F406059

General Info

Members Datasets Scaffolds Average Seq Length
321 212 642 236

Family's Representative Sequence

Representative Sequence 3300033179|Ga0307507_10130237|Ga0307507_101302373
Length 214
Sequence MPVAIVTGASKGFGRALTHALASRGWDVVVDARDAEALQRANFSPRITVLPGDVTDPDHRLELVNAVEHLDLLVNNASALGPSPQPALANYPLDAFTSVYEANVVAPLALIQLALPKLTDGVIVNVSSDAAVEAYEGWGGYGSSKAALDRVSAVLAVEHPDIGVYAFDPGDMRTDMHQAAFPGEDISDRPDPETVVPSLLKLIDERPPSGRYTR

Samples

Sample ID Description Type Environment
1 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
212 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.31
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.43
Nodule 0
Rhizoplane 11.84
Rhizosphere 82.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307507_10130237 3300033179 Bacteria 1971
2 JGI24743J22301_10039901 3300001991 Bacteria 940
3 JGI24744J21845_10006168 3300002077 Bacteria 2487
4 JGI24742J22300_10010441 3300002244 Bacteria 1538
5 JGI24751J29686_10013145 3300002459 Bacteria 1708
6 JGI25406J46586_10038171 3300003203 Bacteria 1724
7 JGI25405J52794_10017436 3300003911 Bacteria 1426
8 Ga0070690_100056569 3300005330 Bacteria 2515
9 Ga0068869_100087078 3300005334 Bacteria 2343
10 Ga0070666_10001784 3300005335 Bacteria 13108
11 Ga0070682_100196651 3300005337 Bacteria 1420
12 Ga0068868_100000227 3300005338 Bacteria 38201
13 Ga0068868_100056535 3300005338 Bacteria 3098
14 Ga0070689_100018024 3300005340 Bacteria 5194
15 Ga0070689_100034021 3300005340 Bacteria 3887
16 Ga0070691_10001857 3300005341 Bacteria 9218
17 Ga0070687_100033726 3300005343 Bacteria 2529
18 Ga0070687_100324971 3300005343 Bacteria 984
19 Ga0070692_10203976 3300005345 Bacteria 1160
20 Ga0070668_100001662 3300005347 Bacteria 16135
21 Ga0070668_100048790 3300005347 Bacteria 3256
22 Ga0070675_100541567 3300005354 Bacteria 1052
23 Ga0070671_100004470 3300005355 Bacteria 11075
24 Ga0070671_100192003 3300005355 Bacteria 1731
25 Ga0070674_100000223 3300005356 Bacteria 27721
26 Ga0070659_100024323 3300005366 Bacteria 4642
27 Ga0070667_100006000 3300005367 Bacteria 10096
28 Ga0070713_100391326 3300005436 Bacteria 1297
29 Ga0070710_10001032 3300005437 Bacteria 13226
30 Ga0070701_10000228 3300005438 Bacteria 17759
31 Ga0070701_10027896 3300005438 Bacteria 2771
32 Ga0070711_100000141 3300005439 Bacteria 38743
33 Ga0070711_100049563 3300005439 Bacteria 2876
34 Ga0070700_100003619 3300005441 Bacteria 7993
35 Ga0070700_100102156 3300005441 Bacteria 1891
36 Ga0070694_100024197 3300005444 Bacteria 3918
37 Ga0070708_100123477 3300005445 Bacteria 2391
38 Ga0070663_100004594 3300005455 Bacteria 8131
39 Ga0070662_100014901 3300005457 Bacteria 5200
40 Ga0068867_100004183 3300005459 Bacteria 10154
41 Ga0070706_100026215 3300005467 Bacteria 5364
42 Ga0070706_100112253 3300005467 Bacteria 2537
43 Ga0070707_100013828 3300005468 Bacteria 7557
44 Ga0070707_100252062 3300005468 Bacteria 1718
45 Ga0070707_100375177 3300005468 Bacteria 1382
46 Ga0070707_100376857 3300005468 Bacteria 1378
47 Ga0070707_100559779 3300005468 Bacteria 1105
48 Ga0070697_100149960 3300005536 Bacteria 1965
49 Ga0068853_100004865 3300005539 Bacteria 10441
50 Ga0070686_100047004 3300005544 Bacteria 2727
51 Ga0070696_100133513 3300005546 Bacteria 1809
52 Ga0070693_100003729 3300005547 Bacteria 7130
53 Ga0070665_100007150 3300005548 Bacteria 11350
54 Ga0070665_100012228 3300005548 Bacteria 8653
55 Ga0070665_100030085 3300005548 Bacteria 5464
56 Ga0070704_100001285 3300005549 Bacteria 13264
57 Ga0068854_100000492 3300005578 Bacteria 24084
58 Ga0068854_100058919 3300005578 Bacteria 2774
59 Ga0068856_100782814 3300005614 Bacteria 974
60 Ga0070702_100000335 3300005615 Bacteria 16344
61 Ga0070702_100038613 3300005615 Bacteria 2660
62 Ga0068852_100052787 3300005616 Bacteria 3496
63 Ga0068859_100003815 3300005617 Bacteria 15385
64 Ga0068859_100200411 3300005617 Bacteria 2080
65 Ga0068866_10000345 3300005718 Bacteria 21934
66 Ga0068866_10390831 3300005718 Bacteria 895
67 Ga0068861_100004126 3300005719 Bacteria 9743
68 Ga0068861_100080714 3300005719 Bacteria 2545
69 Ga0068861_100565134 3300005719 Bacteria 1039
70 Ga0068863_100009041 3300005841 Bacteria 9727
71 Ga0068858_100003458 3300005842 Bacteria 15667
72 Ga0068860_100000971 3300005843 Bacteria 31764
73 Ga0068862_100005339 3300005844 Bacteria 10763
74 Ga0081455_10000201 3300005937 Bacteria 76008
75 Ga0081538_10060302 3300005981 Bacteria 2183
76 Ga0081540_1020869 3300005983 Bacteria 3923
77 Ga0081539_10005668 3300005985 Bacteria 12537
78 Ga0070717_10112763 3300006028 Bacteria 2321
79 Ga0075365_10000663 3300006038 Bacteria 13765
80 Ga0075363_100003883 3300006048 Bacteria 6447
81 Ga0075364_10002720 3300006051 Bacteria 9934
82 Ga0075364_10074545 3300006051 Bacteria 2238
83 Ga0070715_10021776 3300006163 Bacteria 2490
84 Ga0070715_10060955 3300006163 Bacteria 1656
85 Ga0070716_100010178 3300006173 Bacteria 4711
86 Ga0070712_100000917 3300006175 Bacteria 17675
87 Ga0070712_100002729 3300006175 Bacteria 10897
88 Ga0075369_10000883 3300006186 Bacteria 9940
89 Ga0097621_100127269 3300006237 Bacteria 2165
90 Ga0075428_100003831 3300006844 Bacteria 16513
91 Ga0075430_100004460 3300006846 Bacteria 11809
92 Ga0075430_100114014 3300006846 Bacteria 2252
93 Ga0075430_100200557 3300006846 Bacteria 1657
94 Ga0075430_100347665 3300006846 Bacteria 1225
95 Ga0075431_100006635 3300006847 Bacteria 11498
96 Ga0075431_100008773 3300006847 Bacteria 10129
97 Ga0075431_100030916 3300006847 Bacteria 5515
98 Ga0075429_100000202 3300006880 Bacteria 39555
99 Ga0068865_100053800 3300006881 Bacteria 2794
100 Ga0097620_100003815 3300006931 Bacteria 15385
101 Ga0097620_100200411 3300006931 Bacteria 2080
102 Ga0105250_10042631 3300009092 Bacteria 1819
103 Ga0105240_10463251 3300009093 Bacteria 1416
104 Ga0111539_10042593 3300009094 Bacteria 5450
105 Ga0105245_10000678 3300009098 Bacteria 30775
106 Ga0105245_10410296 3300009098 Bacteria 1356
107 Ga0105247_10001857 3300009101 Bacteria 14779
108 Ga0105247_10270324 3300009101 Bacteria 1169
109 Ga0114129_10008326 3300009147 Bacteria 14794
110 Ga0114129_10508737 3300009147 Bacteria 1572
111 Ga0105243_10000534 3300009148 Bacteria 38657
112 Ga0105243_10615009 3300009148 Bacteria 1048
113 Ga0105242_10000799 3300009176 Bacteria 24420
114 Ga0105248_10000842 3300009177 Bacteria 34503
115 Ga0105248_10131626 3300009177 Bacteria 2822
116 Ga0105248_10162177 3300009177 Bacteria 2521
117 Ga0105237_10168485 3300009545 Bacteria 2190
118 Ga0105249_10003856 3300009553 Bacteria 12948
119 Ga0105249_10010228 3300009553 Bacteria 8238
120 Ga0105249_10029994 3300009553 Bacteria 4913
121 Ga0105239_10047790 3300010375 Bacteria 4690
122 Ga0105239_10133546 3300010375 Bacteria 2762
123 Ga0105246_10480153 3300011119 Bacteria 1051
124 Ga0157374_10011701 3300013296 Bacteria 7611
125 Ga0157378_10001491 3300013297 Bacteria 21150
126 Ga0163162_10035110 3300013306 Bacteria 4993
127 Ga0163162_10130810 3300013306 Bacteria 2618
128 Ga0163162_10203684 3300013306 Bacteria 2108
129 Ga0163162_10442729 3300013306 Bacteria 1431
130 Ga0157372_10010382 3300013307 Bacteria 9900
131 Ga0157375_10005317 3300013308 Bacteria 11184
132 Ga0163163_10002474 3300014325 Bacteria 15621
133 Ga0157380_10016490 3300014326 Bacteria 5449
134 Ga0157377_10093618 3300014745 Bacteria 1779
135 Ga0157379_10084650 3300014968 Bacteria 2841
136 Ga0163161_10005295 3300017792 Bacteria 8981
137 Ga0207656_10076250 3300025321 Bacteria 1499
138 Ga0207642_10000829 3300025899 Bacteria 9622
139 Ga0207642_10013439 3300025899 Bacteria 2988
140 Ga0207710_10006207 3300025900 Bacteria 5114
141 Ga0207688_10000119 3300025901 Bacteria 32169
142 Ga0207688_10000427 3300025901 Bacteria 19816
143 Ga0207688_10038503 3300025901 Bacteria 2654
144 Ga0207685_10004403 3300025905 Bacteria 3575
145 Ga0207685_10011323 3300025905 Bacteria 2677
146 Ga0207699_10027610 3300025906 Bacteria 3145
147 Ga0207684_10063632 3300025910 Bacteria 3132
148 Ga0207654_10074814 3300025911 Bacteria 2022
149 Ga0207693_10001162 3300025915 Bacteria 23484
150 Ga0207693_10001864 3300025915 Bacteria 18460
151 Ga0207663_10072309 3300025916 Bacteria 2228
152 Ga0207663_10165803 3300025916 Bacteria 1564
153 Ga0207662_10340226 3300025918 Bacteria 1005
154 Ga0207657_10085583 3300025919 Bacteria 2641
155 Ga0207646_10008953 3300025922 Bacteria 9964
156 Ga0207646_10278876 3300025922 Bacteria 1510
157 Ga0207646_10310157 3300025922 Bacteria 1425
158 Ga0207659_10373027 3300025926 Bacteria 1188
159 Ga0207687_10002749 3300025927 Bacteria 11927
160 Ga0207700_10168437 3300025928 Bacteria 1825
161 Ga0207664_10007760 3300025929 Bacteria 7449
162 Ga0207644_10002226 3300025931 Bacteria 12590
163 Ga0207644_10127526 3300025931 Bacteria 1944
164 Ga0207644_10396360 3300025931 Bacteria 1128
165 Ga0207690_10173505 3300025932 Bacteria 1617
166 Ga0207706_10011073 3300025933 Bacteria 8221
167 Ga0207709_10009852 3300025935 Bacteria 5261
168 Ga0207670_10030243 3300025936 Bacteria 3459
169 Ga0207670_10044543 3300025936 Bacteria 2935
170 Ga0207669_10001045 3300025937 Bacteria 11825
171 Ga0207669_10149230 3300025937 Bacteria 1635
172 Ga0207704_10027257 3300025938 Bacteria 3149
173 Ga0207665_10001371 3300025939 Bacteria 16413
174 Ga0207665_10008434 3300025939 Bacteria 6791
175 Ga0207691_10090765 3300025940 Bacteria 2738
176 Ga0207689_10008268 3300025942 Bacteria 9069
177 Ga0207689_10010021 3300025942 Bacteria 8169
178 Ga0207689_10152444 3300025942 Bacteria 1905
179 Ga0207712_10028598 3300025961 Bacteria 3730
180 Ga0207712_10039149 3300025961 Bacteria 3247
181 Ga0207668_10130971 3300025972 Bacteria 1915
182 Ga0207668_10704818 3300025972 Bacteria 887
183 Ga0207640_10001865 3300025981 Bacteria 11303
184 Ga0207658_10012355 3300025986 Bacteria 5830
185 Ga0207658_10021729 3300025986 Bacteria 4459
186 Ga0207658_10032052 3300025986 Bacteria 3737
187 Ga0207677_10096256 3300026023 Bacteria 2165
188 Ga0207639_10084309 3300026041 Bacteria 2524
189 Ga0207678_10022251 3300026067 Bacteria 5553
190 Ga0207678_10038959 3300026067 Bacteria 4127
191 Ga0207678_10067091 3300026067 Bacteria 3079
192 Ga0207708_10004538 3300026075 Bacteria 10220
193 Ga0207702_10256530 3300026078 Bacteria 1644
194 Ga0207641_10006574 3300026088 Bacteria 9771
195 Ga0207648_10000085 3300026089 Bacteria 88563
196 Ga0207648_10245621 3300026089 Bacteria 1595
197 Ga0207676_10165313 3300026095 Bacteria 1922
198 Ga0207674_10251636 3300026116 Bacteria 1714
199 Ga0207675_100020717 3300026118 Bacteria 6130
200 Ga0207675_100078810 3300026118 Bacteria 3087
201 Ga0207675_100110674 3300026118 Bacteria 2591
202 Ga0207675_100629473 3300026118 Bacteria 1078
203 Ga0207683_10028555 3300026121 Bacteria 4824
204 Ga0207683_10074689 3300026121 Bacteria 2999
205 Ga0207428_10030737 3300027907 Bacteria 4437
206 Ga0268266_10005849 3300028379 Bacteria 11380
207 Ga0268265_10022063 3300028380 Bacteria 4469
208 Ga0268264_10683488 3300028381 Bacteria 1018
209 Ga0265337_1000956 3300028556 Bacteria 15127
210 Ga0265326_10001055 3300028558 Bacteria 9831
211 Ga0265319_1003084 3300028563 Bacteria 8811
212 Ga0265334_10000786 3300028573 Bacteria 15875
213 Ga0265318_10035344 3300028577 Bacteria 1922
214 Ga0265323_10016918 3300028653 Bacteria 2840
215 Ga0265336_10003062 3300028666 Bacteria 6654
216 Ga0307515_10213299 3300028794 Bacteria 1769
217 Ga0265338_10000956 3300028800 Bacteria 48667
218 Ga0265324_10001066 3300029957 Bacteria 16559
219 Ga0265332_10004501 3300031238 Bacteria 6530
220 Ga0265320_10015947 3300031240 Bacteria 4228
221 Ga0265325_10013498 3300031241 Bacteria 4650
222 Ga0265331_10132420 3300031250 Bacteria 1137
223 Ga0265316_10024997 3300031344 Bacteria 4991
224 Ga0265342_10004076 3300031712 Bacteria 11652
225 Ga0307407_10448411 3300031903 Bacteria 936
226 Ga0316212_1005293 3300033547 Bacteria 1875
227 Ga0373960_0207718 3300035121 Bacteria 695
228 Ga0373942_0054869 3300035207 Bacteria 1127
229 Ga0373931_0096610 3300035691 Bacteria 1655
230 Ga0372808_019021 3300036459 Bacteria 987
231 Ga0373925_0000020 3300037068 Bacteria 170299
232 Ga0436363_0169189 3300039450 Bacteria 13441
233 Ga0466972_0086146 3300044658 Bacteria 1493
234 Ga0466972_0092036 3300044658 Bacteria 1438
235 Ga0466966_0032568 3300044684 Bacteria 3377
236 Ga0466961_0052921 3300044693 Bacteria 2591
237 Ga0466963_0003782 3300044694 Bacteria 8723
238 Ga0466963_0009956 3300044694 Bacteria 5743
239 Ga0466963_0492312 3300044694 Bacteria 866
240 Ga0466971_0057151 3300044719 Bacteria 1760
241 Ga0466970_0056583 3300044765 Bacteria 2096
242 Ga0466970_0407753 3300044765 Bacteria 776
243 Ga0466957_0164341 3300044842 Bacteria 1443
244 Ga0466959_0132020 3300045049 Bacteria 1770
245 Ga0466959_0157901 3300045049 Bacteria 1595
246 Ga0466959_0179416 3300045049 Bacteria 1482
247 Ga0466959_0199613 3300045049 Bacteria 1393
248 Ga0466959_0259549 3300045049 Bacteria 1196
249 Ga0466958_0014164 3300045836 Bacteria 4551
250 Ga0466958_0316458 3300045836 Bacteria 1003
251 Ga0466967_0002591 3300045976 Bacteria 11366
252 Ga0466967_0009725 3300045976 Bacteria 7161
253 Ga0466967_0040529 3300045976 Bacteria 4010
254 Ga0466967_0185230 3300045976 Bacteria 1966
255 Ga0466967_0273960 3300045976 Bacteria 1618
256 Ga0495641_0114473 3300046461 Bacteria 1203
257 Ga0495630_0364673 3300046517 Bacteria 1106
258 Ga0495635_0038750 3300046663 Bacteria 3299
259 Ga0496100_0001201 3300048903 Bacteria 12581
260 Ga0496100_0148119 3300048903 Bacteria 1671
261 Ga0496100_0943730 3300048903 Bacteria 678
262 Ga0496101_0001844 3300048904 Bacteria 12776
263 Ga0496101_0080603 3300048904 Bacteria 2405
264 Ga0496101_0701693 3300048904 Bacteria 799
265 Ga0496102_0000409 3300048905 Bacteria 49825
266 Ga0496102_0018528 3300048905 Bacteria 6119
267 Ga0496102_0030073 3300048905 Bacteria 4860
268 Ga0496102_0056055 3300048905 Bacteria 3594
269 Ga0496103_0000968 3300048906 Bacteria 20340
270 Ga0496103_0008949 3300048906 Bacteria 5936
271 Ga0496103_0016854 3300048906 Bacteria 4363
272 Ga0496104_0006249 3300048907 Bacteria 10469
273 Ga0496104_0308584 3300048907 Bacteria 1495
274 Ga0496105_0069336 3300048908 Bacteria 2914
275 Ga0496105_0414621 3300048908 Bacteria 1067
276 Ga0496106_0018558 3300048909 Bacteria 5146
277 Ga0496106_0177328 3300048909 Bacteria 1691
278 Ga0496106_0200190 3300048909 Bacteria 1589
279 Ga0496107_0001410 3300048910 Bacteria 14818
280 Ga0496107_0157359 3300048910 Bacteria 1683
281 Ga0496107_0468445 3300048910 Bacteria 935
282 Ga0496108_0002944 3300048911 Bacteria 13691
283 Ga0496108_0130861 3300048911 Bacteria 2157
284 Ga0496109_0004402 3300048912 Bacteria 11770
285 Ga0496110_0060045 3300048913 Bacteria 3353
286 Ga0496111_0020893 3300048914 Bacteria 4565
287 Ga0496111_0062520 3300048914 Bacteria 2700
288 Ga0496112_0024871 3300048915 Bacteria 5745
289 Ga0496112_0037611 3300048915 Bacteria 4723
290 Ga0496113_0080842 3300048916 Bacteria 2490
291 Ga0496113_0157556 3300048916 Bacteria 1794
292 Ga0496114_0003967 3300048917 Bacteria 11426
293 Ga0496114_0046854 3300048917 Bacteria 3593
294 Ga0496114_0266575 3300048917 Bacteria 1509
295 Ga0496115_0367361 3300048918 Bacteria 1172
296 Ga0496115_0699596 3300048918 Bacteria 797
297 Ga0496126_0394102 3300048929 Bacteria 1124
298 Ga0501047_0121887 3300049581 Bacteria 2489
299 Ga0501072_0059301 3300049588 Bacteria 3017
300 nmdc:mga03n38_34684_c1 3300050490 Bacteria 2157
301 nmdc:mga00v17_198617_c1 3300050491 Bacteria 1296
302 nmdc:mga00v17_40962_c1 3300050491 Bacteria 2780
303 nmdc:mga0yw44_11475_c1 3300050492 Bacteria 4577
304 nmdc:mga06z11_45301_c1 3300050494 Bacteria 2223
305 nmdc:mga05p37_370_c1 3300050507 Bacteria 48311
306 nmdc:mga09592_735_c1 3300050508 Bacteria 25241
307 nmdc:mga0qj67_134624_c1 3300050509 Bacteria 2002
308 nmdc:mga0qj67_15041_c1 3300050509 Bacteria 5854
309 nmdc:mga0qj67_194241_c1 3300050509 Bacteria 1649
310 nmdc:mga0qj67_351761_c1 3300050509 Bacteria 1191
311 nmdc:mga06r32_11736_c1 3300050510 Bacteria 7888
312 nmdc:mga06r32_1832_c1 3300050510 Bacteria 18980
313 nmdc:mga08y16_3409_c1 3300050511 Bacteria 16485
314 nmdc:mga0n895_519693_c1 3300050512 Bacteria 1198
315 nmdc:mga0a205_175671_c1 3300050515 Bacteria 2037
316 nmdc:mga0sz30_1347_c1 3300050516 Bacteria 8763
317 Ga0495595_0068675 3300053084 Bacteria 1672
318 Ga0466962_0013272 3300061719 Bacteria 3962
319 Ga0466962_0018981 3300061719 Bacteria 3303
320 2744955595 2744054611 Bacteria 5611514
321 2795784486 2795385470 Bacteria 8317180
322 Ga0307507_10130237
323 JGI24743J22301_10039901
324 JGI24744J21845_10006168
325 JGI24742J22300_10010441
326 JGI24751J29686_10013145
327 JGI25406J46586_10038171
328 JGI25405J52794_10017436
329 Ga0070690_100056569
330 Ga0068869_100087078
331 Ga0070666_10001784
332 Ga0070682_100196651
333 Ga0068868_100000227
334 Ga0068868_100056535
335 Ga0070689_100018024
336 Ga0070689_100034021
337 Ga0070691_10001857
338 Ga0070687_100033726
339 Ga0070687_100324971
340 Ga0070692_10203976
341 Ga0070668_100001662
342 Ga0070668_100048790
343 Ga0070675_100541567
344 Ga0070671_100004470
345 Ga0070671_100192003
346 Ga0070674_100000223
347 Ga0070659_100024323
348 Ga0070667_100006000
349 Ga0070713_100391326
350 Ga0070710_10001032
351 Ga0070701_10000228
352 Ga0070701_10027896
353 Ga0070711_100000141
354 Ga0070711_100049563
355 Ga0070700_100003619
356 Ga0070700_100102156
357 Ga0070694_100024197
358 Ga0070708_100123477
359 Ga0070663_100004594
360 Ga0070662_100014901
361 Ga0068867_100004183
362 Ga0070706_100026215
363 Ga0070706_100112253
364 Ga0070707_100013828
365 Ga0070707_100252062
366 Ga0070707_100375177
367 Ga0070707_100376857
368 Ga0070707_100559779
369 Ga0070697_100149960
370 Ga0068853_100004865
371 Ga0070686_100047004
372 Ga0070696_100133513
373 Ga0070693_100003729
374 Ga0070665_100007150
375 Ga0070665_100012228
376 Ga0070665_100030085
377 Ga0070704_100001285
378 Ga0068854_100000492
379 Ga0068854_100058919
380 Ga0068856_100782814
381 Ga0070702_100000335
382 Ga0070702_100038613
383 Ga0068852_100052787
384 Ga0068859_100003815
385 Ga0068859_100200411
386 Ga0068866_10000345
387 Ga0068866_10390831
388 Ga0068861_100004126
389 Ga0068861_100080714
390 Ga0068861_100565134
391 Ga0068863_100009041
392 Ga0068858_100003458
393 Ga0068860_100000971
394 Ga0068862_100005339
395 Ga0081455_10000201
396 Ga0081538_10060302
397 Ga0081540_1020869
398 Ga0081539_10005668
399 Ga0070717_10112763
400 Ga0075365_10000663
401 Ga0075363_100003883
402 Ga0075364_10002720
403 Ga0075364_10074545
404 Ga0070715_10021776
405 Ga0070715_10060955
406 Ga0070716_100010178
407 Ga0070712_100000917
408 Ga0070712_100002729
409 Ga0075369_10000883
410 Ga0097621_100127269
411 Ga0075428_100003831
412 Ga0075430_100004460
413 Ga0075430_100114014
414 Ga0075430_100200557
415 Ga0075430_100347665
416 Ga0075431_100006635
417 Ga0075431_100008773
418 Ga0075431_100030916
419 Ga0075429_100000202
420 Ga0068865_100053800
421 Ga0097620_100003815
422 Ga0097620_100200411
423 Ga0105250_10042631
424 Ga0105240_10463251
425 Ga0111539_10042593
426 Ga0105245_10000678
427 Ga0105245_10410296
428 Ga0105247_10001857
429 Ga0105247_10270324
430 Ga0114129_10008326
431 Ga0114129_10508737
432 Ga0105243_10000534
433 Ga0105243_10615009
434 Ga0105242_10000799
435 Ga0105248_10000842
436 Ga0105248_10131626
437 Ga0105248_10162177
438 Ga0105237_10168485
439 Ga0105249_10003856
440 Ga0105249_10010228
441 Ga0105249_10029994
442 Ga0105239_10047790
443 Ga0105239_10133546
444 Ga0105246_10480153
445 Ga0157374_10011701
446 Ga0157378_10001491
447 Ga0163162_10035110
448 Ga0163162_10130810
449 Ga0163162_10203684
450 Ga0163162_10442729
451 Ga0157372_10010382
452 Ga0157375_10005317
453 Ga0163163_10002474
454 Ga0157380_10016490
455 Ga0157377_10093618
456 Ga0157379_10084650
457 Ga0163161_10005295
458 Ga0207656_10076250
459 Ga0207642_10000829
460 Ga0207642_10013439
461 Ga0207710_10006207
462 Ga0207688_10000119
463 Ga0207688_10000427
464 Ga0207688_10038503
465 Ga0207685_10004403
466 Ga0207685_10011323
467 Ga0207699_10027610
468 Ga0207684_10063632
469 Ga0207654_10074814
470 Ga0207693_10001162
471 Ga0207693_10001864
472 Ga0207663_10072309
473 Ga0207663_10165803
474 Ga0207662_10340226
475 Ga0207657_10085583
476 Ga0207646_10008953
477 Ga0207646_10278876
478 Ga0207646_10310157
479 Ga0207659_10373027
480 Ga0207687_10002749
481 Ga0207700_10168437
482 Ga0207664_10007760
483 Ga0207644_10002226
484 Ga0207644_10127526
485 Ga0207644_10396360
486 Ga0207690_10173505
487 Ga0207706_10011073
488 Ga0207709_10009852
489 Ga0207670_10030243
490 Ga0207670_10044543
491 Ga0207669_10001045
492 Ga0207669_10149230
493 Ga0207704_10027257
494 Ga0207665_10001371
495 Ga0207665_10008434
496 Ga0207691_10090765
497 Ga0207689_10008268
498 Ga0207689_10010021
499 Ga0207689_10152444
500 Ga0207712_10028598
501 Ga0207712_10039149
502 Ga0207668_10130971
503 Ga0207668_10704818
504 Ga0207640_10001865
505 Ga0207658_10012355
506 Ga0207658_10021729
507 Ga0207658_10032052
508 Ga0207677_10096256
509 Ga0207639_10084309
510 Ga0207678_10022251
511 Ga0207678_10038959
512 Ga0207678_10067091
513 Ga0207708_10004538
514 Ga0207702_10256530
515 Ga0207641_10006574
516 Ga0207648_10000085
517 Ga0207648_10245621
518 Ga0207676_10165313
519 Ga0207674_10251636
520 Ga0207675_100020717
521 Ga0207675_100078810
522 Ga0207675_100110674
523 Ga0207675_100629473
524 Ga0207683_10028555
525 Ga0207683_10074689
526 Ga0207428_10030737
527 Ga0268266_10005849
528 Ga0268265_10022063
529 Ga0268264_10683488
530 Ga0265337_1000956
531 Ga0265326_10001055
532 Ga0265319_1003084
533 Ga0265334_10000786
534 Ga0265318_10035344
535 Ga0265323_10016918
536 Ga0265336_10003062
537 Ga0307515_10213299
538 Ga0265338_10000956
539 Ga0265324_10001066
540 Ga0265332_10004501
541 Ga0265320_10015947
542 Ga0265325_10013498
543 Ga0265331_10132420
544 Ga0265316_10024997
545 Ga0265342_10004076
546 Ga0307407_10448411
547 Ga0316212_1005293
548 Ga0373960_0207718
549 Ga0373942_0054869
550 Ga0373931_0096610
551 Ga0372808_019021
552 Ga0373925_0000020
553 Ga0436363_0169189
554 Ga0466972_0086146
555 Ga0466972_0092036
556 Ga0466966_0032568
557 Ga0466961_0052921
558 Ga0466963_0003782
559 Ga0466963_0009956
560 Ga0466963_0492312
561 Ga0466971_0057151
562 Ga0466970_0056583
563 Ga0466970_0407753
564 Ga0466957_0164341
565 Ga0466959_0132020
566 Ga0466959_0157901
567 Ga0466959_0179416
568 Ga0466959_0199613
569 Ga0466959_0259549
570 Ga0466958_0014164
571 Ga0466958_0316458
572 Ga0466967_0002591
573 Ga0466967_0009725
574 Ga0466967_0040529
575 Ga0466967_0185230
576 Ga0466967_0273960
577 Ga0495641_0114473
578 Ga0495630_0364673
579 Ga0495635_0038750
580 Ga0496100_0001201
581 Ga0496100_0148119
582 Ga0496100_0943730
583 Ga0496101_0001844
584 Ga0496101_0080603
585 Ga0496101_0701693
586 Ga0496102_0000409
587 Ga0496102_0018528
588 Ga0496102_0030073
589 Ga0496102_0056055
590 Ga0496103_0000968
591 Ga0496103_0008949
592 Ga0496103_0016854
593 Ga0496104_0006249
594 Ga0496104_0308584
595 Ga0496105_0069336
596 Ga0496105_0414621
597 Ga0496106_0018558
598 Ga0496106_0177328
599 Ga0496106_0200190
600 Ga0496107_0001410
601 Ga0496107_0157359
602 Ga0496107_0468445
603 Ga0496108_0002944
604 Ga0496108_0130861
605 Ga0496109_0004402
606 Ga0496110_0060045
607 Ga0496111_0020893
608 Ga0496111_0062520
609 Ga0496112_0024871
610 Ga0496112_0037611
611 Ga0496113_0080842
612 Ga0496113_0157556
613 Ga0496114_0003967
614 Ga0496114_0046854
615 Ga0496114_0266575
616 Ga0496115_0367361
617 Ga0496115_0699596
618 Ga0496126_0394102
619 Ga0501047_0121887
620 Ga0501072_0059301
621 nmdc:mga03n38_34684_c1
622 nmdc:mga00v17_198617_c1
623 nmdc:mga00v17_40962_c1
624 nmdc:mga0yw44_11475_c1
625 nmdc:mga06z11_45301_c1
626 nmdc:mga05p37_370_c1
627 nmdc:mga09592_735_c1
628 nmdc:mga0qj67_134624_c1
629 nmdc:mga0qj67_15041_c1
630 nmdc:mga0qj67_194241_c1
631 nmdc:mga0qj67_351761_c1
632 nmdc:mga06r32_11736_c1
633 nmdc:mga06r32_1832_c1
634 nmdc:mga08y16_3409_c1
635 nmdc:mga0n895_519693_c1
636 nmdc:mga0a205_175671_c1
637 nmdc:mga0sz30_1347_c1
638 Ga0495595_0068675
639 Ga0466962_0013272
640 Ga0466962_0018981
641 2744955595
642 2795784486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

2

185

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

8

198

0.9

PF08659

KR

KR domain

3

159

0.81

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

4

158

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i1j-assembly1.cif.gz_A structure of a putative short chain dehydrogenase from pseudomonas syringae 0.9296 9 229
3gy0-assembly1.cif.gz_A-2 crystal structure of putatitve short chain dehydrogenase from shigella flexneri 2a str. 301 complexed with nadp 0.928 9 230
3gz4-assembly1.cif.gz_B crystal structure of putative short chain dehydrogenase from escherichia coli cft073 complexed with nadph 0.9247 9 229
3g1t-assembly1.cif.gz_A-2 crystal structure of short chain dehydrogenase from salmonella enterica subsp. enterica serovar typhi str. ct18 0.9238 7 229
8aer-assembly1.cif.gz_A malonyl-coa reductase from chloroflexus aurantiacus - c-terminal y731a variant 0.9147 6 188
ID Description Score Start End Superfamily
af_Q0E0D3_22_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9294 10 208 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9279 7 193 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9145 10 53 3.40.50.720
6b9uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9123 9 228 3.40.50.720
af_Q0E0D3_22_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9076 10 208 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6V8L3X4-F1-model_v4 Short-chain dehydrogenase 0.9958 72 236 GO:0004757
GO:0005737
GO:0006729
AF-A0A428YXN4-F1-model_v4 Short-chain dehydrogenase 0.9939 9 228 GO:0016491
AF-A0A6I5X531-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9912 8 232 GO:0016491
AF-A0A7W7Q706-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9883 10 228 GO:0016020
GO:0016491
AF-C7Q6M4-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.988 6 232 GO:0016491

Map