F406036

General Info

Members Datasets Scaffolds Average Seq Length
321 228 277 240

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10022959|Ga0265324_100229592
Length 231
Sequence MLKIARLHAFYGKSHVLHGVDLEVGAGEIVALLGRNGSGRSTTAKAVMGLVDAQGSVQFEGREIRGLKSYEIAHRGLGYVPENRDIFPKLTVHQNLLLGQKTGAKDARWGFDDMYAMFPRLKERQHTEAGVLSGGEQQMLTLCRSLMGDPRLVIIDEPTEGLAPKIVELVAEYLQALKARGVSVLLIEQKLTIALQISQRCVVMGHGRIVFEGTPEALRADAYVRKEWLEV

Samples

Sample ID Description Type Environment
1 2534681786 Brucella suis 92/29 Isolate Unclassified
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
7 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
8 2643221569 Achromobacter sp. Root565 Isolate Unclassified
9 2643221585 Pelomonas sp. Root662 Isolate Unclassified
10 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
11 2643221594 Achromobacter sp. Root170 Isolate Unclassified
12 2643221621 Achromobacter sp. Root83 Isolate Unclassified
13 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
14 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
17 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
18 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543012 Acidovorax sp. CF301 Isolate Unclassified
21 2738543013 Variovorax sp. BT01 Isolate Unclassified
22 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
23 2816332133 Acidovorax radicis 2721A Isolate Unclassified
24 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
25 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
26 2842747753 Variovorax sp. R-72060 Isolate Unclassified
27 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
28 2855730933 Achromobacter sp. HZ28 Isolate Nodule
29 2855767633 Achromobacter sp. HZ34 Isolate Nodule
30 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
31 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
32 2858950400 Achromobacter sp. K91 Isolate Unclassified
33 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
34 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
35 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
36 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
37 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
38 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
39 2941479691
40 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
41 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
42 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
43 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
44 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
45 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
46 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
47 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
48 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
49 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
50 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
51 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
54 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
55 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
140 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
141 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
217 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
218 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
224 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
225 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
226 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
227 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
228 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.29
Metatranscriptomes 0
Isolates 13.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.68
Nodule 0.93
Rhizoplane 6.54
Rhizosphere 43.3
Stem 0
Stem Tuber 0
Unclassified 25.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000182 3300002704 Bacteria 26998
2 JGI25156J39149_1000304 3300002705 Bacteria 32589
3 JGI25154J39366_1000268 3300002738 Bacteria 32589
4 JGI25157J39369_1000334 3300002741 Bacteria 33420
5 JGI25157J39369_1000373 3300002741 Bacteria 30848
6 JGI25152J39213_1002258 3300002773 Bacteria 7443
7 JGI25151J46595_10000639 3300003187 Bacteria 30118
8 JGI25151J46595_10003224 3300003187 Bacteria 9120
9 JGI25153J46596_10000537 3300003215 Bacteria 23734
10 Ga0055532_1000130 3300003758 Bacteria 74140
11 Ga0055525_1000084 3300003759 Bacteria 155319
12 Ga0055526_1000296 3300003771 Bacteria 41724
13 Ga0055534_1000538 3300003784 Bacteria 20301
14 Ga0055534_1014274 3300003784 Bacteria 1494
15 Ga0055540_1054071 3300003792 Bacteria 820
16 Ga0055543_1027223 3300004625 Bacteria 1013
17 Ga0065165_1000246 3300005262 Bacteria 93310
18 Ga0065165_1001709 3300005262 Bacteria 22025
19 Ga0070673_100352090 3300005364 Bacteria 1307
20 Ga0070659_100259661 3300005366 Bacteria 1441
21 Ga0070667_100009961 3300005367 Bacteria 7877
22 Ga0070663_100159576 3300005455 Bacteria 1735
23 Ga0068853_100130972 3300005539 Bacteria 2245
24 Ga0068853_100241610 3300005539 Bacteria 1655
25 Ga0070672_100386236 3300005543 Bacteria 1198
26 Ga0070665_100533089 3300005548 Bacteria 1186
27 Ga0068855_100272969 3300005563 Bacteria 1880
28 Ga0068859_100090977 3300005617 Bacteria 3102
29 Ga0068864_100347036 3300005618 Bacteria 1399
30 Ga0068861_100085698 3300005719 Bacteria 2475
31 Ga0068863_100006493 3300005841 Bacteria 11469
32 Ga0068863_100243344 3300005841 Bacteria 1736
33 Ga0068860_100271391 3300005843 Bacteria 1656
34 Ga0068862_100041738 3300005844 Bacteria 3905
35 Ga0081539_10126190 3300005985 Bacteria 1264
36 Ga0075365_10184409 3300006038 Bacteria 1460
37 Ga0075368_10143412 3300006042 Bacteria 996
38 Ga0075367_10101552 3300006178 Bacteria 1759
39 Ga0075366_10002750 3300006195 Bacteria 9093
40 Ga0075366_10017277 3300006195 Bacteria 4151
41 Ga0075366_10124969 3300006195 Bacteria 1551
42 Ga0075366_10222547 3300006195 Bacteria 1150
43 Ga0097621_100016123 3300006237 Bacteria 5642
44 Ga0075370_10000806 3300006353 Bacteria 12561
45 Ga0075370_10057355 3300006353 Bacteria 2214
46 Ga0075370_10179696 3300006353 Bacteria 1245
47 Ga0075370_10260954 3300006353 Bacteria 1027
48 Ga0075370_10272436 3300006353 Bacteria 1005
49 Ga0068871_100015509 3300006358 Bacteria 5705
50 Ga0075433_10284091 3300006852 Bacteria 1466
51 Ga0075434_100664340 3300006871 Bacteria 1060
52 Ga0097620_100090978 3300006931 Bacteria 3102
53 Ga0075435_100810728 3300007076 Bacteria 815
54 Ga0105240_10052581 3300009093 Bacteria 5119
55 Ga0105240_10154469 3300009093 Bacteria 2731
56 Ga0105248_11377480 3300009177 Bacteria 798
57 Ga0105237_10014914 3300009545 Bacteria 8103
58 Ga0105239_10009446 3300010375 Bacteria 10988
59 Ga0105246_10822524 3300011119 Bacteria 826
60 Ga0157373_10007445 3300013100 Bacteria 8143
61 Ga0157371_10124750 3300013102 Bacteria 1831
62 Ga0157370_10002111 3300013104 Bacteria 24281
63 Ga0157370_10026421 3300013104 Bacteria 5733
64 Ga0157369_10000456 3300013105 Bacteria 54115
65 Ga0163162_10183247 3300013306 Bacteria 2220
66 Ga0182008_10000207 3300014497 Bacteria 46359
67 Ga0182008_10001172 3300014497 Bacteria 18079
68 Ga0157376_10289677 3300014969 Bacteria 1545
69 Ga0182006_1050845 3300015261 Bacteria 1596
70 Ga0182007_10000185 3300015262 Bacteria 42160
71 Ga0182005_1026006 3300015265 Bacteria 1597
72 Ga0163161_10151893 3300017792 Bacteria 1760
73 Ga0163161_10236378 3300017792 Bacteria 1419
74 Ga0209435_100046 3300025206 Bacteria 95081
75 Ga0209147_100157 3300025229 Bacteria 92005
76 Ga0209563_100025 3300025230 Bacteria 596456
77 Ga0209258_100733 3300025242 Bacteria 21360
78 Ga0207425_1000259 3300025245 Bacteria 39126
79 Ga0209646_1000156 3300025246 Bacteria 95083
80 Ga0209026_1000267 3300025250 Bacteria 63271
81 Ga0209148_1007780 3300025254 Bacteria 2197
82 Ga0209759_1000348 3300025256 Bacteria 60134
83 Ga0209129_1000175 3300025258 Bacteria 93817
84 Ga0209673_1008351 3300025273 Bacteria 4617
85 Ga0209130_1002434 3300025284 Bacteria 9333
86 Ga0209130_1007846 3300025284 Bacteria 3233
87 Ga0209675_1000859 3300025291 Bacteria 19681
88 Ga0209675_1002909 3300025291 Bacteria 8479
89 Ga0209676_1006086 3300025292 Bacteria 6066
90 Ga0209676_1019922 3300025292 Bacteria 2294
91 Ga0209025_1000018 3300025294 Bacteria 686898
92 Ga0209025_1000133 3300025294 Bacteria 195885
93 Ga0209025_1000853 3300025294 Bacteria 48270
94 Ga0209564_1000136 3300025295 Bacteria 185198
95 Ga0209564_1028842 3300025295 Bacteria 1762
96 Ga0209758_1000275 3300025297 Bacteria 102404
97 Ga0209758_1080396 3300025297 Bacteria 988
98 Ga0209050_1000247 3300025298 Bacteria 116514
99 Ga0209050_1001725 3300025298 Bacteria 21758
100 Ga0209050_1068675 3300025298 Bacteria 801
101 Ga0209051_1026700 3300025303 Bacteria 2320
102 Ga0209051_1039952 3300025303 Bacteria 1688
103 Ga0209051_1060075 3300025303 Bacteria 1202
104 Ga0207671_10098708 3300025914 Bacteria 2209
105 Ga0207694_10151243 3300025924 Bacteria 1870
106 Ga0207650_10246491 3300025925 Bacteria 1445
107 Ga0207644_10221347 3300025931 Bacteria 1500
108 Ga0207690_10224863 3300025932 Bacteria 1438
109 Ga0207691_10164522 3300025940 Bacteria 1944
110 Ga0207711_10713844 3300025941 Bacteria 935
111 Ga0207667_10973035 3300025949 Bacteria 837
112 Ga0207712_10401576 3300025961 Bacteria 1152
113 Ga0207640_10343302 3300025981 Bacteria 1197
114 Ga0207639_10033289 3300026041 Bacteria 3801
115 Ga0207641_10151013 3300026088 Bacteria 2104
116 Ga0207676_10278665 3300026095 Bacteria 1517
117 Ga0207674_10113399 3300026116 Bacteria 2684
118 Ga0207674_10149032 3300026116 Bacteria 2297
119 Ga0207675_100101667 3300026118 Bacteria 2708
120 Ga0209371_1020428 3300027312 Bacteria 1632
121 Ga0268266_10345340 3300028379 Bacteria 1398
122 Ga0268265_10551459 3300028380 Bacteria 1094
123 Ga0268264_10215836 3300028381 Bacteria 1763
124 Ga0307517_10275524 3300028786 Bacteria 964
125 Ga0307515_10185248 3300028794 Bacteria 2014
126 Ga0265324_10022959 3300029957 Bacteria 2225
127 Ga0268256_1022888 3300030500 Bacteria 1632
128 Ga0316182_1008399 3300030745 Bacteria 4575
129 Ga0265332_10158523 3300031238 Bacteria 946
130 Ga0265328_10006250 3300031239 Bacteria 5060
131 Ga0265331_10001230 3300031250 Bacteria 19256
132 Ga0265327_10000266 3300031251 Bacteria 103308
133 Ga0265327_10006362 3300031251 Bacteria 9468
134 Ga0265327_10073904 3300031251 Bacteria 1699
135 Ga0307513_10007462 3300031456 Bacteria 14170
136 Ga0307513_10022192 3300031456 Bacteria 7468
137 Ga0307513_10161978 3300031456 Bacteria 2128
138 Ga0307513_10216331 3300031456 Bacteria 1742
139 Ga0307513_10255184 3300031456 Bacteria 1547
140 Ga0307509_10334046 3300031507 Bacteria 1246
141 Ga0307516_10013066 3300031730 Bacteria 8879
142 Ga0307407_10296558 3300031903 Bacteria 1126
143 Ga0307412_10000512 3300031911 Bacteria 23134
144 Ga0307412_10016402 3300031911 Bacteria 4412
145 Ga0307412_10104628 3300031911 Bacteria 2009
146 Ga0307416_100011432 3300032002 Bacteria 5921
147 Ga0307510_10070419 3300033180 Bacteria 3492
148 Ga0395900_0190713 3300037418 Bacteria 2079
149 Ga0395900_0450486 3300037418 Bacteria 1243
150 Ga0451793_0014015 3300041452 Bacteria 2637
151 Ga0466972_0078133 3300044658 Bacteria 1576
152 Ga0466965_0005137 3300044683 Bacteria 5874
153 Ga0466965_0045602 3300044683 Bacteria 2168
154 Ga0466960_0009903 3300044901 Bacteria 3943
155 Ga0495627_021365 3300046453 Bacteria 2147
156 Ga0495638_0173726 3300046460 Bacteria 1234
157 Ga0495639_0027894 3300046475 Bacteria 2500
158 Ga0495632_0003923 3300046519 Bacteria 10332
159 Ga0495637_0004153 3300046520 Bacteria 7535
160 Ga0495642_0040956 3300046528 Bacteria 1883
161 Ga0495654_0000462 3300046530 Bacteria 33930
162 Ga0495621_0061230 3300046539 Bacteria 1367
163 Ga0495621_0063489 3300046539 Bacteria 1346
164 Ga0495621_0140702 3300046539 Bacteria 944
165 Ga0495633_0003193 3300046558 Bacteria 11069
166 Ga0495588_0188022 3300046674 Bacteria 1091
167 Ga0495613_0000194 3300046689 Bacteria 59997
168 Ga0495670_0107426 3300046691 Bacteria 1442
169 Ga0495673_0103399 3300047469 Bacteria 1148
170 Ga0495681_0000235 3300047470 Bacteria 45882
171 Ga0495686_0028926 3300047472 Bacteria 3607
172 Ga0495626_0001523 3300048091 Bacteria 18212
173 Ga0496100_0002476 3300048903 Bacteria 9386
174 Ga0496101_0000519 3300048904 Bacteria 24028
175 Ga0496101_0442701 3300048904 Bacteria 1025
176 Ga0496102_0001291 3300048905 Bacteria 22509
177 Ga0496102_0048973 3300048905 Bacteria 3843
178 Ga0496103_0004323 3300048906 Bacteria 8633
179 Ga0496104_0002481 3300048907 Bacteria 15897
180 Ga0496105_0000375 3300048908 Bacteria 29508
181 Ga0496105_0230923 3300048908 Bacteria 1504
182 Ga0496106_0002941 3300048909 Bacteria 12680
183 Ga0496106_0051310 3300048909 Bacteria 3110
184 Ga0496109_0045183 3300048912 Bacteria 3996
185 Ga0496109_0047712 3300048912 Bacteria 3895
186 Ga0496110_0001501 3300048913 Bacteria 16929
187 Ga0496110_0125915 3300048913 Bacteria 2311
188 Ga0496110_0179466 3300048913 Bacteria 1922
189 Ga0496111_0013567 3300048914 Bacteria 5548
190 Ga0496111_0069494 3300048914 Bacteria 2561
191 Ga0496114_1045545 3300048917 Bacteria 700
192 Ga0496116_0014717 3300048919 Bacteria 6232
193 Ga0496117_0007204 3300048920 Bacteria 10965
194 Ga0496117_0020810 3300048920 Bacteria 5338
195 Ga0496118_0019252 3300048921 Bacteria 6110
196 Ga0496118_0037960 3300048921 Bacteria 3867
197 Ga0496119_0176237 3300048922 Bacteria 1125
198 Ga0496120_0002371 3300048923 Bacteria 19229
199 Ga0496121_0000153 3300048924 Bacteria 150635
200 Ga0496121_0011190 3300048924 Bacteria 10001
201 Ga0496121_0114041 3300048924 Bacteria 2055
202 Ga0496121_0121436 3300048924 Bacteria 1972
203 Ga0496122_0000034 3300048925 Bacteria 320661
204 Ga0496122_0005806 3300048925 Bacteria 14506
205 Ga0496122_0063309 3300048925 Bacteria 2700
206 Ga0496122_0092516 3300048925 Bacteria 2055
207 Ga0496122_0104443 3300048925 Bacteria 1882
208 Ga0496122_0265609 3300048925 Bacteria 949
209 Ga0496123_0000141 3300048926 Bacteria 147111
210 Ga0496123_0001621 3300048926 Bacteria 30304
211 Ga0496123_0014329 3300048926 Bacteria 6579
212 Ga0496124_0000123 3300048927 Bacteria 161106
213 Ga0496124_0006512 3300048927 Bacteria 12709
214 Ga0496124_0023619 3300048927 Bacteria 5609
215 Ga0496124_0060308 3300048927 Bacteria 3182
216 Ga0496125_0002020 3300048928 Bacteria 27488
217 Ga0496125_0004960 3300048928 Bacteria 15051
218 Ga0496125_0035119 3300048928 Bacteria 4405
219 Ga0496125_0116523 3300048928 Bacteria 1918
220 Ga0496125_0164776 3300048928 Bacteria 1500
221 Ga0496125_0200237 3300048928 Bacteria 1308
222 Ga0496126_0000674 3300048929 Bacteria 63031
223 Ga0496126_0004010 3300048929 Bacteria 17942
224 Ga0496126_0061983 3300048929 Bacteria 3357
225 Ga0501031_0012665 3300049568 Bacteria 5507
226 Ga0501031_0100690 3300049568 Bacteria 1885
227 Ga0501032_0000816 3300049569 Bacteria 25276
228 Ga0501033_0003584 3300049570 Bacteria 12688
229 Ga0501034_0000134 3300049571 Bacteria 137745
230 Ga0501034_0006814 3300049571 Bacteria 12219
231 Ga0501034_0031655 3300049571 Bacteria 5373
232 Ga0501036_0001771 3300049572 Bacteria 16761
233 Ga0501037_0004252 3300049573 Bacteria 10376
234 Ga0501037_0013688 3300049573 Bacteria 5976
235 Ga0501038_0000494 3300049574 Bacteria 34711
236 Ga0501043_0000038 3300049579 Bacteria 128656
237 Ga0501043_0001194 3300049579 Bacteria 22852
238 Ga0501046_0000049 3300049580 Bacteria 135088
239 Ga0501046_0002440 3300049580 Bacteria 17427
240 Ga0501047_0000039 3300049581 Bacteria 187849
241 Ga0501047_0004711 3300049581 Bacteria 12827
242 Ga0501047_0090152 3300049581 Bacteria 2943
243 Ga0501048_0025913 3300049582 Bacteria 4272
244 Ga0501035_0000874 3300049822 Bacteria 32016
245 Ga0501035_0020751 3300049822 Bacteria 6038
246 Ga0501035_0378192 3300049822 Bacteria 1181
247 Ga0501044_0004644 3300049823 Bacteria 15368
248 Ga0501044_0012609 3300049823 Bacteria 9154
249 Ga0501044_0120424 3300049823 Bacteria 2626
250 Ga0501044_0241711 3300049823 Bacteria 1749
251 Ga0501045_0001444 3300049824 Bacteria 15788
252 nmdc:mga0k408_133302_c1 3300050493 Bacteria 1475
253 nmdc:mga0k408_63220_c2 3300050493 Bacteria 1416
254 nmdc:mga0k408_63238_c1 3300050493 Bacteria 2153
255 nmdc:mga0k408_83546_c1 3300050493 Bacteria 1872
256 nmdc:mga06z11_75134_c1 3300050494 Bacteria 1798
257 nmdc:mga07m45_186457_c1 3300050496 Bacteria 1206
258 nmdc:mga07m45_44575_c1 3300050496 Bacteria 2490
259 nmdc:mga07m45_59696_c1 3300050496 Bacteria 2158
260 nmdc:mga0n895_656473_c1 3300050512 Bacteria 1047
261 Ga0500578_0000282 3300053086 Bacteria 62821
262 Ga0500578_0011827 3300053086 Bacteria 5638
263 Ga0500641_0055972 3300053096 Bacteria 1634
264 Ga0500572_034735 3300053111 Bacteria 1430
265 Ga0500607_154948 3300053121 Bacteria 1056
266 Ga0500628_003983 3300053129 Bacteria 2439
267 Ga0500642_0003827 3300053130 Bacteria 4619
268 Ga0500652_000383 3300053131 Bacteria 15945
269 Ga0500652_096752 3300053131 Bacteria 1233
270 Ga0500559_0000193 3300053136 Bacteria 49137
271 Ga0500568_0015225 3300053139 Bacteria 3447
272 Ga0500568_0033481 3300053139 Bacteria 2108
273 Ga0500577_0136691 3300053142 Bacteria 1031
274 Ga0500622_0000413 3300053156 Bacteria 40682
275 Ga0500622_0001707 3300053156 Bacteria 17033
276 Ga0500636_0154169 3300053177 Bacteria 1259
277 Ga0500645_003922 3300053730 Bacteria 5868

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_1045545 Ga0496114_1045545_19_663 214
2 iso_pu_bacteria 8006994254 8007001660 229
3 3300029957 Ga0265324_10022959 Ga0265324_100229592 231
4 3300049822 Ga0501035_0020751 Ga0501035_0020751_5315_6010 231
5 iso_pu_bacteria 2854916844 2854920445 231
6 iso_pu_bacteria 2899803654 2899804954 231
7 iso_pu_bacteria 2643221585 2643933398 232
8 3300009093 Ga0105240_10154469 Ga0105240_101544692 233
9 3300028379 Ga0268266_10345340 Ga0268266_103453401 233
10 3300044683 Ga0466965_0045602 Ga0466965_0045602_1348_2049 233
11 iso_pu_bacteria 8048746797 8048748773 233
12 3300005563 Ga0068855_100272969 Ga0068855_1002729692 234
13 3300025949 Ga0207667_10973035 Ga0207667_109730351 234
14 3300047472 Ga0495686_0028926 Ga0495686_0028926_2757_3461 234
15 iso_pu_bacteria 2534681786 2535486028 234
16 iso_pu_bacteria 2857576091 2857576498 234
17 3300005985 Ga0081539_10126190 Ga0081539_101261902 235
18 3300046539 Ga0495621_0140702 Ga0495621_0140702_64_807 235
19 iso_pu_bacteria 2599185292 2599905913 235
20 iso_pu_bacteria 2643221569 2643859099 235
21 iso_pu_bacteria 2643221594 2643980071 235
22 iso_pu_bacteria 2643221621 2644122968 235
23 iso_pu_bacteria 2738543012 2739244250 235
24 iso_pu_bacteria 2808606395 2809033795 235
25 iso_pu_bacteria 2816332133 2816472522 235
26 iso_pu_bacteria 2858950400 2858954557 235
27 iso_pu_bacteria 2887375801 2887376194 235
28 iso_pu_bacteria 2904541872 2904547007 235
29 iso_pu_bacteria 2929160207 2929164479 235
30 iso_pu_bacteria 2941479691 2941484907 235
31 3300004625 Ga0055543_1027223 Ga0055543_10272231 236
32 3300005262 Ga0065165_1000246 Ga0065165_100024615 236
33 3300015261 Ga0182006_1050845 Ga0182006_10508452 236
34 3300025284 Ga0209130_1007846 Ga0209130_10078462 236
35 3300031456 Ga0307513_10007462 Ga0307513_1000746210 236
36 iso_pu_bacteria 2588253510 2588295815 236
37 iso_pu_bacteria 2619619299 2621297418 236
38 iso_pu_bacteria 2643221592 2643971045 236
39 iso_pu_bacteria 2643221625 2644144208 236
40 iso_pu_bacteria 2643221648 2644275230 236
41 iso_pu_bacteria 2643221683 2644467758 236
42 iso_pu_bacteria 2738541265 2738672857 236
43 iso_pu_bacteria 2738541282 2738751250 236
44 iso_pu_bacteria 2738541303 2738860291 236
45 iso_pu_bacteria 2816332298 2817493474 236
46 iso_pu_bacteria 2855730933 2855731811 236
47 iso_pu_bacteria 2855767633 2855768517 236
48 iso_pu_bacteria 2857542790 2857547181 236
49 iso_pu_bacteria 2881412998 2881413306 236
50 iso_pu_bacteria 2945909444 2945909471 236
51 iso_pu_bacteria 2945984333 2945988549 236
52 3300003759 Ga0055525_1000084 Ga0055525_1000084147 237
53 3300025230 Ga0209563_100025 Ga0209563_100025148 237
54 3300025297 Ga0209758_1080396 Ga0209758_10803962 237
55 3300028794 Ga0307515_10185248 Ga0307515_101852482 237
56 3300031239 Ga0265328_10006250 Ga0265328_100062504 237
57 3300031250 Ga0265331_10001230 Ga0265331_1000123018 237
58 3300031251 Ga0265327_10000266 Ga0265327_1000026696 237
59 3300031456 Ga0307513_10022192 Ga0307513_100221922 237
60 3300031507 Ga0307509_10334046 Ga0307509_103340462 237
61 3300033180 Ga0307510_10070419 Ga0307510_100704192 237
62 3300053096 Ga0500641_0055972 Ga0500641_0055972_278_991 237
63 3300053121 Ga0500607_154948 Ga0500607_154948_288_1001 237
64 3300053131 Ga0500652_096752 Ga0500652_096752_46_759 237
65 3300053136 Ga0500559_0000193 Ga0500559_0000193_24849_25562 237
66 3300053139 Ga0500568_0033481 Ga0500568_0033481_1294_2007 237
67 3300053156 Ga0500622_0000413 Ga0500622_0000413_15146_15859 237
68 3300053177 Ga0500636_0154169 Ga0500636_0154169_534_1247 237
69 iso_pu_bacteria 2585428057 2587730921 237
70 iso_pu_bacteria 2585428058 2587736044 237
71 iso_pu_bacteria 2585428062 2587756354 237
72 3300006195 Ga0075366_10222547 Ga0075366_102225471 238
73 3300025294 Ga0209025_1000853 Ga0209025_10008538 238
74 3300049571 Ga0501034_0000134 Ga0501034_0000134_36119_36835 238
75 3300053086 Ga0500578_0011827 Ga0500578_0011827_2858_3574 238
76 3300053730 Ga0500645_003922 Ga0500645_003922_4143_4859 238
77 3300003187 JGI25151J46595_10003224 JGI25151J46595_100032247 239
78 3300005364 Ga0070673_100352090 Ga0070673_1003520902 239
79 3300005617 Ga0068859_100090977 Ga0068859_1000909772 239
80 3300005618 Ga0068864_100347036 Ga0068864_1003470362 239
81 3300005719 Ga0068861_100085698 Ga0068861_1000856983 239
82 3300005841 Ga0068863_100006493 Ga0068863_1000064933 239
83 3300005841 Ga0068863_100243344 Ga0068863_1002433442 239
84 3300005843 Ga0068860_100271391 Ga0068860_1002713912 239
85 3300005844 Ga0068862_100041738 Ga0068862_1000417382 239
86 3300006038 Ga0075365_10184409 Ga0075365_101844092 239
87 3300006042 Ga0075368_10143412 Ga0075368_101434121 239
88 3300006178 Ga0075367_10101552 Ga0075367_101015522 239
89 3300006195 Ga0075366_10002750 Ga0075366_100027502 239
90 3300006237 Ga0097621_100016123 Ga0097621_1000161235 239
91 3300006353 Ga0075370_10000806 Ga0075370_100008064 239
92 3300006358 Ga0068871_100015509 Ga0068871_1000155093 239
93 3300006852 Ga0075433_10284091 Ga0075433_102840912 239
94 3300006871 Ga0075434_100664340 Ga0075434_1006643402 239
95 3300006931 Ga0097620_100090978 Ga0097620_1000909782 239
96 3300007076 Ga0075435_100810728 Ga0075435_1008107281 239
97 3300009177 Ga0105248_11377480 Ga0105248_113774801 239
98 3300013102 Ga0157371_10124750 Ga0157371_101247502 239
99 3300025292 Ga0209676_1006086 Ga0209676_10060864 239
100 3300025294 Ga0209025_1000133 Ga0209025_100013393 239
101 3300025298 Ga0209050_1068675 Ga0209050_10686751 239
102 3300025303 Ga0209051_1039952 Ga0209051_10399522 239
103 3300025931 Ga0207644_10221347 Ga0207644_102213472 239
104 3300025941 Ga0207711_10713844 Ga0207711_107138441 239
105 3300025961 Ga0207712_10401576 Ga0207712_104015762 239
106 3300026088 Ga0207641_10151013 Ga0207641_101510133 239
107 3300026095 Ga0207676_10278665 Ga0207676_102786652 239
108 3300026118 Ga0207675_100101667 Ga0207675_1001016672 239
109 3300027312 Ga0209371_1020428 Ga0209371_10204282 239
110 3300028380 Ga0268265_10551459 Ga0268265_105514591 239
111 3300028381 Ga0268264_10215836 Ga0268264_102158361 239
112 3300030500 Ga0268256_1022888 Ga0268256_10228882 239
113 3300031456 Ga0307513_10161978 Ga0307513_101619783 239
114 3300031456 Ga0307513_10255184 Ga0307513_102551842 239
115 3300046530 Ga0495654_0000462 Ga0495654_0000462_24152_24871 239
116 3300047469 Ga0495673_0103399 Ga0495673_0103399_395_1114 239
117 3300048908 Ga0496105_0230923 Ga0496105_0230923_310_1029 239
118 3300048919 Ga0496116_0014717 Ga0496116_0014717_1838_2617 239
119 3300048920 Ga0496117_0020810 Ga0496117_0020810_2433_3152 239
120 3300048921 Ga0496118_0019252 Ga0496118_0019252_657_1376 239
121 3300048921 Ga0496118_0037960 Ga0496118_0037960_2192_2911 239
122 3300048922 Ga0496119_0176237 Ga0496119_0176237_244_963 239
123 3300048923 Ga0496120_0002371 Ga0496120_0002371_14444_15163 239
124 3300048924 Ga0496121_0000153 Ga0496121_0000153_38275_38994 239
125 3300048925 Ga0496122_0005806 Ga0496122_0005806_922_1665 239
126 3300048925 Ga0496122_0063309 Ga0496122_0063309_1006_1725 239
127 3300048925 Ga0496122_0104443 Ga0496122_0104443_749_1468 239
128 3300048926 Ga0496123_0001621 Ga0496123_0001621_18927_19670 239
129 3300048926 Ga0496123_0014329 Ga0496123_0014329_3133_3852 239
130 3300048927 Ga0496124_0060308 Ga0496124_0060308_1957_2676 239
131 3300048928 Ga0496125_0002020 Ga0496125_0002020_19575_20294 239
132 3300048928 Ga0496125_0035119 Ga0496125_0035119_2326_3045 239
133 3300048928 Ga0496125_0116523 Ga0496125_0116523_854_1597 239
134 3300048928 Ga0496125_0200237 Ga0496125_0200237_134_853 239
135 3300048929 Ga0496126_0004010 Ga0496126_0004010_2391_3110 239
136 3300048929 Ga0496126_0061983 Ga0496126_0061983_980_1723 239
137 3300049568 Ga0501031_0012665 Ga0501031_0012665_2196_2915 239
138 3300049569 Ga0501032_0000816 Ga0501032_0000816_24315_25034 239
139 3300049570 Ga0501033_0003584 Ga0501033_0003584_4075_4794 239
140 3300049571 Ga0501034_0006814 Ga0501034_0006814_7554_8273 239
141 3300049571 Ga0501034_0031655 Ga0501034_0031655_676_1395 239
142 3300049572 Ga0501036_0001771 Ga0501036_0001771_2354_3073 239
143 3300049573 Ga0501037_0004252 Ga0501037_0004252_5567_6286 239
144 3300049574 Ga0501038_0000494 Ga0501038_0000494_29215_29934 239
145 3300049579 Ga0501043_0000038 Ga0501043_0000038_125592_126311 239
146 3300049579 Ga0501043_0001194 Ga0501043_0001194_13703_14422 239
147 3300049580 Ga0501046_0000049 Ga0501046_0000049_2369_3088 239
148 3300049580 Ga0501046_0002440 Ga0501046_0002440_10083_10802 239
149 3300049581 Ga0501047_0000039 Ga0501047_0000039_184785_185504 239
150 3300049581 Ga0501047_0004711 Ga0501047_0004711_7039_7758 239
151 3300049582 Ga0501048_0025913 Ga0501048_0025913_2480_3199 239
152 3300049822 Ga0501035_0000874 Ga0501035_0000874_31183_31902 239
153 3300049823 Ga0501044_0012609 Ga0501044_0012609_666_1385 239
154 3300049823 Ga0501044_0120424 Ga0501044_0120424_1745_2464 239
155 3300049824 Ga0501045_0001444 Ga0501045_0001444_2255_2974 239
156 3300050493 nmdc:mga0k408_133302_c1 nmdc:mga0k408_133302_c1_156_875 239
157 3300050493 nmdc:mga0k408_63238_c1 nmdc:mga0k408_63238_c1_782_1501 239
158 3300050494 nmdc:mga06z11_75134_c1 nmdc:mga06z11_75134_c1_736_1455 239
159 3300050496 nmdc:mga07m45_44575_c1 nmdc:mga07m45_44575_c1_621_1340 239
160 3300050512 nmdc:mga0n895_656473_c1 nmdc:mga0n895_656473_c1_269_988 239
161 iso_pu_bacteria 2738543013 2739250699 239
162 iso_pu_bacteria 2842747753 2842752923 239
163 iso_pu_bacteria 2954767861 2954768302 239
164 3300003187 JGI25151J46595_10000639 JGI25151J46595_1000063927 240
165 3300003784 Ga0055534_1000538 Ga0055534_100053813 240
166 3300003792 Ga0055540_1054071 Ga0055540_10540711 240
167 3300005262 Ga0065165_1001709 Ga0065165_10017098 240
168 3300005367 Ga0070667_100009961 Ga0070667_1000099616 240
169 3300005455 Ga0070663_100159576 Ga0070663_1001595762 240
170 3300005543 Ga0070672_100386236 Ga0070672_1003862362 240
171 3300005548 Ga0070665_100533089 Ga0070665_1005330892 240
172 3300006353 Ga0075370_10272436 Ga0075370_102724361 240
173 3300011119 Ga0105246_10822524 Ga0105246_108225241 240
174 3300013104 Ga0157370_10002111 Ga0157370_1000211119 240
175 3300013306 Ga0163162_10183247 Ga0163162_101832472 240
176 3300014497 Ga0182008_10000207 Ga0182008_100002076 240
177 3300014497 Ga0182008_10001172 Ga0182008_1000117213 240
178 3300014969 Ga0157376_10289677 Ga0157376_102896772 240
179 3300015262 Ga0182007_10000185 Ga0182007_1000018521 240
180 3300015265 Ga0182005_1026006 Ga0182005_10260062 240
181 3300017792 Ga0163161_10236378 Ga0163161_102363782 240
182 3300025284 Ga0209130_1002434 Ga0209130_10024347 240
183 3300025291 Ga0209675_1000859 Ga0209675_10008598 240
184 3300025292 Ga0209676_1019922 Ga0209676_10199223 240
185 3300025294 Ga0209025_1000018 Ga0209025_1000018166 240
186 3300025295 Ga0209564_1028842 Ga0209564_10288422 240
187 3300025298 Ga0209050_1000247 Ga0209050_100024760 240
188 3300025303 Ga0209051_1026700 Ga0209051_10267002 240
189 3300025924 Ga0207694_10151243 Ga0207694_101512432 240
190 3300025940 Ga0207691_10164522 Ga0207691_101645222 240
191 3300031238 Ga0265332_10158523 Ga0265332_101585232 240
192 3300031251 Ga0265327_10006362 Ga0265327_100063627 240
193 3300031251 Ga0265327_10073904 Ga0265327_100739042 240
194 3300031456 Ga0307513_10216331 Ga0307513_102163312 240
195 3300031911 Ga0307412_10016402 Ga0307412_100164022 240
196 3300032002 Ga0307416_100011432 Ga0307416_1000114325 240
197 3300037418 Ga0395900_0190713 Ga0395900_0190713_693_1415 240
198 3300046475 Ga0495639_0027894 Ga0495639_0027894_1393_2115 240
199 3300046528 Ga0495642_0040956 Ga0495642_0040956_161_883 240
200 3300046539 Ga0495621_0061230 Ga0495621_0061230_242_964 240
201 3300046539 Ga0495621_0063489 Ga0495621_0063489_567_1289 240
202 3300046558 Ga0495633_0003193 Ga0495633_0003193_3857_4579 240
203 3300046674 Ga0495588_0188022 Ga0495588_0188022_347_1069 240
204 3300046691 Ga0495670_0107426 Ga0495670_0107426_15_737 240
205 3300048903 Ga0496100_0002476 Ga0496100_0002476_5840_6562 240
206 3300048904 Ga0496101_0000519 Ga0496101_0000519_11666_12388 240
207 3300048904 Ga0496101_0442701 Ga0496101_0442701_177_899 240
208 3300048905 Ga0496102_0001291 Ga0496102_0001291_16106_16828 240
209 3300048905 Ga0496102_0048973 Ga0496102_0048973_3031_3753 240
210 3300048906 Ga0496103_0004323 Ga0496103_0004323_7528_8250 240
211 3300048907 Ga0496104_0002481 Ga0496104_0002481_15158_15880 240
212 3300048908 Ga0496105_0000375 Ga0496105_0000375_12255_12977 240
213 3300048909 Ga0496106_0051310 Ga0496106_0051310_1161_1883 240
214 3300048912 Ga0496109_0045183 Ga0496109_0045183_2654_3376 240
215 3300048912 Ga0496109_0047712 Ga0496109_0047712_1963_2685 240
216 3300048913 Ga0496110_0001501 Ga0496110_0001501_12820_13542 240
217 3300048913 Ga0496110_0125915 Ga0496110_0125915_912_1634 240
218 3300048913 Ga0496110_0179466 Ga0496110_0179466_631_1353 240
219 3300048914 Ga0496111_0013567 Ga0496111_0013567_4662_5384 240
220 3300048914 Ga0496111_0069494 Ga0496111_0069494_1182_1904 240
221 3300048924 Ga0496121_0114041 Ga0496121_0114041_1060_1782 240
222 3300048927 Ga0496124_0000123 Ga0496124_0000123_121517_122239 240
223 3300048929 Ga0496126_0000674 Ga0496126_0000674_38498_39220 240
224 3300049573 Ga0501037_0013688 Ga0501037_0013688_1368_2090 240
225 3300049581 Ga0501047_0090152 Ga0501047_0090152_1094_1816 240
226 3300049822 Ga0501035_0378192 Ga0501035_0378192_101_823 240
227 3300049823 Ga0501044_0004644 Ga0501044_0004644_7578_8300 240
228 3300049823 Ga0501044_0241711 Ga0501044_0241711_936_1658 240
229 3300050496 nmdc:mga07m45_186457_c1 nmdc:mga07m45_186457_c1_196_918 240
230 3300053086 Ga0500578_0000282 Ga0500578_0000282_27267_27989 240
231 iso_pu_bacteria 2919046199 2919047203 240
232 3300003784 Ga0055534_1014274 Ga0055534_10142741 241
233 3300005539 Ga0068853_100241610 Ga0068853_1002416103 241
234 3300006195 Ga0075366_10017277 Ga0075366_100172774 241
235 3300006195 Ga0075366_10124969 Ga0075366_101249692 241
236 3300006353 Ga0075370_10057355 Ga0075370_100573553 241
237 3300006353 Ga0075370_10260954 Ga0075370_102609542 241
238 3300025291 Ga0209675_1002909 Ga0209675_10029097 241
239 3300025298 Ga0209050_1001725 Ga0209050_10017256 241
240 3300025303 Ga0209051_1060075 Ga0209051_10600751 241
241 3300028786 Ga0307517_10275524 Ga0307517_102755242 241
242 3300031730 Ga0307516_10013066 Ga0307516_100130667 241
243 3300037418 Ga0395900_0450486 Ga0395900_0450486_196_921 241
244 3300041452 Ga0451793_0014015 Ga0451793_0014015_1101_1826 241
245 3300046460 Ga0495638_0173726 Ga0495638_0173726_339_1064 241
246 3300046519 Ga0495632_0003923 Ga0495632_0003923_2231_2956 241
247 3300046520 Ga0495637_0004153 Ga0495637_0004153_1106_1831 241
248 3300048091 Ga0495626_0001523 Ga0495626_0001523_15086_15811 241
249 3300048920 Ga0496117_0007204 Ga0496117_0007204_9518_10243 241
250 3300048924 Ga0496121_0011190 Ga0496121_0011190_1011_1736 241
251 3300048925 Ga0496122_0265609 Ga0496122_0265609_167_892 241
252 3300048928 Ga0496125_0164776 Ga0496125_0164776_355_1080 241
253 3300049568 Ga0501031_0100690 Ga0501031_0100690_1108_1833 241
254 3300050493 nmdc:mga0k408_63220_c2 nmdc:mga0k408_63220_c2_105_830 241
255 3300050493 nmdc:mga0k408_83546_c1 nmdc:mga0k408_83546_c1_12_737 241
256 3300050496 nmdc:mga07m45_59696_c1 nmdc:mga07m45_59696_c1_1301_2026 241
257 3300053111 Ga0500572_034735 Ga0500572_034735_625_1350 241
258 3300053129 Ga0500628_003983 Ga0500628_003983_932_1657 241
259 3300053130 Ga0500642_0003827 Ga0500642_0003827_3150_3875 241
260 3300053131 Ga0500652_000383 Ga0500652_000383_14592_15317 241
261 3300053139 Ga0500568_0015225 Ga0500568_0015225_1013_1738 241
262 3300053142 Ga0500577_0136691 Ga0500577_0136691_96_821 241
263 3300053156 Ga0500622_0001707 Ga0500622_0001707_10134_10859 241
264 iso_pu_bacteria 2738541307 2738883033 241
265 3300005366 Ga0070659_100259661 Ga0070659_1002596612 242
266 3300005539 Ga0068853_100130972 Ga0068853_1001309723 242
267 3300009093 Ga0105240_10052581 Ga0105240_100525813 242
268 3300009545 Ga0105237_10014914 Ga0105237_100149142 242
269 3300010375 Ga0105239_10009446 Ga0105239_100094468 242
270 3300013100 Ga0157373_10007445 Ga0157373_100074457 242
271 3300013104 Ga0157370_10026421 Ga0157370_100264213 242
272 3300013105 Ga0157369_10000456 Ga0157369_1000045648 242
273 3300017792 Ga0163161_10151893 Ga0163161_101518932 242
274 3300025914 Ga0207671_10098708 Ga0207671_100987082 242
275 3300025925 Ga0207650_10246491 Ga0207650_102464912 242
276 3300025932 Ga0207690_10224863 Ga0207690_102248632 242
277 3300025981 Ga0207640_10343302 Ga0207640_103433022 242
278 3300026041 Ga0207639_10033289 Ga0207639_100332893 242
279 3300026116 Ga0207674_10113399 Ga0207674_101133992 242
280 3300026116 Ga0207674_10149032 Ga0207674_101490322 242
281 3300030745 Ga0316182_1008399 Ga0316182_10083992 242
282 3300031911 Ga0307412_10104628 Ga0307412_101046282 242
283 3300044683 Ga0466965_0005137 Ga0466965_0005137_3996_4724 242
284 3300044901 Ga0466960_0009903 Ga0466960_0009903_3065_3793 242
285 3300046689 Ga0495613_0000194 Ga0495613_0000194_43998_44726 242
286 3300047470 Ga0495681_0000235 Ga0495681_0000235_13366_14094 242
287 3300048925 Ga0496122_0000034 Ga0496122_0000034_209347_210081 242
288 3300048925 Ga0496122_0092516 Ga0496122_0092516_782_1531 242
289 3300048926 Ga0496123_0000141 Ga0496123_0000141_139573_140307 242
290 3300048927 Ga0496124_0006512 Ga0496124_0006512_6912_7661 242
291 3300048927 Ga0496124_0023619 Ga0496124_0023619_1235_1969 242
292 3300031911 Ga0307412_10000512 Ga0307412_1000051216 243
293 3300002773 JGI25152J39213_1002258 JGI25152J39213_10022583 244
294 3300003215 JGI25153J46596_10000537 JGI25153J46596_100005377 244
295 3300003771 Ga0055526_1000296 Ga0055526_100029626 244
296 3300025245 Ga0207425_1000259 Ga0207425_100025927 244
297 3300025258 Ga0209129_1000175 Ga0209129_100017543 244
298 3300025273 Ga0209673_1008351 Ga0209673_10083512 244
299 3300025295 Ga0209564_1000136 Ga0209564_1000136123 244
300 3300025297 Ga0209758_1000275 Ga0209758_100027572 244
301 3300044658 Ga0466972_0078133 Ga0466972_0078133_568_1302 244
302 3300048909 Ga0496106_0002941 Ga0496106_0002941_5641_6381 244
303 3300006353 Ga0075370_10179696 Ga0075370_101796962 245
304 3300031903 Ga0307407_10296558 Ga0307407_102965581 245
305 3300046453 Ga0495627_021365 Ga0495627_021365_161_898 245
306 3300048924 Ga0496121_0121436 Ga0496121_0121436_1113_1868 245
307 3300048928 Ga0496125_0004960 Ga0496125_0004960_6859_7614 245
308 iso_pu_bacteria 2818991445 2819593011 247
309 3300002704 JGI25155J39150_1000182 JGI25155J39150_100018213 251
310 3300002705 JGI25156J39149_1000304 JGI25156J39149_100030413 251
311 3300002738 JGI25154J39366_1000268 JGI25154J39366_100026813 251
312 3300002741 JGI25157J39369_1000334 JGI25157J39369_10003343 251
313 3300002741 JGI25157J39369_1000373 JGI25157J39369_100037321 251
314 3300003758 Ga0055532_1000130 Ga0055532_100013061 251
315 3300025206 Ga0209435_100046 Ga0209435_10004680 251
316 3300025229 Ga0209147_100157 Ga0209147_10015711 251
317 3300025242 Ga0209258_100733 Ga0209258_10073311 251
318 3300025246 Ga0209646_1000156 Ga0209646_100015613 251
319 3300025250 Ga0209026_1000267 Ga0209026_100026713 251
320 3300025254 Ga0209148_1007780 Ga0209148_10077803 251
321 3300025256 Ga0209759_1000348 Ga0209759_100034845 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

160

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9065 16 251
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.8975 20 238
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.8917 20 249
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8903 20 247
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8884 16 251
ID Description Score Start End Superfamily
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9251 20 247 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9229 18 251 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9079 18 251 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8947 20 247 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8941 20 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0K8NUH8-F1-model_v4 Branched-chain amino acid transport ATP-binding protein LivF 0.9846 17 251 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A561CKT0-F1-model_v4 deleted 0.9843 17 251
AF-A0A1C9VEH6-F1-model_v4 deleted 0.984 16 251
AF-A0A086XSU2-F1-model_v4 Mannosyltransferase 0.9833 15 251 GO:0005524
GO:0015658
GO:0015807
GO:0016757
GO:0016887
AF-A0A537FQ68-F1-model_v4 ATP-binding cassette domain-containing protein 0.9812 66 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.23 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map