_0113333 | Ga0496113_0113333_1609_2058 | 149 |
| 40 | 3300053139 | Ga0500568_0124848 | Ga0500568_0124848_465_917 | 149 |
| 41 | iso_pu_bacteria | 2897803580 | 2897805518 | 149 |
| 42 | 3300002459 | JGI24751J29686_10092947 | JGI24751J29686_100929471 | 150 |
| 43 | 3300005327 | Ga0070658_10073511 | Ga0070658_100735111 | 150 |
| 44 | 3300005327 | Ga0070658_10104705 | Ga0070658_101047053 | 150 |
| 45 | 3300005327 | Ga0070658_10261212 | Ga0070658_102612122 | 150 |
| 46 | 3300005329 | Ga0070683_100456336 | Ga0070683_1004563361 | 150 |
| 47 | 3300005331 | Ga0070670_100005265 | Ga0070670_1000052655 | 150 |
| 48 | 3300005331 | Ga0070670_100185748 | Ga0070670_1001857482 | 150 |
| 49 | 3300005335 | Ga0070666_10003181 | Ga0070666_100031813 | 150 |
| 50 | 3300005338 | Ga0068868_100033560 | Ga0068868_1000335601 | 150 |
| 51 | 3300005340 | Ga0070689_100508481 | Ga0070689_1005084811 | 150 |
| 52 | 3300005341 | Ga0070691_10820892 | Ga0070691_108208921 | 150 |
| 53 | 3300005344 | Ga0070661_100000019 | Ga0070661_100000019133 | 150 |
| 54 | 3300005366 | Ga0070659_100799686 | Ga0070659_1007996861 | 150 |
| 55 | 3300005367 | Ga0070667_100081464 | Ga0070667_1000814642 | 150 |
| 56 | 3300005435 | Ga0070714_100056762 | Ga0070714_1000567624 | 150 |
| 57 | 3300005439 | Ga0070711_100329175 | Ga0070711_1003291752 | 150 |
| 58 | 3300005439 | Ga0070711_100651761 | Ga0070711_1006517612 | 150 |
| 59 | 3300005455 | Ga0070663_100532607 | Ga0070663_1005326072 | 150 |
| 60 | 3300005455 | Ga0070663_100737486 | Ga0070663_1007374862 | 150 |
| 61 | 3300005456 | Ga0070678_100699927 | Ga0070678_1006999272 | 150 |
| 62 | 3300005458 | Ga0070681_11103866 | Ga0070681_111038662 | 150 |
| 63 | 3300005471 | Ga0070698_100189095 | Ga0070698_1001890952 | 150 |
| 64 | 3300005530 | Ga0070679_100206729 | Ga0070679_1002067292 | 150 |
| 65 | 3300005530 | Ga0070679_100240701 | Ga0070679_1002407012 | 150 |
| 66 | 3300005530 | Ga0070679_100940396 | Ga0070679_1009403962 | 150 |
| 67 | 3300005547 | Ga0070693_100173448 | Ga0070693_1001734483 | 150 |
| 68 | 3300005563 | Ga0068855_100065220 | Ga0068855_1000652206 | 150 |
| 69 | 3300005563 | Ga0068855_100078236 | Ga0068855_1000782363 | 150 |
| 70 | 3300005563 | Ga0068855_100168358 | Ga0068855_1001683583 | 150 |
| 71 | 3300005563 | Ga0068855_100669679 | Ga0068855_1006696791 | 150 |
| 72 | 3300005616 | Ga0068852_100271299 | Ga0068852_1002712992 | 150 |
| 73 | 3300006237 | Ga0097621_100829933 | Ga0097621_1008299332 | 150 |
| 74 | 3300006358 | Ga0068871_100099837 | Ga0068871_1000998374 | 150 |
| 75 | 3300007265 | Ga0099794_10246234 | Ga0099794_102462342 | 150 |
| 76 | 3300007788 | Ga0099795_10000230 | Ga0099795_1000023010 | 150 |
| 77 | 3300007788 | Ga0099795_10090927 | Ga0099795_100909272 | 150 |
| 78 | 3300007788 | Ga0099795_10203019 | Ga0099795_102030192 | 150 |
| 79 | 3300009093 | Ga0105240_10042474 | Ga0105240_100424747 | 150 |
| 80 | 3300009093 | Ga0105240_10066210 | Ga0105240_100662105 | 150 |
| 81 | 3300009093 | Ga0105240_10288062 | Ga0105240_102880624 | 150 |
| 82 | 3300009093 | Ga0105240_10375312 | Ga0105240_103753123 | 150 |
| 83 | 3300009093 | Ga0105240_11147642 | Ga0105240_111476422 | 150 |
| 84 | 3300009098 | Ga0105245_10072752 | Ga0105245_100727523 | 150 |
| 85 | 3300009098 | Ga0105245_10153648 | Ga0105245_101536482 | 150 |
| 86 | 3300009101 | Ga0105247_10089750 | Ga0105247_100897502 | 150 |
| 87 | 3300009148 | Ga0105243_10875462 | Ga0105243_108754621 | 150 |
| 88 | 3300009174 | Ga0105241_10428944 | Ga0105241_104289442 | 150 |
| 89 | 3300009177 | Ga0105248_10352596 | Ga0105248_103525962 | 150 |
| 90 | 3300009177 | Ga0105248_12559892 | Ga0105248_125598922 | 150 |
| 91 | 3300009545 | Ga0105237_10235663 | Ga0105237_102356633 | 150 |
| 92 | 3300009545 | Ga0105237_10246571 | Ga0105237_102465712 | 150 |
| 93 | 3300009545 | Ga0105237_10256607 | Ga0105237_102566072 | 150 |
| 94 | 3300009545 | Ga0105237_10539228 | Ga0105237_105392281 | 150 |
| 95 | 3300009545 | Ga0105237_11105021 | Ga0105237_111050212 | 150 |
| 96 | 3300009551 | Ga0105238_10322242 | Ga0105238_103222422 | 150 |
| 97 | 3300009551 | Ga0105238_10622544 | Ga0105238_106225442 | 150 |
| 98 | 3300009553 | Ga0105249_10225608 | Ga0105249_102256083 | 150 |
| 99 | 3300010159 | Ga0099796_10010695 | Ga0099796_100106952 | 150 |
| 100 | 3300010375 | Ga0105239_10011951 | Ga0105239_1001195110 | 150 |
| 101 | 3300010375 | Ga0105239_10067115 | Ga0105239_100671152 | 150 |
| 102 | 3300010375 | Ga0105239_10143406 | Ga0105239_101434062 | 150 |
| 103 | 3300010375 | Ga0105239_10181329 | Ga0105239_101813293 | 150 |
| 104 | 3300010375 | Ga0105239_10355990 | Ga0105239_103559903 | 150 |
| 105 | 3300010375 | Ga0105239_10594294 | Ga0105239_105942941 | 150 |
| 106 | 3300010375 | Ga0105239_10750223 | Ga0105239_107502232 | 150 |
| 107 | 3300011119 | Ga0105246_10137101 | Ga0105246_101371013 | 150 |
| 108 | 3300011119 | Ga0105246_10677362 | Ga0105246_106773622 | 150 |
| 109 | 3300013104 | Ga0157370_10141037 | Ga0157370_101410375 | 150 |
| 110 | 3300013104 | Ga0157370_10161691 | Ga0157370_101616912 | 150 |
| 111 | 3300013104 | Ga0157370_10383113 | Ga0157370_103831132 | 150 |
| 112 | 3300013104 | Ga0157370_10811612 | Ga0157370_108116122 | 150 |
| 113 | 3300013105 | Ga0157369_10152283 | Ga0157369_101522832 | 150 |
| 114 | 3300013296 | Ga0157374_10277356 | Ga0157374_102773562 | 150 |
| 115 | 3300013297 | Ga0157378_10037828 | Ga0157378_100378282 | 150 |
| 116 | 3300013306 | Ga0163162_10048143 | Ga0163162_100481432 | 150 |
| 117 | 3300014325 | Ga0163163_10661975 | Ga0163163_106619752 | 150 |
| 118 | 3300014969 | Ga0157376_10064973 | Ga0157376_100649734 | 150 |
| 119 | 3300014969 | Ga0157376_10126801 | Ga0157376_101268012 | 150 |
| 120 | 3300025272 | Ga0209455_1030536 | Ga0209455_10305362 | 150 |
| 121 | 3300025315 | Ga0207697_10076095 | Ga0207697_100760953 | 150 |
| 122 | 3300025903 | Ga0207680_10009465 | Ga0207680_100094656 | 150 |
| 123 | 3300025909 | Ga0207705_10216833 | Ga0207705_102168331 | 150 |
| 124 | 3300025909 | Ga0207705_10313213 | Ga0207705_103132132 | 150 |
| 125 | 3300025911 | Ga0207654_10231877 | Ga0207654_102318772 | 150 |
| 126 | 3300025912 | Ga0207707_10512166 | Ga0207707_105121662 | 150 |
| 127 | 3300025913 | Ga0207695_10012690 | Ga0207695_1001269012 | 150 |
| 128 | 3300025913 | Ga0207695_10049960 | Ga0207695_100499605 | 150 |
| 129 | 3300025913 | Ga0207695_10060325 | Ga0207695_100603253 | 150 |
| 130 | 3300025914 | Ga0207671_10146455 | Ga0207671_101464552 | 150 |
| 131 | 3300025914 | Ga0207671_10241395 | Ga0207671_102413952 | 150 |
| 132 | 3300025914 | Ga0207671_10281386 | Ga0207671_102813862 | 150 |
| 133 | 3300025914 | Ga0207671_11351519 | Ga0207671_113515191 | 150 |
| 134 | 3300025915 | Ga0207693_10329938 | Ga0207693_103299382 | 150 |
| 135 | 3300025916 | Ga0207663_10278300 | Ga0207663_102783002 | 150 |
| 136 | 3300025917 | Ga0207660_10302978 | Ga0207660_103029783 | 150 |
| 137 | 3300025919 | Ga0207657_10711785 | Ga0207657_107117852 | 150 |
| 138 | 3300025920 | Ga0207649_10000382 | Ga0207649_1000038211 | 150 |
| 139 | 3300025924 | Ga0207694_10075570 | Ga0207694_100755703 | 150 |
| 140 | 3300025924 | Ga0207694_10437587 | Ga0207694_104375871 | 150 |
| 141 | 3300025924 | Ga0207694_11288833 | Ga0207694_112888331 | 150 |
| 142 | 3300025926 | Ga0207659_10245781 | Ga0207659_102457812 | 150 |
| 143 | 3300025927 | Ga0207687_10100480 | Ga0207687_101004802 | 150 |
| 144 | 3300025928 | Ga0207700_10125453 | Ga0207700_101254532 | 150 |
| 145 | 3300025929 | Ga0207664_10025604 | Ga0207664_100256043 | 150 |
| 146 | 3300025929 | Ga0207664_10049328 | Ga0207664_100493282 | 150 |
| 147 | 3300025932 | Ga0207690_10060145 | Ga0207690_100601453 | 150 |
| 148 | 3300025935 | Ga0207709_10988388 | Ga0207709_109883881 | 150 |
| 149 | 3300025936 | Ga0207670_10372877 | Ga0207670_103728772 | 150 |
| 150 | 3300025938 | Ga0207704_10561066 | Ga0207704_105610662 | 150 |
| 151 | 3300025940 | Ga0207691_10537611 | Ga0207691_105376112 | 150 |
| 152 | 3300025941 | Ga0207711_11661760 | Ga0207711_116617602 | 150 |
| 153 | 3300025942 | Ga0207689_10184655 | Ga0207689_101846552 | 150 |
| 154 | 3300025945 | Ga0207679_10235002 | Ga0207679_102350021 | 150 |
| 155 | 3300025949 | Ga0207667_10090592 | Ga0207667_100905924 | 150 |
| 156 | 3300025949 | Ga0207667_10494956 | Ga0207667_104949562 | 150 |
| 157 | 3300025949 | Ga0207667_10570640 | Ga0207667_105706402 | 150 |
| 158 | 3300025960 | Ga0207651_11305137 | Ga0207651_113051371 | 150 |
| 159 | 3300025986 | Ga0207658_10063343 | Ga0207658_100633434 | 150 |
| 160 | 3300026023 | Ga0207677_10288864 | Ga0207677_102888642 | 150 |
| 161 | 3300026041 | Ga0207639_10438395 | Ga0207639_104383952 | 150 |
| 162 | 3300026041 | Ga0207639_10706911 | Ga0207639_107069111 | 150 |
| 163 | 3300026067 | Ga0207678_10014082 | Ga0207678_100140828 | 150 |
| 164 | 3300026078 | Ga0207702_10197498 | Ga0207702_101974983 | 150 |
| 165 | 3300026095 | Ga0207676_10116748 | Ga0207676_101167482 | 150 |
| 166 | 3300026116 | Ga0207674_10117037 | Ga0207674_101170373 | 150 |
| 167 | 3300026142 | Ga0207698_10387529 | Ga0207698_103875291 | 150 |
| 168 | 3300026142 | Ga0207698_11140949 | Ga0207698_111409492 | 150 |
| 169 | 3300028379 | Ga0268266_10279216 | Ga0268266_102792163 | 150 |
| 170 | 3300028379 | Ga0268266_10534124 | Ga0268266_105341241 | 150 |
| 171 | 3300028577 | Ga0265318_10000839 | Ga0265318_100008398 | 150 |
| 172 | 3300031241 | Ga0265325_10010531 | Ga0265325_100105313 | 150 |
| 173 | 3300031247 | Ga0265340_10048261 | Ga0265340_100482612 | 150 |
| 174 | 3300031249 | Ga0265339_10054770 | Ga0265339_100547702 | 150 |
| 175 | 3300031249 | Ga0265339_10104596 | Ga0265339_101045963 | 150 |
| 176 | 3300031250 | Ga0265331_10022157 | Ga0265331_100221575 | 150 |
| 177 | 3300031250 | Ga0265331_10029275 | Ga0265331_100292753 | 150 |
| 178 | 3300031344 | Ga0265316_10017222 | Ga0265316_100172224 | 150 |
| 179 | 3300031595 | Ga0265313_10002435 | Ga0265313_100024358 | 150 |
| 180 | 3300031595 | Ga0265313_10005168 | Ga0265313_1000516813 | 150 |
| 181 | 3300031711 | Ga0265314_10006433 | Ga0265314_100064339 | 150 |
| 182 | 3300031711 | Ga0265314_10016266 | Ga0265314_100162667 | 150 |
| 183 | 3300031711 | Ga0265314_10080612 | Ga0265314_100806122 | 150 |
| 184 | 3300031711 | Ga0265314_10290957 | Ga0265314_102909572 | 150 |
| 185 | 3300031712 | Ga0265342_10224166 | Ga0265342_102241662 | 150 |
| 186 | 3300031712 | Ga0265342_10477722 | Ga0265342_104777221 | 150 |
| 187 | 3300035088 | Ga0373940_0155600 | Ga0373940_0155600_166_627 | 150 |
| 188 | 3300035120 | Ga0373957_0249865 | Ga0373957_0249865_74_526 | 150 |
| 189 | 3300035171 | Ga0373946_0082554 | Ga0373946_0082554_31_492 | 150 |
| 190 | 3300035691 | Ga0373931_1026454 | Ga0373931_1026454_26_487 | 150 |
| 191 | 3300035692 | Ga0373935_0570694 | Ga0373935_0570694_76_537 | 150 |
| 192 | 3300035695 | Ga0373927_0549234 | Ga0373927_0549234_24_482 | 150 |
| 193 | 3300036401 | Ga0373937_0010772 | Ga0373937_0010772_1690_2142 | 150 |
| 194 | 3300036401 | Ga0373937_0550619 | Ga0373937_0550619_83_535 | 150 |
| 195 | 3300037068 | Ga0373925_0251681 | Ga0373925_0251681_65_541 | 150 |
| 196 | 3300037068 | Ga0373925_1329503 | Ga0373925_1329503_42_503 | 150 |
| 197 | 3300037466 | Ga0395898_0655694 | Ga0395898_0655694_195_710 | 150 |
| 198 | 3300041452 | Ga0451793_1758379 | Ga0451793_1758379_102_554 | 150 |
| 199 | 3300046476 | Ga0495662_0086231 | Ga0495662_0086231_975_1436 | 150 |
| 200 | 3300046492 | Ga0495585_0313195 | Ga0495585_0313195_93_569 | 150 |
| 201 | 3300046514 | Ga0495618_0014379 | Ga0495618_0014379_2483_2944 | 150 |
| 202 | 3300046531 | Ga0495665_0131560 | Ga0495665_0131560_184_645 | 150 |
| 203 | 3300046533 | Ga0495640_0025682 | Ga0495640_0025682_873_1334 | 150 |
| 204 | 3300046557 | Ga0495622_0448694 | Ga0495622_0448694_53_514 | 150 |
| 205 | 3300046559 | Ga0495667_0396731 | Ga0495667_0396731_380_841 | 150 |
| 206 | 3300046642 | Ga0495634_0158696 | Ga0495634_0158696_892_1353 | 150 |
| 207 | 3300046683 | Ga0495658_0202579 | Ga0495658_0202579_239_700 | 150 |
| 208 | 3300046689 | Ga0495613_0072381 | Ga0495613_0072381_1442_1903 | 150 |
| 209 | 3300046690 | Ga0495624_0179221 | Ga0495624_0179221_728_1189 | 150 |
| 210 | 3300046809 | Ga0495600_0204528 | Ga0495600_0204528_200_661 | 150 |
| 211 | 3300047315 | Ga0495581_0623112 | Ga0495581_0623112_152_613 | 150 |
| 212 | 3300047317 | Ga0495604_0292356 | Ga0495604_0292356_121_597 | 150 |
| 213 | 3300047322 | Ga0495680_0487357 | Ga0495680_0487357_220_672 | 150 |
| 214 | 3300047322 | Ga0495680_0979483 | Ga0495680_0979483_16_477 | 150 |
| 215 | 3300047444 | Ga0495675_0225033 | Ga0495675_0225033_79_531 | 150 |
| 216 | 3300047673 | Ga0495593_0002840 | Ga0495593_0002840_334_810 | 150 |
| 217 | 3300048088 | Ga0495602_0490877 | Ga0495602_0490877_49_501 | 150 |
| 218 | 3300048903 | Ga0496100_0018161 | Ga0496100_0018161_3384_3860 | 150 |
| 219 | 3300048904 | Ga0496101_0003260 | Ga0496101_0003260_3898_4374 | 150 |
| 220 | 3300048905 | Ga0496102_0178801 | Ga0496102_0178801_286_762 | 150 |
| 221 | 3300048905 | Ga0496102_0908572 | Ga0496102_0908572_105_581 | 150 |
| 222 | 3300048907 | Ga0496104_0179807 | Ga0496104_0179807_1067_1543 | 150 |
| 223 | 3300048908 | Ga0496105_0377493 | Ga0496105_0377493_464_940 | 150 |
| 224 | 3300048909 | Ga0496106_0301371 | Ga0496106_0301371_173_649 | 150 |
| 225 | 3300048911 | Ga0496108_0026814 | Ga0496108_0026814_1199_1675 | 150 |
| 226 | 3300048912 | Ga0496109_0771392 | Ga0496109_0771392_305_781 | 150 |
| 227 | 3300048917 | Ga0496114_0101783 | Ga0496114_0101783_1139_1600 | 150 |
| 228 | 3300048918 | Ga0496115_0009324 | Ga0496115_0009324_5069_5545 | 150 |
| 229 | 3300048918 | Ga0496115_0025001 | Ga0496115_0025001_2466_2927 | 150 |
| 230 | 3300048918 | Ga0496115_0033725 | Ga0496115_0033725_2753_3232 | 150 |
| 231 | 3300048923 | Ga0496120_0181417 | Ga0496120_0181417_428_916 | 150 |
| 232 | 3300048928 | Ga0496125_0380105 | Ga0496125_0380105_109_588 | 150 |
| 233 | 3300048929 | Ga0496126_0019887 | Ga0496126_0019887_4178_4630 | 150 |
| 234 | 3300048929 | Ga0496126_0125167 | Ga0496126_0125167_1415_1894 | 150 |
| 235 | 3300048929 | Ga0496126_1184648 | Ga0496126_1184648_31_483 | 150 |
| 236 | 3300049568 | Ga0501031_0087528 | Ga0501031_0087528_879_1346 | 150 |
| 237 | 3300049569 | Ga0501032_0091759 | Ga0501032_0091759_1195_1662 | 150 |
| 238 | 3300049569 | Ga0501032_0298919 | Ga0501032_0298919_566_1018 | 150 |
| 239 | 3300049569 | Ga0501032_0472483 | Ga0501032_0472483_119_571 | 150 |
| 240 | 3300049570 | Ga0501033_0007810 | Ga0501033_0007810_6429_6884 | 150 |
| 241 | 3300049570 | Ga0501033_0046749 | Ga0501033_0046749_263_718 | 150 |
| 242 | 3300049570 | Ga0501033_0089308 | Ga0501033_0089308_827_1279 | 150 |
| 243 | 3300049570 | Ga0501033_0116275 | Ga0501033_0116275_831_1283 | 150 |
| 244 | 3300049570 | Ga0501033_0120273 | Ga0501033_0120273_1215_1682 | 150 |
| 245 | 3300049570 | Ga0501033_0129560 | Ga0501033_0129560_225_677 | 150 |
| 246 | 3300049571 | Ga0501034_0097308 | Ga0501034_0097308_1996_2448 | 150 |
| 247 | 3300049571 | Ga0501034_0103505 | Ga0501034_0103505_1394_1861 | 150 |
| 248 | 3300049571 | Ga0501034_0135233 | Ga0501034_0135233_203_658 | 150 |
| 249 | 3300049572 | Ga0501036_0034847 | Ga0501036_0034847_3285_3752 | 150 |
| 250 | 3300049572 | Ga0501036_0130466 | Ga0501036_0130466_471_923 | 150 |
| 251 | 3300049573 | Ga0501037_0045731 | Ga0501037_0045731_1863_2330 | 150 |
| 252 | 3300049574 | Ga0501038_0088706 | Ga0501038_0088706_1890_2345 | 150 |
| 253 | 3300049574 | Ga0501038_0114977 | Ga0501038_0114977_980_1432 | 150 |
| 254 | 3300049574 | Ga0501038_0649219 | Ga0501038_0649219_249_701 | 150 |
| 255 | 3300049575 | Ga0501039_0000973 | Ga0501039_0000973_3051_3518 | 150 |
| 256 | 3300049579 | Ga0501043_0066136 | Ga0501043_0066136_438_893 | 150 |
| 257 | 3300049579 | Ga0501043_0222222 | Ga0501043_0222222_378_830 | 150 |
| 258 | 3300049580 | Ga0501046_0003969 | Ga0501046_0003969_3404_3871 | 150 |
| 259 | 3300049580 | Ga0501046_0014477 | Ga0501046_0014477_3685_4140 | 150 |
| 260 | 3300049580 | Ga0501046_0500725 | Ga0501046_0500725_81_533 | 150 |
| 261 | 3300049581 | Ga0501047_0007423 | Ga0501047_0007423_4239_4727 | 150 |
| 262 | 3300049581 | Ga0501047_0030776 | Ga0501047_0030776_2670_3134 | 150 |
| 263 | 3300049581 | Ga0501047_0035806 | Ga0501047_0035806_29_484 | 150 |
| 264 | 3300049581 | Ga0501047_0042535 | Ga0501047_0042535_1228_1680 | 150 |
| 265 | 3300049581 | Ga0501047_0084807 | Ga0501047_0084807_713_1180 | 150 |
| 266 | 3300049581 | Ga0501047_1082229 | Ga0501047_1082229_39_491 | 150 |
| 267 | 3300049581 | Ga0501047_1089558 | Ga0501047_1089558_150_602 | 150 |
| 268 | 3300049582 | Ga0501048_0002706 | Ga0501048_0002706_5037_5504 | 150 |
| 269 | 3300049583 | Ga0501067_0000451 | Ga0501067_0000451_1365_1832 | 150 |
| 270 | 3300049584 | Ga0501068_0071363 | Ga0501068_0071363_403_858 | 150 |
| 271 | 3300049585 | Ga0501069_0023094 | Ga0501069_0023094_1206_1673 | 150 |
| 272 | 3300049586 | Ga0501070_0016828 | Ga0501070_0016828_4960_5427 | 150 |
| 273 | 3300049586 | Ga0501070_0121577 | Ga0501070_0121577_1269_1724 | 150 |
| 274 | 3300049589 | Ga0501073_0033222 | Ga0501073_0033222_1993_2460 | 150 |
| 275 | 3300049590 | Ga0501074_0071577 | Ga0501074_0071577_353_820 | 150 |
| 276 | 3300049590 | Ga0501074_0279184 | Ga0501074_0279184_395_925 | 150 |
| 277 | 3300049590 | Ga0501074_0512937 | Ga0501074_0512937_266_721 | 150 |
| 278 | 3300049592 | Ga0501076_0230588 | Ga0501076_0230588_726_1193 | 150 |
| 279 | 3300049741 | Ga0501079_0069245 | Ga0501079_0069245_890_1357 | 150 |
| 280 | 3300049742 | Ga0501080_0145943 | Ga0501080_0145943_26_478 | 150 |
| 281 | 3300049742 | Ga0501080_0211919 | Ga0501080_0211919_881_1336 | 150 |
| 282 | 3300049742 | Ga0501080_0474343 | Ga0501080_0474343_394_846 | 150 |
| 283 | 3300049744 | Ga0501083_0005421 | Ga0501083_0005421_6969_7436 | 150 |
| 284 | 3300049744 | Ga0501083_0470511 | Ga0501083_0470511_151_603 | 150 |
| 285 | 3300049822 | Ga0501035_0001972 | Ga0501035_0001972_16030_16482 | 150 |
| 286 | 3300049822 | Ga0501035_0022013 | Ga0501035_0022013_1679_2143 | 150 |
| 287 | 3300049822 | Ga0501035_0082626 | Ga0501035_0082626_1782_2249 | 150 |
| 288 | 3300049822 | Ga0501035_0091006 | Ga0501035_0091006_1861_2313 | 150 |
| 289 | 3300049823 | Ga0501044_0010404 | Ga0501044_0010404_1981_2433 | 150 |
| 290 | 3300049823 | Ga0501044_0017042 | Ga0501044_0017042_4324_4791 | 150 |
| 291 | 3300049823 | Ga0501044_0053462 | Ga0501044_0053462_1648_2112 | 150 |
| 292 | 3300049823 | Ga0501044_0077907 | Ga0501044_0077907_2575_3027 | 150 |
| 293 | 3300049823 | Ga0501044_0118381 | Ga0501044_0118381_1837_2289 | 150 |
| 294 | 3300049823 | Ga0501044_0190153 | Ga0501044_0190153_1432_1887 | 150 |
| 295 | 3300049823 | Ga0501044_0278898 | Ga0501044_0278898_775_1227 | 150 |
| 296 | 3300049823 | Ga0501044_0592334 | Ga0501044_0592334_147_599 | 150 |
| 297 | 3300049823 | Ga0501044_0706151 | Ga0501044_0706151_203_658 | 150 |
| 298 | 3300049824 | Ga0501045_0022105 | Ga0501045_0022105_250_717 | 150 |
| 299 | 3300050491 | nmdc:mga00v17_391687_c1 | nmdc:mga00v17_391687_c1_257_709 | 150 |
| 300 | 3300050514 | nmdc:mga08x19_838981_c1 | nmdc:mga08x19_838981_c1_158_616 | 150 |
| 301 | 3300053077 | Ga0495601_0788062 | Ga0495601_0788062_23_484 | 150 |
| 302 | 3300053085 | Ga0495619_0036750 | Ga0495619_0036750_2079_2540 | 150 |
| 303 | 3300053090 | Ga0500646_0068632 | Ga0500646_0068632_339_791 | 150 |
| 304 | 3300053102 | Ga0500554_084451 | Ga0500554_084451_557_1033 | 150 |
| 305 | 3300053117 | Ga0500593_163502 | Ga0500593_163502_381_833 | 150 |
| 306 | 3300053119 | Ga0500595_001332 | Ga0500595_001332_4479_4955 | 150 |
| 307 | 3300053136 | Ga0500559_0065121 | Ga0500559_0065121_234_776 | 150 |
| 308 | 3300053136 | Ga0500559_0143182 | Ga0500559_0143182_452_928 | 150 |
| 309 | 3300053139 | Ga0500568_0027671 | Ga0500568_0027671_607_1059 | 150 |
| 310 | 3300053150 | Ga0500603_139935 | Ga0500603_139935_149_625 | 150 |
| 311 | 3300053162 | Ga0500638_000810 | Ga0500638_000810_3309_3785 | 150 |
| 312 | 3300053178 | Ga0500637_0000716 | Ga0500637_0000716_3162_3638 | 150 |
| 313 | 3300054114 | Ga0501084_0015981 | Ga0501084_0015981_4335_4802 | 150 |
| 314 | 3300055283 | Ga0500661_000675 | Ga0500661_000675_659_1135 | 150 |
| 315 | 3300060353 | Ga0501082_0037374 | Ga0501082_0037374_536_1003 | 150 |
| 316 | iso_pu_bacteria | 2932794094 | 2932800772 | 150 |
| 317 | iso_pu_bacteria | 2932801729 | 2932803390 | 150 |
| 318 | iso_pu_bacteria | 2935608549 | 2935611882 | 150 |
| 319 | iso_pu_bacteria | 2935819856 | 2935821362 | 150 |
| 320 | iso_pu_bacteria | 2935847175 | 2935850379 | 150 |
| 321 | iso_pu_bacteria | 2935883170 | 2935886462 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f8b-assembly1.cif.gz_B-2 | crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef | 0.9413 | 23 | 136 |
| 5k0p-assembly1.cif.gz_B | crystal structure of the archaeosine synthase quef-like in the apo form | 0.9143 | 32 | 133 |
| 3bp1-assembly1.cif.gz_D | crystal structure of putative 7-cyano-7-deazaguanine reductase quef from vibrio cholerae o1 biovar eltor | 0.9116 | 33 | 126 |
| 5k0p-assembly1.cif.gz_B | crystal structure of the archaeosine synthase quef-like in the apo form | 0.9057 | 32 | 133 |
| 7alc-assembly1.cif.gz_D-2 | human gch-gfrp stimulatory complex | 0.9026 | 25 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G081_22_166_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9406 | 14 | 131 | 3.30.1130.10 |
| 4uqfA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8568 | 33 | 130 | 3.30.1130.10 |
| 1a8rA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8317 | 24 | 126 | 3.30.1130.10 |
| 3bp1A01 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8312 | 17 | 113 | 3.30.1130.10 |
| 3rzpD02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8101 | 33 | 139 | 3.30.1130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520IJI0-F1-model_v4 | PreQ(1) synthase (EC 1.7.1.13) | 0.9927 | 6 | 112 |
GO:0005737
GO:0008616 GO:0033739 |
| AF-Q9RNJ7-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9926 | 7 | 115 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-A0A3B8XPT8-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (EC 1.7.1.13) | 0.9869 | 3 | 119 |
GO:0005737
GO:0008616 GO:0033739 |
| AF-A0A7C0W7L9-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (EC 1.7.1.13) | 0.9798 | 22 | 129 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-K1ZKZ5-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.979 | 23 | 130 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar