F406036
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 321 | 228 | 277 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300029957|Ga0265324_10022959|Ga0265324_100229592 |
| Length | 231 |
| Sequence | MLKIARLHAFYGKSHVLHGVDLEVGAGEIVALLGRNGSGRSTTAKAVMGLVDAQGSVQFEGREIRGLKSYEIAHRGLGYVPENRDIFPKLTVHQNLLLGQKTGAKDARWGFDDMYAMFPRLKERQHTEAGVLSGGEQQMLTLCRSLMGDPRLVIIDEPTEGLAPKIVELVAEYLQALKARGVSVLLIEQKLTIALQISQRCVVMGHGRIVFEGTPEALRADAYVRKEWLEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 7 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 8 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 9 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 10 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 11 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 12 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 13 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 14 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 15 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 16 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 17 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 18 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 19 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 20 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 21 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 22 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 23 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 24 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 25 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 26 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 27 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 28 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 29 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 30 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 31 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 32 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 33 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 34 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 35 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 36 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 37 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 38 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 39 | 2941479691 | |||
| 40 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 41 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 42 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 43 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 44 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 45 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 46 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 47 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 48 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 49 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 50 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 51 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 55 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 138 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 139 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 142 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 147 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 148 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 149 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 155 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 156 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 157 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 158 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 180 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 181 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 185 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 186 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 187 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 188 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 189 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 190 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 191 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 192 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 193 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 194 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 195 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 196 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 211 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 212 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 213 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 215 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 216 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 217 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 218 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 219 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 220 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 221 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 222 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 223 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 224 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 225 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 226 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 227 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 228 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.29 |
| Metatranscriptomes | 0 |
| Isolates | 13.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.68 |
| Nodule | 0.93 |
| Rhizoplane | 6.54 |
| Rhizosphere | 43.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000182 | 3300002704 | Bacteria | 26998 |
| 2 | JGI25156J39149_1000304 | 3300002705 | Bacteria | 32589 |
| 3 | JGI25154J39366_1000268 | 3300002738 | Bacteria | 32589 |
| 4 | JGI25157J39369_1000334 | 3300002741 | Bacteria | 33420 |
| 5 | JGI25157J39369_1000373 | 3300002741 | Bacteria | 30848 |
| 6 | JGI25152J39213_1002258 | 3300002773 | Bacteria | 7443 |
| 7 | JGI25151J46595_10000639 | 3300003187 | Bacteria | 30118 |
| 8 | JGI25151J46595_10003224 | 3300003187 | Bacteria | 9120 |
| 9 | JGI25153J46596_10000537 | 3300003215 | Bacteria | 23734 |
| 10 | Ga0055532_1000130 | 3300003758 | Bacteria | 74140 |
| 11 | Ga0055525_1000084 | 3300003759 | Bacteria | 155319 |
| 12 | Ga0055526_1000296 | 3300003771 | Bacteria | 41724 |
| 13 | Ga0055534_1000538 | 3300003784 | Bacteria | 20301 |
| 14 | Ga0055534_1014274 | 3300003784 | Bacteria | 1494 |
| 15 | Ga0055540_1054071 | 3300003792 | Bacteria | 820 |
| 16 | Ga0055543_1027223 | 3300004625 | Bacteria | 1013 |
| 17 | Ga0065165_1000246 | 3300005262 | Bacteria | 93310 |
| 18 | Ga0065165_1001709 | 3300005262 | Bacteria | 22025 |
| 19 | Ga0070673_100352090 | 3300005364 | Bacteria | 1307 |
| 20 | Ga0070659_100259661 | 3300005366 | Bacteria | 1441 |
| 21 | Ga0070667_100009961 | 3300005367 | Bacteria | 7877 |
| 22 | Ga0070663_100159576 | 3300005455 | Bacteria | 1735 |
| 23 | Ga0068853_100130972 | 3300005539 | Bacteria | 2245 |
| 24 | Ga0068853_100241610 | 3300005539 | Bacteria | 1655 |
| 25 | Ga0070672_100386236 | 3300005543 | Bacteria | 1198 |
| 26 | Ga0070665_100533089 | 3300005548 | Bacteria | 1186 |
| 27 | Ga0068855_100272969 | 3300005563 | Bacteria | 1880 |
| 28 | Ga0068859_100090977 | 3300005617 | Bacteria | 3102 |
| 29 | Ga0068864_100347036 | 3300005618 | Bacteria | 1399 |
| 30 | Ga0068861_100085698 | 3300005719 | Bacteria | 2475 |
| 31 | Ga0068863_100006493 | 3300005841 | Bacteria | 11469 |
| 32 | Ga0068863_100243344 | 3300005841 | Bacteria | 1736 |
| 33 | Ga0068860_100271391 | 3300005843 | Bacteria | 1656 |
| 34 | Ga0068862_100041738 | 3300005844 | Bacteria | 3905 |
| 35 | Ga0081539_10126190 | 3300005985 | Bacteria | 1264 |
| 36 | Ga0075365_10184409 | 3300006038 | Bacteria | 1460 |
| 37 | Ga0075368_10143412 | 3300006042 | Bacteria | 996 |
| 38 | Ga0075367_10101552 | 3300006178 | Bacteria | 1759 |
| 39 | Ga0075366_10002750 | 3300006195 | Bacteria | 9093 |
| 40 | Ga0075366_10017277 | 3300006195 | Bacteria | 4151 |
| 41 | Ga0075366_10124969 | 3300006195 | Bacteria | 1551 |
| 42 | Ga0075366_10222547 | 3300006195 | Bacteria | 1150 |
| 43 | Ga0097621_100016123 | 3300006237 | Bacteria | 5642 |
| 44 | Ga0075370_10000806 | 3300006353 | Bacteria | 12561 |
| 45 | Ga0075370_10057355 | 3300006353 | Bacteria | 2214 |
| 46 | Ga0075370_10179696 | 3300006353 | Bacteria | 1245 |
| 47 | Ga0075370_10260954 | 3300006353 | Bacteria | 1027 |
| 48 | Ga0075370_10272436 | 3300006353 | Bacteria | 1005 |
| 49 | Ga0068871_100015509 | 3300006358 | Bacteria | 5705 |
| 50 | Ga0075433_10284091 | 3300006852 | Bacteria | 1466 |
| 51 | Ga0075434_100664340 | 3300006871 | Bacteria | 1060 |
| 52 | Ga0097620_100090978 | 3300006931 | Bacteria | 3102 |
| 53 | Ga0075435_100810728 | 3300007076 | Bacteria | 815 |
| 54 | Ga0105240_10052581 | 3300009093 | Bacteria | 5119 |
| 55 | Ga0105240_10154469 | 3300009093 | Bacteria | 2731 |
| 56 | Ga0105248_11377480 | 3300009177 | Bacteria | 798 |
| 57 | Ga0105237_10014914 | 3300009545 | Bacteria | 8103 |
| 58 | Ga0105239_10009446 | 3300010375 | Bacteria | 10988 |
| 59 | Ga0105246_10822524 | 3300011119 | Bacteria | 826 |
| 60 | Ga0157373_10007445 | 3300013100 | Bacteria | 8143 |
| 61 | Ga0157371_10124750 | 3300013102 | Bacteria | 1831 |
| 62 | Ga0157370_10002111 | 3300013104 | Bacteria | 24281 |
| 63 | Ga0157370_10026421 | 3300013104 | Bacteria | 5733 |
| 64 | Ga0157369_10000456 | 3300013105 | Bacteria | 54115 |
| 65 | Ga0163162_10183247 | 3300013306 | Bacteria | 2220 |
| 66 | Ga0182008_10000207 | 3300014497 | Bacteria | 46359 |
| 67 | Ga0182008_10001172 | 3300014497 | Bacteria | 18079 |
| 68 | Ga0157376_10289677 | 3300014969 | Bacteria | 1545 |
| 69 | Ga0182006_1050845 | 3300015261 | Bacteria | 1596 |
| 70 | Ga0182007_10000185 | 3300015262 | Bacteria | 42160 |
| 71 | Ga0182005_1026006 | 3300015265 | Bacteria | 1597 |
| 72 | Ga0163161_10151893 | 3300017792 | Bacteria | 1760 |
| 73 | Ga0163161_10236378 | 3300017792 | Bacteria | 1419 |
| 74 | Ga0209435_100046 | 3300025206 | Bacteria | 95081 |
| 75 | Ga0209147_100157 | 3300025229 | Bacteria | 92005 |
| 76 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 77 | Ga0209258_100733 | 3300025242 | Bacteria | 21360 |
| 78 | Ga0207425_1000259 | 3300025245 | Bacteria | 39126 |
| 79 | Ga0209646_1000156 | 3300025246 | Bacteria | 95083 |
| 80 | Ga0209026_1000267 | 3300025250 | Bacteria | 63271 |
| 81 | Ga0209148_1007780 | 3300025254 | Bacteria | 2197 |
| 82 | Ga0209759_1000348 | 3300025256 | Bacteria | 60134 |
| 83 | Ga0209129_1000175 | 3300025258 | Bacteria | 93817 |
| 84 | Ga0209673_1008351 | 3300025273 | Bacteria | 4617 |
| 85 | Ga0209130_1002434 | 3300025284 | Bacteria | 9333 |
| 86 | Ga0209130_1007846 | 3300025284 | Bacteria | 3233 |
| 87 | Ga0209675_1000859 | 3300025291 | Bacteria | 19681 |
| 88 | Ga0209675_1002909 | 3300025291 | Bacteria | 8479 |
| 89 | Ga0209676_1006086 | 3300025292 | Bacteria | 6066 |
| 90 | Ga0209676_1019922 | 3300025292 | Bacteria | 2294 |
| 91 | Ga0209025_1000018 | 3300025294 | Bacteria | 686898 |
| 92 | Ga0209025_1000133 | 3300025294 | Bacteria | 195885 |
| 93 | Ga0209025_1000853 | 3300025294 | Bacteria | 48270 |
| 94 | Ga0209564_1000136 | 3300025295 | Bacteria | 185198 |
| 95 | Ga0209564_1028842 | 3300025295 | Bacteria | 1762 |
| 96 | Ga0209758_1000275 | 3300025297 | Bacteria | 102404 |
| 97 | Ga0209758_1080396 | 3300025297 | Bacteria | 988 |
| 98 | Ga0209050_1000247 | 3300025298 | Bacteria | 116514 |
| 99 | Ga0209050_1001725 | 3300025298 | Bacteria | 21758 |
| 100 | Ga0209050_1068675 | 3300025298 | Bacteria | 801 |
| 101 | Ga0209051_1026700 | 3300025303 | Bacteria | 2320 |
| 102 | Ga0209051_1039952 | 3300025303 | Bacteria | 1688 |
| 103 | Ga0209051_1060075 | 3300025303 | Bacteria | 1202 |
| 104 | Ga0207671_10098708 | 3300025914 | Bacteria | 2209 |
| 105 | Ga0207694_10151243 | 3300025924 | Bacteria | 1870 |
| 106 | Ga0207650_10246491 | 3300025925 | Bacteria | 1445 |
| 107 | Ga0207644_10221347 | 3300025931 | Bacteria | 1500 |
| 108 | Ga0207690_10224863 | 3300025932 | Bacteria | 1438 |
| 109 | Ga0207691_10164522 | 3300025940 | Bacteria | 1944 |
| 110 | Ga0207711_10713844 | 3300025941 | Bacteria | 935 |
| 111 | Ga0207667_10973035 | 3300025949 | Bacteria | 837 |
| 112 | Ga0207712_10401576 | 3300025961 | Bacteria | 1152 |
| 113 | Ga0207640_10343302 | 3300025981 | Bacteria | 1197 |
| 114 | Ga0207639_10033289 | 3300026041 | Bacteria | 3801 |
| 115 | Ga0207641_10151013 | 3300026088 | Bacteria | 2104 |
| 116 | Ga0207676_10278665 | 3300026095 | Bacteria | 1517 |
| 117 | Ga0207674_10113399 | 3300026116 | Bacteria | 2684 |
| 118 | Ga0207674_10149032 | 3300026116 | Bacteria | 2297 |
| 119 | Ga0207675_100101667 | 3300026118 | Bacteria | 2708 |
| 120 | Ga0209371_1020428 | 3300027312 | Bacteria | 1632 |
| 121 | Ga0268266_10345340 | 3300028379 | Bacteria | 1398 |
| 122 | Ga0268265_10551459 | 3300028380 | Bacteria | 1094 |
| 123 | Ga0268264_10215836 | 3300028381 | Bacteria | 1763 |
| 124 | Ga0307517_10275524 | 3300028786 | Bacteria | 964 |
| 125 | Ga0307515_10185248 | 3300028794 | Bacteria | 2014 |
| 126 | Ga0265324_10022959 | 3300029957 | Bacteria | 2225 |
| 127 | Ga0268256_1022888 | 3300030500 | Bacteria | 1632 |
| 128 | Ga0316182_1008399 | 3300030745 | Bacteria | 4575 |
| 129 | Ga0265332_10158523 | 3300031238 | Bacteria | 946 |
| 130 | Ga0265328_10006250 | 3300031239 | Bacteria | 5060 |
| 131 | Ga0265331_10001230 | 3300031250 | Bacteria | 19256 |
| 132 | Ga0265327_10000266 | 3300031251 | Bacteria | 103308 |
| 133 | Ga0265327_10006362 | 3300031251 | Bacteria | 9468 |
| 134 | Ga0265327_10073904 | 3300031251 | Bacteria | 1699 |
| 135 | Ga0307513_10007462 | 3300031456 | Bacteria | 14170 |
| 136 | Ga0307513_10022192 | 3300031456 | Bacteria | 7468 |
| 137 | Ga0307513_10161978 | 3300031456 | Bacteria | 2128 |
| 138 | Ga0307513_10216331 | 3300031456 | Bacteria | 1742 |
| 139 | Ga0307513_10255184 | 3300031456 | Bacteria | 1547 |
| 140 | Ga0307509_10334046 | 3300031507 | Bacteria | 1246 |
| 141 | Ga0307516_10013066 | 3300031730 | Bacteria | 8879 |
| 142 | Ga0307407_10296558 | 3300031903 | Bacteria | 1126 |
| 143 | Ga0307412_10000512 | 3300031911 | Bacteria | 23134 |
| 144 | Ga0307412_10016402 | 3300031911 | Bacteria | 4412 |
| 145 | Ga0307412_10104628 | 3300031911 | Bacteria | 2009 |
| 146 | Ga0307416_100011432 | 3300032002 | Bacteria | 5921 |
| 147 | Ga0307510_10070419 | 3300033180 | Bacteria | 3492 |
| 148 | Ga0395900_0190713 | 3300037418 | Bacteria | 2079 |
| 149 | Ga0395900_0450486 | 3300037418 | Bacteria | 1243 |
| 150 | Ga0451793_0014015 | 3300041452 | Bacteria | 2637 |
| 151 | Ga0466972_0078133 | 3300044658 | Bacteria | 1576 |
| 152 | Ga0466965_0005137 | 3300044683 | Bacteria | 5874 |
| 153 | Ga0466965_0045602 | 3300044683 | Bacteria | 2168 |
| 154 | Ga0466960_0009903 | 3300044901 | Bacteria | 3943 |
| 155 | Ga0495627_021365 | 3300046453 | Bacteria | 2147 |
| 156 | Ga0495638_0173726 | 3300046460 | Bacteria | 1234 |
| 157 | Ga0495639_0027894 | 3300046475 | Bacteria | 2500 |
| 158 | Ga0495632_0003923 | 3300046519 | Bacteria | 10332 |
| 159 | Ga0495637_0004153 | 3300046520 | Bacteria | 7535 |
| 160 | Ga0495642_0040956 | 3300046528 | Bacteria | 1883 |
| 161 | Ga0495654_0000462 | 3300046530 | Bacteria | 33930 |
| 162 | Ga0495621_0061230 | 3300046539 | Bacteria | 1367 |
| 163 | Ga0495621_0063489 | 3300046539 | Bacteria | 1346 |
| 164 | Ga0495621_0140702 | 3300046539 | Bacteria | 944 |
| 165 | Ga0495633_0003193 | 3300046558 | Bacteria | 11069 |
| 166 | Ga0495588_0188022 | 3300046674 | Bacteria | 1091 |
| 167 | Ga0495613_0000194 | 3300046689 | Bacteria | 59997 |
| 168 | Ga0495670_0107426 | 3300046691 | Bacteria | 1442 |
| 169 | Ga0495673_0103399 | 3300047469 | Bacteria | 1148 |
| 170 | Ga0495681_0000235 | 3300047470 | Bacteria | 45882 |
| 171 | Ga0495686_0028926 | 3300047472 | Bacteria | 3607 |
| 172 | Ga0495626_0001523 | 3300048091 | Bacteria | 18212 |
| 173 | Ga0496100_0002476 | 3300048903 | Bacteria | 9386 |
| 174 | Ga0496101_0000519 | 3300048904 | Bacteria | 24028 |
| 175 | Ga0496101_0442701 | 3300048904 | Bacteria | 1025 |
| 176 | Ga0496102_0001291 | 3300048905 | Bacteria | 22509 |
| 177 | Ga0496102_0048973 | 3300048905 | Bacteria | 3843 |
| 178 | Ga0496103_0004323 | 3300048906 | Bacteria | 8633 |
| 179 | Ga0496104_0002481 | 3300048907 | Bacteria | 15897 |
| 180 | Ga0496105_0000375 | 3300048908 | Bacteria | 29508 |
| 181 | Ga0496105_0230923 | 3300048908 | Bacteria | 1504 |
| 182 | Ga0496106_0002941 | 3300048909 | Bacteria | 12680 |
| 183 | Ga0496106_0051310 | 3300048909 | Bacteria | 3110 |
| 184 | Ga0496109_0045183 | 3300048912 | Bacteria | 3996 |
| 185 | Ga0496109_0047712 | 3300048912 | Bacteria | 3895 |
| 186 | Ga0496110_0001501 | 3300048913 | Bacteria | 16929 |
| 187 | Ga0496110_0125915 | 3300048913 | Bacteria | 2311 |
| 188 | Ga0496110_0179466 | 3300048913 | Bacteria | 1922 |
| 189 | Ga0496111_0013567 | 3300048914 | Bacteria | 5548 |
| 190 | Ga0496111_0069494 | 3300048914 | Bacteria | 2561 |
| 191 | Ga0496114_1045545 | 3300048917 | Bacteria | 700 |
| 192 | Ga0496116_0014717 | 3300048919 | Bacteria | 6232 |
| 193 | Ga0496117_0007204 | 3300048920 | Bacteria | 10965 |
| 194 | Ga0496117_0020810 | 3300048920 | Bacteria | 5338 |
| 195 | Ga0496118_0019252 | 3300048921 | Bacteria | 6110 |
| 196 | Ga0496118_0037960 | 3300048921 | Bacteria | 3867 |
| 197 | Ga0496119_0176237 | 3300048922 | Bacteria | 1125 |
| 198 | Ga0496120_0002371 | 3300048923 | Bacteria | 19229 |
| 199 | Ga0496121_0000153 | 3300048924 | Bacteria | 150635 |
| 200 | Ga0496121_0011190 | 3300048924 | Bacteria | 10001 |
| 201 | Ga0496121_0114041 | 3300048924 | Bacteria | 2055 |
| 202 | Ga0496121_0121436 | 3300048924 | Bacteria | 1972 |
| 203 | Ga0496122_0000034 | 3300048925 | Bacteria | 320661 |
| 204 | Ga0496122_0005806 | 3300048925 | Bacteria | 14506 |
| 205 | Ga0496122_0063309 | 3300048925 | Bacteria | 2700 |
| 206 | Ga0496122_0092516 | 3300048925 | Bacteria | 2055 |
| 207 | Ga0496122_0104443 | 3300048925 | Bacteria | 1882 |
| 208 | Ga0496122_0265609 | 3300048925 | Bacteria | 949 |
| 209 | Ga0496123_0000141 | 3300048926 | Bacteria | 147111 |
| 210 | Ga0496123_0001621 | 3300048926 | Bacteria | 30304 |
| 211 | Ga0496123_0014329 | 3300048926 | Bacteria | 6579 |
| 212 | Ga0496124_0000123 | 3300048927 | Bacteria | 161106 |
| 213 | Ga0496124_0006512 | 3300048927 | Bacteria | 12709 |
| 214 | Ga0496124_0023619 | 3300048927 | Bacteria | 5609 |
| 215 | Ga0496124_0060308 | 3300048927 | Bacteria | 3182 |
| 216 | Ga0496125_0002020 | 3300048928 | Bacteria | 27488 |
| 217 | Ga0496125_0004960 | 3300048928 | Bacteria | 15051 |
| 218 | Ga0496125_0035119 | 3300048928 | Bacteria | 4405 |
| 219 | Ga0496125_0116523 | 3300048928 | Bacteria | 1918 |
| 220 | Ga0496125_0164776 | 3300048928 | Bacteria | 1500 |
| 221 | Ga0496125_0200237 | 3300048928 | Bacteria | 1308 |
| 222 | Ga0496126_0000674 | 3300048929 | Bacteria | 63031 |
| 223 | Ga0496126_0004010 | 3300048929 | Bacteria | 17942 |
| 224 | Ga0496126_0061983 | 3300048929 | Bacteria | 3357 |
| 225 | Ga0501031_0012665 | 3300049568 | Bacteria | 5507 |
| 226 | Ga0501031_0100690 | 3300049568 | Bacteria | 1885 |
| 227 | Ga0501032_0000816 | 3300049569 | Bacteria | 25276 |
| 228 | Ga0501033_0003584 | 3300049570 | Bacteria | 12688 |
| 229 | Ga0501034_0000134 | 3300049571 | Bacteria | 137745 |
| 230 | Ga0501034_0006814 | 3300049571 | Bacteria | 12219 |
| 231 | Ga0501034_0031655 | 3300049571 | Bacteria | 5373 |
| 232 | Ga0501036_0001771 | 3300049572 | Bacteria | 16761 |
| 233 | Ga0501037_0004252 | 3300049573 | Bacteria | 10376 |
| 234 | Ga0501037_0013688 | 3300049573 | Bacteria | 5976 |
| 235 | Ga0501038_0000494 | 3300049574 | Bacteria | 34711 |
| 236 | Ga0501043_0000038 | 3300049579 | Bacteria | 128656 |
| 237 | Ga0501043_0001194 | 3300049579 | Bacteria | 22852 |
| 238 | Ga0501046_0000049 | 3300049580 | Bacteria | 135088 |
| 239 | Ga0501046_0002440 | 3300049580 | Bacteria | 17427 |
| 240 | Ga0501047_0000039 | 3300049581 | Bacteria | 187849 |
| 241 | Ga0501047_0004711 | 3300049581 | Bacteria | 12827 |
| 242 | Ga0501047_0090152 | 3300049581 | Bacteria | 2943 |
| 243 | Ga0501048_0025913 | 3300049582 | Bacteria | 4272 |
| 244 | Ga0501035_0000874 | 3300049822 | Bacteria | 32016 |
| 245 | Ga0501035_0020751 | 3300049822 | Bacteria | 6038 |
| 246 | Ga0501035_0378192 | 3300049822 | Bacteria | 1181 |
| 247 | Ga0501044_0004644 | 3300049823 | Bacteria | 15368 |
| 248 | Ga0501044_0012609 | 3300049823 | Bacteria | 9154 |
| 249 | Ga0501044_0120424 | 3300049823 | Bacteria | 2626 |
| 250 | Ga0501044_0241711 | 3300049823 | Bacteria | 1749 |
| 251 | Ga0501045_0001444 | 3300049824 | Bacteria | 15788 |
| 252 | nmdc:mga0k408_133302_c1 | 3300050493 | Bacteria | 1475 |
| 253 | nmdc:mga0k408_63220_c2 | 3300050493 | Bacteria | 1416 |
| 254 | nmdc:mga0k408_63238_c1 | 3300050493 | Bacteria | 2153 |
| 255 | nmdc:mga0k408_83546_c1 | 3300050493 | Bacteria | 1872 |
| 256 | nmdc:mga06z11_75134_c1 | 3300050494 | Bacteria | 1798 |
| 257 | nmdc:mga07m45_186457_c1 | 3300050496 | Bacteria | 1206 |
| 258 | nmdc:mga07m45_44575_c1 | 3300050496 | Bacteria | 2490 |
| 259 | nmdc:mga07m45_59696_c1 | 3300050496 | Bacteria | 2158 |
| 260 | nmdc:mga0n895_656473_c1 | 3300050512 | Bacteria | 1047 |
| 261 | Ga0500578_0000282 | 3300053086 | Bacteria | 62821 |
| 262 | Ga0500578_0011827 | 3300053086 | Bacteria | 5638 |
| 263 | Ga0500641_0055972 | 3300053096 | Bacteria | 1634 |
| 264 | Ga0500572_034735 | 3300053111 | Bacteria | 1430 |
| 265 | Ga0500607_154948 | 3300053121 | Bacteria | 1056 |
| 266 | Ga0500628_003983 | 3300053129 | Bacteria | 2439 |
| 267 | Ga0500642_0003827 | 3300053130 | Bacteria | 4619 |
| 268 | Ga0500652_000383 | 3300053131 | Bacteria | 15945 |
| 269 | Ga0500652_096752 | 3300053131 | Bacteria | 1233 |
| 270 | Ga0500559_0000193 | 3300053136 | Bacteria | 49137 |
| 271 | Ga0500568_0015225 | 3300053139 | Bacteria | 3447 |
| 272 | Ga0500568_0033481 | 3300053139 | Bacteria | 2108 |
| 273 | Ga0500577_0136691 | 3300053142 | Bacteria | 1031 |
| 274 | Ga0500622_0000413 | 3300053156 | Bacteria | 40682 |
| 275 | Ga0500622_0001707 | 3300053156 | Bacteria | 17033 |
| 276 | Ga0500636_0154169 | 3300053177 | Bacteria | 1259 |
| 277 | Ga0500645_003922 | 3300053730 | Bacteria | 5868 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_1045545 | Ga0496114_1045545_19_663 | 214 |
| 2 | iso_pu_bacteria | 8006994254 | 8007001660 | 229 |
| 3 | 3300029957 | Ga0265324_10022959 | Ga0265324_100229592 | 231 |
| 4 | 3300049822 | Ga0501035_0020751 | Ga0501035_0020751_5315_6010 | 231 |
| 5 | iso_pu_bacteria | 2854916844 | 2854920445 | 231 |
| 6 | iso_pu_bacteria | 2899803654 | 2899804954 | 231 |
| 7 | iso_pu_bacteria | 2643221585 | 2643933398 | 232 |
| 8 | 3300009093 | Ga0105240_10154469 | Ga0105240_101544692 | 233 |
| 9 | 3300028379 | Ga0268266_10345340 | Ga0268266_103453401 | 233 |
| 10 | 3300044683 | Ga0466965_0045602 | Ga0466965_0045602_1348_2049 | 233 |
| 11 | iso_pu_bacteria | 8048746797 | 8048748773 | 233 |
| 12 | 3300005563 | Ga0068855_100272969 | Ga0068855_1002729692 | 234 |
| 13 | 3300025949 | Ga0207667_10973035 | Ga0207667_109730351 | 234 |
| 14 | 3300047472 | Ga0495686_0028926 | Ga0495686_0028926_2757_3461 | 234 |
| 15 | iso_pu_bacteria | 2534681786 | 2535486028 | 234 |
| 16 | iso_pu_bacteria | 2857576091 | 2857576498 | 234 |
| 17 | 3300005985 | Ga0081539_10126190 | Ga0081539_101261902 | 235 |
| 18 | 3300046539 | Ga0495621_0140702 | Ga0495621_0140702_64_807 | 235 |
| 19 | iso_pu_bacteria | 2599185292 | 2599905913 | 235 |
| 20 | iso_pu_bacteria | 2643221569 | 2643859099 | 235 |
| 21 | iso_pu_bacteria | 2643221594 | 2643980071 | 235 |
| 22 | iso_pu_bacteria | 2643221621 | 2644122968 | 235 |
| 23 | iso_pu_bacteria | 2738543012 | 2739244250 | 235 |
| 24 | iso_pu_bacteria | 2808606395 | 2809033795 | 235 |
| 25 | iso_pu_bacteria | 2816332133 | 2816472522 | 235 |
| 26 | iso_pu_bacteria | 2858950400 | 2858954557 | 235 |
| 27 | iso_pu_bacteria | 2887375801 | 2887376194 | 235 |
| 28 | iso_pu_bacteria | 2904541872 | 2904547007 | 235 |
| 29 | iso_pu_bacteria | 2929160207 | 2929164479 | 235 |
| 30 | iso_pu_bacteria | 2941479691 | 2941484907 | 235 |
| 31 | 3300004625 | Ga0055543_1027223 | Ga0055543_10272231 | 236 |
| 32 | 3300005262 | Ga0065165_1000246 | Ga0065165_100024615 | 236 |
| 33 | 3300015261 | Ga0182006_1050845 | Ga0182006_10508452 | 236 |
| 34 | 3300025284 | Ga0209130_1007846 | Ga0209130_10078462 | 236 |
| 35 | 3300031456 | Ga0307513_10007462 | Ga0307513_1000746210 | 236 |
| 36 | iso_pu_bacteria | 2588253510 | 2588295815 | 236 |
| 37 | iso_pu_bacteria | 2619619299 | 2621297418 | 236 |
| 38 | iso_pu_bacteria | 2643221592 | 2643971045 | 236 |
| 39 | iso_pu_bacteria | 2643221625 | 2644144208 | 236 |
| 40 | iso_pu_bacteria | 2643221648 | 2644275230 | 236 |
| 41 | iso_pu_bacteria | 2643221683 | 2644467758 | 236 |
| 42 | iso_pu_bacteria | 2738541265 | 2738672857 | 236 |
| 43 | iso_pu_bacteria | 2738541282 | 2738751250 | 236 |
| 44 | iso_pu_bacteria | 2738541303 | 2738860291 | 236 |
| 45 | iso_pu_bacteria | 2816332298 | 2817493474 | 236 |
| 46 | iso_pu_bacteria | 2855730933 | 2855731811 | 236 |
| 47 | iso_pu_bacteria | 2855767633 | 2855768517 | 236 |
| 48 | iso_pu_bacteria | 2857542790 | 2857547181 | 236 |
| 49 | iso_pu_bacteria | 2881412998 | 2881413306 | 236 |
| 50 | iso_pu_bacteria | 2945909444 | 2945909471 | 236 |
| 51 | iso_pu_bacteria | 2945984333 | 2945988549 | 236 |
| 52 | 3300003759 | Ga0055525_1000084 | Ga0055525_1000084147 | 237 |
| 53 | 3300025230 | Ga0209563_100025 | Ga0209563_100025148 | 237 |
| 54 | 3300025297 | Ga0209758_1080396 | Ga0209758_10803962 | 237 |
| 55 | 3300028794 | Ga0307515_10185248 | Ga0307515_101852482 | 237 |
| 56 | 3300031239 | Ga0265328_10006250 | Ga0265328_100062504 | 237 |
| 57 | 3300031250 | Ga0265331_10001230 | Ga0265331_1000123018 | 237 |
| 58 | 3300031251 | Ga0265327_10000266 | Ga0265327_1000026696 | 237 |
| 59 | 3300031456 | Ga0307513_10022192 | Ga0307513_100221922 | 237 |
| 60 | 3300031507 | Ga0307509_10334046 | Ga0307509_103340462 | 237 |
| 61 | 3300033180 | Ga0307510_10070419 | Ga0307510_100704192 | 237 |
| 62 | 3300053096 | Ga0500641_0055972 | Ga0500641_0055972_278_991 | 237 |
| 63 | 3300053121 | Ga0500607_154948 | Ga0500607_154948_288_1001 | 237 |
| 64 | 3300053131 | Ga0500652_096752 | Ga0500652_096752_46_759 | 237 |
| 65 | 3300053136 | Ga0500559_0000193 | Ga0500559_0000193_24849_25562 | 237 |
| 66 | 3300053139 | Ga0500568_0033481 | Ga0500568_0033481_1294_2007 | 237 |
| 67 | 3300053156 | Ga0500622_0000413 | Ga0500622_0000413_15146_15859 | 237 |
| 68 | 3300053177 | Ga0500636_0154169 | Ga0500636_0154169_534_1247 | 237 |
| 69 | iso_pu_bacteria | 2585428057 | 2587730921 | 237 |
| 70 | iso_pu_bacteria | 2585428058 | 2587736044 | 237 |
| 71 | iso_pu_bacteria | 2585428062 | 2587756354 | 237 |
| 72 | 3300006195 | Ga0075366_10222547 | Ga0075366_102225471 | 238 |
| 73 | 3300025294 | Ga0209025_1000853 | Ga0209025_10008538 | 238 |
| 74 | 3300049571 | Ga0501034_0000134 | Ga0501034_0000134_36119_36835 | 238 |
| 75 | 3300053086 | Ga0500578_0011827 | Ga0500578_0011827_2858_3574 | 238 |
| 76 | 3300053730 | Ga0500645_003922 | Ga0500645_003922_4143_4859 | 238 |
| 77 | 3300003187 | JGI25151J46595_10003224 | JGI25151J46595_100032247 | 239 |
| 78 | 3300005364 | Ga0070673_100352090 | Ga0070673_1003520902 | 239 |
| 79 | 3300005617 | Ga0068859_100090977 | Ga0068859_1000909772 | 239 |
| 80 | 3300005618 | Ga0068864_100347036 | Ga0068864_1003470362 | 239 |
| 81 | 3300005719 | Ga0068861_100085698 | Ga0068861_1000856983 | 239 |
| 82 | 3300005841 | Ga0068863_100006493 | Ga0068863_1000064933 | 239 |
| 83 | 3300005841 | Ga0068863_100243344 | Ga0068863_1002433442 | 239 |
| 84 | 3300005843 | Ga0068860_100271391 | Ga0068860_1002713912 | 239 |
| 85 | 3300005844 | Ga0068862_100041738 | Ga0068862_1000417382 | 239 |
| 86 | 3300006038 | Ga0075365_10184409 | Ga0075365_101844092 | 239 |
| 87 | 3300006042 | Ga0075368_10143412 | Ga0075368_101434121 | 239 |
| 88 | 3300006178 | Ga0075367_10101552 | Ga0075367_101015522 | 239 |
| 89 | 3300006195 | Ga0075366_10002750 | Ga0075366_100027502 | 239 |
| 90 | 3300006237 | Ga0097621_100016123 | Ga0097621_1000161235 | 239 |
| 91 | 3300006353 | Ga0075370_10000806 | Ga0075370_100008064 | 239 |
| 92 | 3300006358 | Ga0068871_100015509 | Ga0068871_1000155093 | 239 |
| 93 | 3300006852 | Ga0075433_10284091 | Ga0075433_102840912 | 239 |
| 94 | 3300006871 | Ga0075434_100664340 | Ga0075434_1006643402 | 239 |
| 95 | 3300006931 | Ga0097620_100090978 | Ga0097620_1000909782 | 239 |
| 96 | 3300007076 | Ga0075435_100810728 | Ga0075435_1008107281 | 239 |
| 97 | 3300009177 | Ga0105248_11377480 | Ga0105248_113774801 | 239 |
| 98 | 3300013102 | Ga0157371_10124750 | Ga0157371_101247502 | 239 |
| 99 | 3300025292 | Ga0209676_1006086 | Ga0209676_10060864 | 239 |
| 100 | 3300025294 | Ga0209025_1000133 | Ga0209025_100013393 | 239 |
| 101 | 3300025298 | Ga0209050_1068675 | Ga0209050_10686751 | 239 |
| 102 | 3300025303 | Ga0209051_1039952 | Ga0209051_10399522 | 239 |
| 103 | 3300025931 | Ga0207644_10221347 | Ga0207644_102213472 | 239 |
| 104 | 3300025941 | Ga0207711_10713844 | Ga0207711_107138441 | 239 |
| 105 | 3300025961 | Ga0207712_10401576 | Ga0207712_104015762 | 239 |
| 106 | 3300026088 | Ga0207641_10151013 | Ga0207641_101510133 | 239 |
| 107 | 3300026095 | Ga0207676_10278665 | Ga0207676_102786652 | 239 |
| 108 | 3300026118 | Ga0207675_100101667 | Ga0207675_1001016672 | 239 |
| 109 | 3300027312 | Ga0209371_1020428 | Ga0209371_10204282 | 239 |
| 110 | 3300028380 | Ga0268265_10551459 | Ga0268265_105514591 | 239 |
| 111 | 3300028381 | Ga0268264_10215836 | Ga0268264_102158361 | 239 |
| 112 | 3300030500 | Ga0268256_1022888 | Ga0268256_10228882 | 239 |
| 113 | 3300031456 | Ga0307513_10161978 | Ga0307513_101619783 | 239 |
| 114 | 3300031456 | Ga0307513_10255184 | Ga0307513_102551842 | 239 |
| 115 | 3300046530 | Ga0495654_0000462 | Ga0495654_0000462_24152_24871 | 239 |
| 116 | 3300047469 | Ga0495673_0103399 | Ga0495673_0103399_395_1114 | 239 |
| 117 | 3300048908 | Ga0496105_0230923 | Ga0496105_0230923_310_1029 | 239 |
| 118 | 3300048919 | Ga0496116_0014717 | Ga0496116_0014717_1838_2617 | 239 |
| 119 | 3300048920 | Ga0496117_0020810 | Ga0496117_0020810_2433_3152 | 239 |
| 120 | 3300048921 | Ga0496118_0019252 | Ga0496118_0019252_657_1376 | 239 |
| 121 | 3300048921 | Ga0496118_0037960 | Ga0496118_0037960_2192_2911 | 239 |
| 122 | 3300048922 | Ga0496119_0176237 | Ga0496119_0176237_244_963 | 239 |
| 123 | 3300048923 | Ga0496120_0002371 | Ga0496120_0002371_14444_15163 | 239 |
| 124 | 3300048924 | Ga0496121_0000153 | Ga0496121_0000153_38275_38994 | 239 |
| 125 | 3300048925 | Ga0496122_0005806 | Ga0496122_0005806_922_1665 | 239 |
| 126 | 3300048925 | Ga0496122_0063309 | Ga0496122_0063309_1006_1725 | 239 |
| 127 | 3300048925 | Ga0496122_0104443 | Ga0496122_0104443_749_1468 | 239 |
| 128 | 3300048926 | Ga0496123_0001621 | Ga0496123_0001621_18927_19670 | 239 |
| 129 | 3300048926 | Ga0496123_0014329 | Ga0496123_0014329_3133_3852 | 239 |
| 130 | 3300048927 | Ga0496124_0060308 | Ga0496124_0060308_1957_2676 | 239 |
| 131 | 3300048928 | Ga0496125_0002020 | Ga0496125_0002020_19575_20294 | 239 |
| 132 | 3300048928 | Ga0496125_0035119 | Ga0496125_0035119_2326_3045 | 239 |
| 133 | 3300048928 | Ga0496125_0116523 | Ga0496125_0116523_854_1597 | 239 |
| 134 | 3300048928 | Ga0496125_0200237 | Ga0496125_0200237_134_853 | 239 |
| 135 | 3300048929 | Ga0496126_0004010 | Ga0496126_0004010_2391_3110 | 239 |
| 136 | 3300048929 | Ga0496126_0061983 | Ga0496126_0061983_980_1723 | 239 |
| 137 | 3300049568 | Ga0501031_0012665 | Ga0501031_0012665_2196_2915 | 239 |
| 138 | 3300049569 | Ga0501032_0000816 | Ga0501032_0000816_24315_25034 | 239 |
| 139 | 3300049570 | Ga0501033_0003584 | Ga0501033_0003584_4075_4794 | 239 |
| 140 | 3300049571 | Ga0501034_0006814 | Ga0501034_0006814_7554_8273 | 239 |
| 141 | 3300049571 | Ga0501034_0031655 | Ga0501034_0031655_676_1395 | 239 |
| 142 | 3300049572 | Ga0501036_0001771 | Ga0501036_0001771_2354_3073 | 239 |
| 143 | 3300049573 | Ga0501037_0004252 | Ga0501037_0004252_5567_6286 | 239 |
| 144 | 3300049574 | Ga0501038_0000494 | Ga0501038_0000494_29215_29934 | 239 |
| 145 | 3300049579 | Ga0501043_0000038 | Ga0501043_0000038_125592_126311 | 239 |
| 146 | 3300049579 | Ga0501043_0001194 | Ga0501043_0001194_13703_14422 | 239 |
| 147 | 3300049580 | Ga0501046_0000049 | Ga0501046_0000049_2369_3088 | 239 |
| 148 | 3300049580 | Ga0501046_0002440 | Ga0501046_0002440_10083_10802 | 239 |
| 149 | 3300049581 | Ga0501047_0000039 | Ga0501047_0000039_184785_185504 | 239 |
| 150 | 3300049581 | Ga0501047_0004711 | Ga0501047_0004711_7039_7758 | 239 |
| 151 | 3300049582 | Ga0501048_0025913 | Ga0501048_0025913_2480_3199 | 239 |
| 152 | 3300049822 | Ga0501035_0000874 | Ga0501035_0000874_31183_31902 | 239 |
| 153 | 3300049823 | Ga0501044_0012609 | Ga0501044_0012609_666_1385 | 239 |
| 154 | 3300049823 | Ga0501044_0120424 | Ga0501044_0120424_1745_2464 | 239 |
| 155 | 3300049824 | Ga0501045_0001444 | Ga0501045_0001444_2255_2974 | 239 |
| 156 | 3300050493 | nmdc:mga0k408_133302_c1 | nmdc:mga0k408_133302_c1_156_875 | 239 |
| 157 | 3300050493 | nmdc:mga0k408_63238_c1 | nmdc:mga0k408_63238_c1_782_1501 | 239 |
| 158 | 3300050494 | nmdc:mga06z11_75134_c1 | nmdc:mga06z11_75134_c1_736_1455 | 239 |
| 159 | 3300050496 | nmdc:mga07m45_44575_c1 | nmdc:mga07m45_44575_c1_621_1340 | 239 |
| 160 | 3300050512 | nmdc:mga0n895_656473_c1 | nmdc:mga0n895_656473_c1_269_988 | 239 |
| 161 | iso_pu_bacteria | 2738543013 | 2739250699 | 239 |
| 162 | iso_pu_bacteria | 2842747753 | 2842752923 | 239 |
| 163 | iso_pu_bacteria | 2954767861 | 2954768302 | 239 |
| 164 | 3300003187 | JGI25151J46595_10000639 | JGI25151J46595_1000063927 | 240 |
| 165 | 3300003784 | Ga0055534_1000538 | Ga0055534_100053813 | 240 |
| 166 | 3300003792 | Ga0055540_1054071 | Ga0055540_10540711 | 240 |
| 167 | 3300005262 | Ga0065165_1001709 | Ga0065165_10017098 | 240 |
| 168 | 3300005367 | Ga0070667_100009961 | Ga0070667_1000099616 | 240 |
| 169 | 3300005455 | Ga0070663_100159576 | Ga0070663_1001595762 | 240 |
| 170 | 3300005543 | Ga0070672_100386236 | Ga0070672_1003862362 | 240 |
| 171 | 3300005548 | Ga0070665_100533089 | Ga0070665_1005330892 | 240 |
| 172 | 3300006353 | Ga0075370_10272436 | Ga0075370_102724361 | 240 |
| 173 | 3300011119 | Ga0105246_10822524 | Ga0105246_108225241 | 240 |
| 174 | 3300013104 | Ga0157370_10002111 | Ga0157370_1000211119 | 240 |
| 175 | 3300013306 | Ga0163162_10183247 | Ga0163162_101832472 | 240 |
| 176 | 3300014497 | Ga0182008_10000207 | Ga0182008_100002076 | 240 |
| 177 | 3300014497 | Ga0182008_10001172 | Ga0182008_1000117213 | 240 |
| 178 | 3300014969 | Ga0157376_10289677 | Ga0157376_102896772 | 240 |
| 179 | 3300015262 | Ga0182007_10000185 | Ga0182007_1000018521 | 240 |
| 180 | 3300015265 | Ga0182005_1026006 | Ga0182005_10260062 | 240 |
| 181 | 3300017792 | Ga0163161_10236378 | Ga0163161_102363782 | 240 |
| 182 | 3300025284 | Ga0209130_1002434 | Ga0209130_10024347 | 240 |
| 183 | 3300025291 | Ga0209675_1000859 | Ga0209675_10008598 | 240 |
| 184 | 3300025292 | Ga0209676_1019922 | Ga0209676_10199223 | 240 |
| 185 | 3300025294 | Ga0209025_1000018 | Ga0209025_1000018166 | 240 |
| 186 | 3300025295 | Ga0209564_1028842 | Ga0209564_10288422 | 240 |
| 187 | 3300025298 | Ga0209050_1000247 | Ga0209050_100024760 | 240 |
| 188 | 3300025303 | Ga0209051_1026700 | Ga0209051_10267002 | 240 |
| 189 | 3300025924 | Ga0207694_10151243 | Ga0207694_101512432 | 240 |
| 190 | 3300025940 | Ga0207691_10164522 | Ga0207691_101645222 | 240 |
| 191 | 3300031238 | Ga0265332_10158523 | Ga0265332_101585232 | 240 |
| 192 | 3300031251 | Ga0265327_10006362 | Ga0265327_100063627 | 240 |
| 193 | 3300031251 | Ga0265327_10073904 | Ga0265327_100739042 | 240 |
| 194 | 3300031456 | Ga0307513_10216331 | Ga0307513_102163312 | 240 |
| 195 | 3300031911 | Ga0307412_10016402 | Ga0307412_100164022 | 240 |
| 196 | 3300032002 | Ga0307416_100011432 | Ga0307416_1000114325 | 240 |
| 197 | 3300037418 | Ga0395900_0190713 | Ga0395900_0190713_693_1415 | 240 |
| 198 | 3300046475 | Ga0495639_0027894 | Ga0495639_0027894_1393_2115 | 240 |
| 199 | 3300046528 | Ga0495642_0040956 | Ga0495642_0040956_161_883 | 240 |
| 200 | 3300046539 | Ga0495621_0061230 | Ga0495621_0061230_242_964 | 240 |
| 201 | 3300046539 | Ga0495621_0063489 | Ga0495621_0063489_567_1289 | 240 |
| 202 | 3300046558 | Ga0495633_0003193 | Ga0495633_0003193_3857_4579 | 240 |
| 203 | 3300046674 | Ga0495588_0188022 | Ga0495588_0188022_347_1069 | 240 |
| 204 | 3300046691 | Ga0495670_0107426 | Ga0495670_0107426_15_737 | 240 |
| 205 | 3300048903 | Ga0496100_0002476 | Ga0496100_0002476_5840_6562 | 240 |
| 206 | 3300048904 | Ga0496101_0000519 | Ga0496101_0000519_11666_12388 | 240 |
| 207 | 3300048904 | Ga0496101_0442701 | Ga0496101_0442701_177_899 | 240 |
| 208 | 3300048905 | Ga0496102_0001291 | Ga0496102_0001291_16106_16828 | 240 |
| 209 | 3300048905 | Ga0496102_0048973 | Ga0496102_0048973_3031_3753 | 240 |
| 210 | 3300048906 | Ga0496103_0004323 | Ga0496103_0004323_7528_8250 | 240 |
| 211 | 3300048907 | Ga0496104_0002481 | Ga0496104_0002481_15158_15880 | 240 |
| 212 | 3300048908 | Ga0496105_0000375 | Ga0496105_0000375_12255_12977 | 240 |
| 213 | 3300048909 | Ga0496106_0051310 | Ga0496106_0051310_1161_1883 | 240 |
| 214 | 3300048912 | Ga0496109_0045183 | Ga0496109_0045183_2654_3376 | 240 |
| 215 | 3300048912 | Ga0496109_0047712 | Ga0496109_0047712_1963_2685 | 240 |
| 216 | 3300048913 | Ga0496110_0001501 | Ga0496110_0001501_12820_13542 | 240 |
| 217 | 3300048913 | Ga0496110_0125915 | Ga0496110_0125915_912_1634 | 240 |
| 218 | 3300048913 | Ga0496110_0179466 | Ga0496110_0179466_631_1353 | 240 |
| 219 | 3300048914 | Ga0496111_0013567 | Ga0496111_0013567_4662_5384 | 240 |
| 220 | 3300048914 | Ga0496111_0069494 | Ga0496111_0069494_1182_1904 | 240 |
| 221 | 3300048924 | Ga0496121_0114041 | Ga0496121_0114041_1060_1782 | 240 |
| 222 | 3300048927 | Ga0496124_0000123 | Ga0496124_0000123_121517_122239 | 240 |
| 223 | 3300048929 | Ga0496126_0000674 | Ga0496126_0000674_38498_39220 | 240 |
| 224 | 3300049573 | Ga0501037_0013688 | Ga0501037_0013688_1368_2090 | 240 |
| 225 | 3300049581 | Ga0501047_0090152 | Ga0501047_0090152_1094_1816 | 240 |
| 226 | 3300049822 | Ga0501035_0378192 | Ga0501035_0378192_101_823 | 240 |
| 227 | 3300049823 | Ga0501044_0004644 | Ga0501044_0004644_7578_8300 | 240 |
| 228 | 3300049823 | Ga0501044_0241711 | Ga0501044_0241711_936_1658 | 240 |
| 229 | 3300050496 | nmdc:mga07m45_186457_c1 | nmdc:mga07m45_186457_c1_196_918 | 240 |
| 230 | 3300053086 | Ga0500578_0000282 | Ga0500578_0000282_27267_27989 | 240 |
| 231 | iso_pu_bacteria | 2919046199 | 2919047203 | 240 |
| 232 | 3300003784 | Ga0055534_1014274 | Ga0055534_10142741 | 241 |
| 233 | 3300005539 | Ga0068853_100241610 | Ga0068853_1002416103 | 241 |
| 234 | 3300006195 | Ga0075366_10017277 | Ga0075366_100172774 | 241 |
| 235 | 3300006195 | Ga0075366_10124969 | Ga0075366_101249692 | 241 |
| 236 | 3300006353 | Ga0075370_10057355 | Ga0075370_100573553 | 241 |
| 237 | 3300006353 | Ga0075370_10260954 | Ga0075370_102609542 | 241 |
| 238 | 3300025291 | Ga0209675_1002909 | Ga0209675_10029097 | 241 |
| 239 | 3300025298 | Ga0209050_1001725 | Ga0209050_10017256 | 241 |
| 240 | 3300025303 | Ga0209051_1060075 | Ga0209051_10600751 | 241 |
| 241 | 3300028786 | Ga0307517_10275524 | Ga0307517_102755242 | 241 |
| 242 | 3300031730 | Ga0307516_10013066 | Ga0307516_100130667 | 241 |
| 243 | 3300037418 | Ga0395900_0450486 | Ga0395900_0450486_196_921 | 241 |
| 244 | 3300041452 | Ga0451793_0014015 | Ga0451793_0014015_1101_1826 | 241 |
| 245 | 3300046460 | Ga0495638_0173726 | Ga0495638_0173726_339_1064 | 241 |
| 246 | 3300046519 | Ga0495632_0003923 | Ga0495632_0003923_2231_2956 | 241 |
| 247 | 3300046520 | Ga0495637_0004153 | Ga0495637_0004153_1106_1831 | 241 |
| 248 | 3300048091 | Ga0495626_0001523 | Ga0495626_0001523_15086_15811 | 241 |
| 249 | 3300048920 | Ga0496117_0007204 | Ga0496117_0007204_9518_10243 | 241 |
| 250 | 3300048924 | Ga0496121_0011190 | Ga0496121_0011190_1011_1736 | 241 |
| 251 | 3300048925 | Ga0496122_0265609 | Ga0496122_0265609_167_892 | 241 |
| 252 | 3300048928 | Ga0496125_0164776 | Ga0496125_0164776_355_1080 | 241 |
| 253 | 3300049568 | Ga0501031_0100690 | Ga0501031_0100690_1108_1833 | 241 |
| 254 | 3300050493 | nmdc:mga0k408_63220_c2 | nmdc:mga0k408_63220_c2_105_830 | 241 |
| 255 | 3300050493 | nmdc:mga0k408_83546_c1 | nmdc:mga0k408_83546_c1_12_737 | 241 |
| 256 | 3300050496 | nmdc:mga07m45_59696_c1 | nmdc:mga07m45_59696_c1_1301_2026 | 241 |
| 257 | 3300053111 | Ga0500572_034735 | Ga0500572_034735_625_1350 | 241 |
| 258 | 3300053129 | Ga0500628_003983 | Ga0500628_003983_932_1657 | 241 |
| 259 | 3300053130 | Ga0500642_0003827 | Ga0500642_0003827_3150_3875 | 241 |
| 260 | 3300053131 | Ga0500652_000383 | Ga0500652_000383_14592_15317 | 241 |
| 261 | 3300053139 | Ga0500568_0015225 | Ga0500568_0015225_1013_1738 | 241 |
| 262 | 3300053142 | Ga0500577_0136691 | Ga0500577_0136691_96_821 | 241 |
| 263 | 3300053156 | Ga0500622_0001707 | Ga0500622_0001707_10134_10859 | 241 |
| 264 | iso_pu_bacteria | 2738541307 | 2738883033 | 241 |
| 265 | 3300005366 | Ga0070659_100259661 | Ga0070659_1002596612 | 242 |
| 266 | 3300005539 | Ga0068853_100130972 | Ga0068853_1001309723 | 242 |
| 267 | 3300009093 | Ga0105240_10052581 | Ga0105240_100525813 | 242 |
| 268 | 3300009545 | Ga0105237_10014914 | Ga0105237_100149142 | 242 |
| 269 | 3300010375 | Ga0105239_10009446 | Ga0105239_100094468 | 242 |
| 270 | 3300013100 | Ga0157373_10007445 | Ga0157373_100074457 | 242 |
| 271 | 3300013104 | Ga0157370_10026421 | Ga0157370_100264213 | 242 |
| 272 | 3300013105 | Ga0157369_10000456 | Ga0157369_1000045648 | 242 |
| 273 | 3300017792 | Ga0163161_10151893 | Ga0163161_101518932 | 242 |
| 274 | 3300025914 | Ga0207671_10098708 | Ga0207671_100987082 | 242 |
| 275 | 3300025925 | Ga0207650_10246491 | Ga0207650_102464912 | 242 |
| 276 | 3300025932 | Ga0207690_10224863 | Ga0207690_102248632 | 242 |
| 277 | 3300025981 | Ga0207640_10343302 | Ga0207640_103433022 | 242 |
| 278 | 3300026041 | Ga0207639_10033289 | Ga0207639_100332893 | 242 |
| 279 | 3300026116 | Ga0207674_10113399 | Ga0207674_101133992 | 242 |
| 280 | 3300026116 | Ga0207674_10149032 | Ga0207674_101490322 | 242 |
| 281 | 3300030745 | Ga0316182_1008399 | Ga0316182_10083992 | 242 |
| 282 | 3300031911 | Ga0307412_10104628 | Ga0307412_101046282 | 242 |
| 283 | 3300044683 | Ga0466965_0005137 | Ga0466965_0005137_3996_4724 | 242 |
| 284 | 3300044901 | Ga0466960_0009903 | Ga0466960_0009903_3065_3793 | 242 |
| 285 | 3300046689 | Ga0495613_0000194 | Ga0495613_0000194_43998_44726 | 242 |
| 286 | 3300047470 | Ga0495681_0000235 | Ga0495681_0000235_13366_14094 | 242 |
| 287 | 3300048925 | Ga0496122_0000034 | Ga0496122_0000034_209347_210081 | 242 |
| 288 | 3300048925 | Ga0496122_0092516 | Ga0496122_0092516_782_1531 | 242 |
| 289 | 3300048926 | Ga0496123_0000141 | Ga0496123_0000141_139573_140307 | 242 |
| 290 | 3300048927 | Ga0496124_0006512 | Ga0496124_0006512_6912_7661 | 242 |
| 291 | 3300048927 | Ga0496124_0023619 | Ga0496124_0023619_1235_1969 | 242 |
| 292 | 3300031911 | Ga0307412_10000512 | Ga0307412_1000051216 | 243 |
| 293 | 3300002773 | JGI25152J39213_1002258 | JGI25152J39213_10022583 | 244 |
| 294 | 3300003215 | JGI25153J46596_10000537 | JGI25153J46596_100005377 | 244 |
| 295 | 3300003771 | Ga0055526_1000296 | Ga0055526_100029626 | 244 |
| 296 | 3300025245 | Ga0207425_1000259 | Ga0207425_100025927 | 244 |
| 297 | 3300025258 | Ga0209129_1000175 | Ga0209129_100017543 | 244 |
| 298 | 3300025273 | Ga0209673_1008351 | Ga0209673_10083512 | 244 |
| 299 | 3300025295 | Ga0209564_1000136 | Ga0209564_1000136123 | 244 |
| 300 | 3300025297 | Ga0209758_1000275 | Ga0209758_100027572 | 244 |
| 301 | 3300044658 | Ga0466972_0078133 | Ga0466972_0078133_568_1302 | 244 |
| 302 | 3300048909 | Ga0496106_0002941 | Ga0496106_0002941_5641_6381 | 244 |
| 303 | 3300006353 | Ga0075370_10179696 | Ga0075370_101796962 | 245 |
| 304 | 3300031903 | Ga0307407_10296558 | Ga0307407_102965581 | 245 |
| 305 | 3300046453 | Ga0495627_021365 | Ga0495627_021365_161_898 | 245 |
| 306 | 3300048924 | Ga0496121_0121436 | Ga0496121_0121436_1113_1868 | 245 |
| 307 | 3300048928 | Ga0496125_0004960 | Ga0496125_0004960_6859_7614 | 245 |
| 308 | iso_pu_bacteria | 2818991445 | 2819593011 | 247 |
| 309 | 3300002704 | JGI25155J39150_1000182 | JGI25155J39150_100018213 | 251 |
| 310 | 3300002705 | JGI25156J39149_1000304 | JGI25156J39149_100030413 | 251 |
| 311 | 3300002738 | JGI25154J39366_1000268 | JGI25154J39366_100026813 | 251 |
| 312 | 3300002741 | JGI25157J39369_1000334 | JGI25157J39369_10003343 | 251 |
| 313 | 3300002741 | JGI25157J39369_1000373 | JGI25157J39369_100037321 | 251 |
| 314 | 3300003758 | Ga0055532_1000130 | Ga0055532_100013061 | 251 |
| 315 | 3300025206 | Ga0209435_100046 | Ga0209435_10004680 | 251 |
| 316 | 3300025229 | Ga0209147_100157 | Ga0209147_10015711 | 251 |
| 317 | 3300025242 | Ga0209258_100733 | Ga0209258_10073311 | 251 |
| 318 | 3300025246 | Ga0209646_1000156 | Ga0209646_100015613 | 251 |
| 319 | 3300025250 | Ga0209026_1000267 | Ga0209026_100026713 | 251 |
| 320 | 3300025254 | Ga0209148_1007780 | Ga0209148_10077803 | 251 |
| 321 | 3300025256 | Ga0209759_1000348 | Ga0209759_100034845 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9065 | 16 | 251 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.8975 | 20 | 238 |
| 4p33-assembly1.cif.gz_A | crystal structure of e. coli lptb-e163q in complex with atp-sodium | 0.8917 | 20 | 249 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.8903 | 20 | 247 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.8884 | 16 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9251 | 20 | 247 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9229 | 18 | 251 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9079 | 18 | 251 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8947 | 20 | 247 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8941 | 20 | 233 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K8NUH8-F1-model_v4 | Branched-chain amino acid transport ATP-binding protein LivF | 0.9846 | 17 | 251 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A561CKT0-F1-model_v4 | deleted | 0.9843 | 17 | 251 |
|
| AF-A0A1C9VEH6-F1-model_v4 | deleted | 0.984 | 16 | 251 |
|
| AF-A0A086XSU2-F1-model_v4 | Mannosyltransferase | 0.9833 | 15 | 251 |
GO:0005524
GO:0015658 GO:0015807 GO:0016757 GO:0016887 |
| AF-A0A537FQ68-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9812 | 66 | 234 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar