F405829

General Info

Members Datasets Scaffolds Average Seq Length
321 208 642 239

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100215039|Ga0070680_1002150392
Length 267
Sequence VTDETQELGAARAGAESGPEQPRERAGVPWLEIGMTVLGVLLLAGLVLAIPALRHAAVAAVHGETSEVRQQIKSLGVGGPLIIVGLGVIHSVVPYPAEIVNAAAGFAYGFFGGLGIVAVGWMLSALICYWFGTGVARPLLDRWFGAARFERFERMVERGGITLLIALRLLPIVPFSLISAAAGAARVPFGRYCWTTAVGFLPITALAVYLGTRLEGIRFTDPTVIGAVVGVVLLLLVAQWIIKRSGADDDGTSESGAPSSRASKEAP

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
206 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 9.97
Rhizosphere 81.62
Stem 0
Stem Tuber 0
Unclassified 7.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100215039 3300005336 Unclassified 1622
2 JGI25404J52841_10036475 3300003659 Bacteria 1046
3 Ga0070683_100018262 3300005329 Bacteria 6208
4 Ga0070683_100041908 3300005329 Bacteria 4214
5 Ga0070683_100338333 3300005329 Bacteria 1433
6 Ga0070666_10054955 3300005335 Bacteria 2687
7 Ga0070682_100000032 3300005337 Bacteria 155141
8 Ga0068868_100000218 3300005338 Bacteria 38835
9 Ga0068868_100000568 3300005338 Bacteria 24761
10 Ga0070689_100064461 3300005340 Bacteria 2852
11 Ga0070661_100000255 3300005344 Bacteria 43552
12 Ga0070668_100059768 3300005347 Bacteria 2950
13 Ga0070668_100508451 3300005347 Bacteria 1044
14 Ga0070673_100011054 3300005364 Bacteria 6149
15 Ga0070667_100009647 3300005367 Bacteria 8008
16 Ga0070667_100128979 3300005367 Bacteria 2206
17 Ga0070667_100440694 3300005367 Unclassified 1189
18 Ga0070714_100015268 3300005435 Bacteria 6178
19 Ga0070711_100113540 3300005439 Bacteria 1992
20 Ga0070663_100001196 3300005455 Bacteria 14269
21 Ga0070663_100167451 3300005455 Bacteria 1696
22 Ga0070662_100000001 3300005457 Bacteria 317995
23 Ga0070662_100394291 3300005457 Bacteria 1141
24 Ga0070685_10000191 3300005466 Bacteria 41016
25 Ga0070685_10270517 3300005466 Bacteria 1134
26 Ga0070679_100001834 3300005530 Bacteria 19119
27 Ga0070684_100005142 3300005535 Bacteria 10001
28 Ga0070684_100016405 3300005535 Bacteria 6054
29 Ga0070684_100747045 3300005535 Unclassified 913
30 Ga0070693_100003939 3300005547 Bacteria 6967
31 Ga0070665_100009217 3300005548 Bacteria 9998
32 Ga0070665_100010578 3300005548 Bacteria 9340
33 Ga0070665_100630396 3300005548 Unclassified 1085
34 Ga0068855_100150905 3300005563 Bacteria 2643
35 Ga0068854_100000267 3300005578 Bacteria 35526
36 Ga0068856_100001040 3300005614 Bacteria 29492
37 Ga0068856_100006944 3300005614 Bacteria 11073
38 Ga0068852_100000132 3300005616 Bacteria 50593
39 Ga0068852_100009749 3300005616 Bacteria 7141
40 Ga0068864_100000024 3300005618 Bacteria 252632
41 Ga0068861_100183387 3300005719 Bacteria 1744
42 Ga0068851_10000258 3300005834 Bacteria 25137
43 Ga0068851_10001500 3300005834 Bacteria 10232
44 Ga0068862_100004764 3300005844 Bacteria 11416
45 Ga0081455_10119587 3300005937 Bacteria 2077
46 Ga0081540_1000181 3300005983 Bacteria 65791
47 Ga0075363_100147223 3300006048 Bacteria 1328
48 Ga0068871_100097042 3300006358 Bacteria 2463
49 Ga0075431_100018190 3300006847 Bacteria 7151
50 Ga0075433_10006968 3300006852 Bacteria 8960
51 Ga0075434_100112121 3300006871 Bacteria 2739
52 Ga0068865_100000039 3300006881 Bacteria 73689
53 Ga0105245_10002902 3300009098 Bacteria 15382
54 Ga0105247_10000369 3300009101 Bacteria 38254
55 Ga0105247_10193839 3300009101 Bacteria 1362
56 Ga0105243_10009809 3300009148 Bacteria 7290
57 Ga0105242_10001159 3300009176 Bacteria 20774
58 Ga0105242_10004215 3300009176 Bacteria 11206
59 Ga0105248_10000017 3300009177 Bacteria 298089
60 Ga0105238_10134353 3300009551 Bacteria 2452
61 Ga0105249_10053767 3300009553 Bacteria 3681
62 Ga0105239_10175629 3300010375 Bacteria 2396
63 Ga0105239_10218822 3300010375 Unclassified 2135
64 Ga0105246_10566459 3300011119 Unclassified 976
65 Ga0157371_10006241 3300013102 Bacteria 9880
66 Ga0157370_10002517 3300013104 Bacteria 22034
67 Ga0157369_10000803 3300013105 Bacteria 40158
68 Ga0157378_10219240 3300013297 Unclassified 1808
69 Ga0163162_10299810 3300013306 Bacteria 1739
70 Ga0157372_10000407 3300013307 Bacteria 47331
71 Ga0157375_10001906 3300013308 Bacteria 17932
72 Ga0157375_10072166 3300013308 Bacteria 3468
73 Ga0157375_11152570 3300013308 Bacteria 908
74 Ga0157379_10183236 3300014968 Bacteria 1892
75 Ga0163161_10000103 3300017792 Bacteria 81496
76 Ga0207656_10000279 3300025321 Bacteria 17686
77 Ga0207656_10067048 3300025321 Bacteria 1588
78 Ga0207710_10000227 3300025900 Bacteria 48932
79 Ga0207680_10021847 3300025903 Bacteria 3470
80 Ga0207680_10151765 3300025903 Bacteria 1545
81 Ga0207693_10010235 3300025915 Bacteria 7614
82 Ga0207663_10120193 3300025916 Bacteria 1798
83 Ga0207649_10000015 3300025920 Bacteria 245662
84 Ga0207652_10000513 3300025921 Bacteria 39231
85 Ga0207694_10151185 3300025924 Unclassified 1870
86 Ga0207687_10000025 3300025927 Bacteria 175177
87 Ga0207687_10001391 3300025927 Bacteria 16522
88 Ga0207700_10000019 3300025928 Bacteria 183117
89 Ga0207664_10062896 3300025929 Bacteria 2965
90 Ga0207690_10020960 3300025932 Bacteria 4047
91 Ga0207706_10000003 3300025933 Bacteria 345011
92 Ga0207686_10000035 3300025934 Bacteria 130483
93 Ga0207686_10022682 3300025934 Bacteria 3617
94 Ga0207709_10005656 3300025935 Bacteria 7067
95 Ga0207669_10077449 3300025937 Bacteria 2115
96 Ga0207704_10000165 3300025938 Bacteria 35234
97 Ga0207691_10000286 3300025940 Bacteria 49918
98 Ga0207711_10000011 3300025941 Bacteria 518817
99 Ga0207661_10000545 3300025944 Bacteria 24110
100 Ga0207661_10001203 3300025944 Bacteria 17323
101 Ga0207661_10064362 3300025944 Archaea 2972
102 Ga0207661_10262793 3300025944 Bacteria 1538
103 Ga0207679_10100804 3300025945 Bacteria 2258
104 Ga0207667_10131618 3300025949 Bacteria 2577
105 Ga0207668_10016227 3300025972 Bacteria 4644
106 Ga0207658_10006639 3300025986 Bacteria 7881
107 Ga0207658_10071087 3300025986 Bacteria 2634
108 Ga0207658_10148442 3300025986 Bacteria 1907
109 Ga0207677_10000163 3300026023 Bacteria 52869
110 Ga0207677_10001061 3300026023 Bacteria 15064
111 Ga0207639_10054317 3300026041 Bacteria 3061
112 Ga0207678_10002590 3300026067 Bacteria 16479
113 Ga0207678_10365997 3300026067 Bacteria 1245
114 Ga0207702_10000349 3300026078 Bacteria 52941
115 Ga0207702_10044730 3300026078 Bacteria 3722
116 Ga0207641_10002521 3300026088 Bacteria 16875
117 Ga0207641_10587622 3300026088 Unclassified 1089
118 Ga0207676_10000048 3300026095 Bacteria 147853
119 Ga0207675_100218416 3300026118 Bacteria 1836
120 Ga0207683_10190878 3300026121 Unclassified 1860
121 Ga0207698_10000014 3300026142 Bacteria 240703
122 Ga0207698_10014780 3300026142 Bacteria 5203
123 Ga0268266_10000369 3300028379 Bacteria 69354
124 Ga0268266_10009239 3300028379 Bacteria 8697
125 Ga0268266_10641789 3300028379 Bacteria 1021
126 Ga0268265_10098167 3300028380 Bacteria 2358
127 Ga0268264_10061575 3300028381 Bacteria 3149
128 Ga0265337_1000060 3300028556 Bacteria 49697
129 Ga0265326_10000056 3300028558 Bacteria 64840
130 Ga0265319_1000037 3300028563 Bacteria 115642
131 Ga0265322_10000017 3300028654 Bacteria 114833
132 Ga0265336_10003958 3300028666 Bacteria 5673
133 Ga0265338_10000051 3300028800 Bacteria 211202
134 Ga0265328_10000258 3300031239 Bacteria 24453
135 Ga0265320_10000068 3300031240 Bacteria 91884
136 Ga0265325_10024342 3300031241 Bacteria 3295
137 Ga0265329_10007182 3300031242 Bacteria 4333
138 Ga0265339_10072518 3300031249 Archaea 1832
139 Ga0265331_10000606 3300031250 Bacteria 31608
140 Ga0265327_10000317 3300031251 Bacteria 92215
141 Ga0265314_10000973 3300031711 Bacteria 33669
142 Ga0265342_10028625 3300031712 Bacteria 3468
143 Ga0373954_0250599 3300035118 Unclassified 872
144 Ga0451853_0880571 3300041512 Bacteria 936
145 Ga0466963_0009227 3300044694 Bacteria 5939
146 Ga0466963_0014072 3300044694 Bacteria 4929
147 Ga0466957_0027884 3300044842 Bacteria 3358
148 Ga0466967_0000013 3300045976 Bacteria 103249
149 Ga0466967_0471954 3300045976 Unclassified 1228
150 Ga0495629_0000201 3300046459 Bacteria 53022
151 Ga0495629_0008550 3300046459 Bacteria 7536
152 Ga0495629_0053857 3300046459 Bacteria 2814
153 Ga0495629_0156269 3300046459 Bacteria 1585
154 Ga0495651_0129850 3300046462 Bacteria 1841
155 Ga0495651_0175032 3300046462 Bacteria 1524
156 Ga0495653_0015647 3300046463 Bacteria 6183
157 Ga0495653_0270435 3300046463 Bacteria 1119
158 Ga0495664_0214803 3300046477 Bacteria 1165
159 Ga0495594_0000001 3300046499 Bacteria 293051
160 Ga0495608_0000042 3300046511 Bacteria 115906
161 Ga0495608_0002177 3300046511 Bacteria 14130
162 Ga0495610_0049855 3300046512 Bacteria 2047
163 Ga0495618_0000051 3300046514 Bacteria 87668
164 Ga0495628_0152053 3300046516 Bacteria 1762
165 Ga0495630_0006964 3300046517 Bacteria 8060
166 Ga0495644_0075026 3300046523 Bacteria 1273
167 Ga0495652_0007230 3300046529 Bacteria 10249
168 Ga0495587_0011085 3300046536 Bacteria 5718
169 Ga0495645_0059636 3300046543 Bacteria 2766
170 Ga0495645_0096347 3300046543 Bacteria 2108
171 Ga0495645_0368895 3300046543 Bacteria 921
172 Ga0495622_0000033 3300046557 Bacteria 124162
173 Ga0495667_0397829 3300046559 Unclassified 868
174 Ga0495634_0000050 3300046642 Bacteria 94546
175 Ga0495634_0019613 3300046642 Bacteria 4803
176 Ga0495634_0195048 3300046642 Bacteria 1261
177 Ga0495588_0000204 3300046674 Bacteria 58892
178 Ga0495657_0000040 3300046675 Bacteria 115899
179 Ga0495657_0001105 3300046675 Bacteria 23615
180 Ga0495647_0000549 3300046681 Bacteria 11034
181 Ga0495658_0000001 3300046683 Bacteria 385362
182 Ga0495658_0026703 3300046683 Bacteria 3097
183 Ga0495613_0000067 3300046689 Bacteria 101960
184 Ga0495613_0000155 3300046689 Bacteria 67203
185 Ga0495624_0000031 3300046690 Bacteria 91702
186 Ga0495624_0144355 3300046690 Bacteria 1457
187 Ga0495670_0007376 3300046691 Bacteria 5405
188 Ga0495600_0000376 3300046809 Bacteria 23258
189 Ga0495600_0000973 3300046809 Bacteria 15439
190 Ga0495600_0098966 3300046809 Bacteria 1901
191 Ga0495604_0016905 3300047317 Bacteria 5833
192 Ga0495674_0000024 3300047319 Bacteria 141746
193 Ga0495676_0004042 3300047321 Bacteria 13356
194 Ga0495680_0006169 3300047322 Bacteria 11179
195 Ga0495680_0088592 3300047322 Bacteria 2325
196 Ga0495680_0141202 3300047322 Unclassified 1762
197 Ga0495675_0000036 3300047444 Bacteria 91842
198 Ga0495675_0026910 3300047444 Bacteria 3666
199 Ga0495685_026729 3300047447 Unclassified 1984
200 Ga0495686_0041061 3300047472 Bacteria 2947
201 Ga0495593_0156147 3300047673 Bacteria 1153
202 Ga0495602_0000268 3300048088 Bacteria 47860
203 Ga0495602_0031787 3300048088 Bacteria 4983
204 Ga0495602_0060096 3300048088 Bacteria 3314
205 Ga0495602_0395529 3300048088 Bacteria 987
206 Ga0496100_0000019 3300048903 Bacteria 149995
207 Ga0496101_0000005 3300048904 Bacteria 331455
208 Ga0496101_0290036 3300048904 Unclassified 1280
209 Ga0496102_0000021 3300048905 Bacteria 246920
210 Ga0496102_0059006 3300048905 Bacteria 3508
211 Ga0496103_0000001 3300048906 Bacteria 643471
212 Ga0496103_0195526 3300048906 Bacteria 1300
213 Ga0496104_0099432 3300048907 Bacteria 2785
214 Ga0496105_0000002 3300048908 Bacteria 753215
215 Ga0496105_0000900 3300048908 Bacteria 20333
216 Ga0496105_0318520 3300048908 Bacteria 1247
217 Ga0496106_0000033 3300048909 Bacteria 131412
218 Ga0496106_0575038 3300048909 Bacteria 903
219 Ga0496107_0000004 3300048910 Bacteria 297680
220 Ga0496108_0000239 3300048911 Bacteria 49308
221 Ga0496108_0007751 3300048911 Bacteria 8698
222 Ga0496108_0504342 3300048911 Bacteria 1057
223 Ga0496109_0000011 3300048912 Bacteria 234908
224 Ga0496109_0000034 3300048912 Bacteria 160397
225 Ga0496109_0087074 3300048912 Bacteria 2885
226 Ga0496109_0168950 3300048912 Unclassified 2051
227 Ga0496111_0000020 3300048914 Bacteria 67992
228 Ga0496111_0103752 3300048914 Bacteria 2091
229 Ga0496111_0112664 3300048914 Unclassified 2004
230 Ga0496112_0000641 3300048915 Bacteria 24272
231 Ga0496113_0000002 3300048916 Bacteria 220193
232 Ga0496113_0001044 3300048916 Bacteria 14929
233 Ga0496113_0133551 3300048916 Unclassified 1949
234 Ga0496113_0159907 3300048916 Unclassified 1780
235 Ga0496114_0062040 3300048917 Bacteria 3128
236 Ga0496115_0000022 3300048918 Bacteria 164224
237 Ga0496115_0059140 3300048918 Unclassified 3086
238 Ga0496116_0000138 3300048919 Bacteria 151606
239 Ga0496117_0002715 3300048920 Bacteria 21760
240 Ga0496118_0005655 3300048921 Bacteria 14094
241 Ga0496119_0004108 3300048922 Bacteria 14674
242 Ga0496119_0005578 3300048922 Bacteria 11970
243 Ga0496119_0015712 3300048922 Bacteria 5806
244 Ga0496119_0032537 3300048922 Bacteria 3473
245 Ga0496119_0086856 3300048922 Unclassified 1786
246 Ga0496120_0001479 3300048923 Bacteria 27945
247 Ga0496120_0041605 3300048923 Bacteria 2690
248 Ga0496121_0019534 3300048924 Bacteria 6767
249 Ga0496121_0028618 3300048924 Bacteria 5182
250 Ga0496121_0038016 3300048924 Bacteria 4269
251 Ga0496121_0188172 3300048924 Bacteria 1483
252 Ga0496124_0030468 3300048927 Bacteria 4788
253 Ga0496124_0327489 3300048927 Unclassified 1094
254 Ga0496125_0025447 3300048928 Bacteria 5418
255 Ga0496125_0038395 3300048928 Bacteria 4145
256 Ga0496125_0181459 3300048928 Bacteria 1402
257 Ga0496126_0012060 3300048929 Bacteria 8881
258 Ga0496126_0019445 3300048929 Bacteria 6688
259 Ga0496126_0133432 3300048929 Bacteria 2144
260 Ga0501031_0003106 3300049568 Bacteria 10636
261 Ga0501032_0001727 3300049569 Bacteria 17287
262 Ga0501033_0001690 3300049570 Bacteria 19306
263 Ga0501034_0009478 3300049571 Bacteria 10191
264 Ga0501034_0451002 3300049571 Bacteria 1204
265 Ga0501036_0001272 3300049572 Bacteria 19338
266 Ga0501037_0001236 3300049573 Bacteria 18847
267 Ga0501038_0010265 3300049574 Bacteria 8569
268 Ga0501040_0024987 3300049576 Bacteria 4014
269 Ga0501042_0004801 3300049578 Bacteria 8637
270 Ga0501043_0001769 3300049579 Bacteria 18577
271 Ga0501043_0188668 3300049579 Bacteria 1604
272 Ga0501046_0002090 3300049580 Bacteria 18929
273 Ga0501047_0007106 3300049581 Bacteria 10514
274 Ga0501047_0027884 3300049581 Bacteria 5442
275 Ga0501047_0047141 3300049581 Bacteria 4164
276 Ga0501047_0238094 3300049581 Bacteria 1671
277 Ga0501047_0401956 3300049581 Bacteria 1203
278 Ga0501048_0001315 3300049582 Bacteria 18841
279 Ga0501067_0032753 3300049583 Bacteria 2885
280 Ga0501068_0006444 3300049584 Bacteria 6473
281 Ga0501069_0006122 3300049585 Bacteria 6282
282 Ga0501069_0017773 3300049585 Bacteria 3833
283 Ga0501070_0002097 3300049586 Bacteria 17495
284 Ga0501070_0197417 3300049586 Bacteria 1652
285 Ga0501071_0021920 3300049587 Bacteria 4453
286 Ga0501071_0173344 3300049587 Bacteria 1615
287 Ga0501072_0294986 3300049588 Bacteria 1289
288 Ga0501073_0001857 3300049589 Bacteria 15739
289 Ga0501074_0010325 3300049590 Bacteria 6774
290 Ga0501074_0037754 3300049590 Bacteria 3500
291 Ga0501074_0135106 3300049590 Bacteria 1764
292 Ga0501079_0007755 3300049741 Bacteria 8125
293 Ga0501079_0046739 3300049741 Bacteria 3340
294 Ga0501080_0023429 3300049742 Bacteria 5721
295 Ga0501080_0024705 3300049742 Bacteria 5572
296 Ga0501080_0724377 3300049742 Bacteria 876
297 Ga0501081_0040522 3300049743 Bacteria 3189
298 Ga0501083_0003852 3300049744 Bacteria 10535
299 Ga0501083_0011140 3300049744 Bacteria 6313
300 Ga0501083_0012682 3300049744 Bacteria 5896
301 Ga0501035_0000614 3300049822 Bacteria 39235
302 Ga0501035_0235336 3300049822 Bacteria 1560
303 Ga0501044_0008924 3300049823 Bacteria 10958
304 Ga0501044_0121748 3300049823 Bacteria 2609
305 Ga0501045_0020792 3300049824 Bacteria 4690
306 nmdc:mga03n38_138526_c1 3300050490 Bacteria 1213
307 nmdc:mga06r32_98922_c1 3300050510 Bacteria 2860
308 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
309 Ga0495601_0000019 3300053077 Bacteria 161673
310 Ga0495601_0172589 3300053077 Unclassified 1413
311 Ga0495612_0000208 3300053078 Bacteria 24962
312 Ga0495612_0003950 3300053078 Bacteria 6159
313 Ga0495655_0000008 3300053083 Bacteria 153535
314 Ga0495595_0000009 3300053084 Bacteria 193039
315 Ga0495595_0003003 3300053084 Bacteria 6667
316 Ga0495619_0000057 3300053085 Bacteria 93948
317 Ga0495619_0118004 3300053085 Bacteria 1817
318 Ga0500566_0008561 3300053094 Bacteria 6047
319 Ga0500628_000023 3300053129 Bacteria 77818
320 Ga0501084_0081550 3300054114 Bacteria 2713
321 Ga0501082_0016254 3300060353 Bacteria 6406
322 Ga0070680_100215039
323 JGI25404J52841_10036475
324 Ga0070683_100018262
325 Ga0070683_100041908
326 Ga0070683_100338333
327 Ga0070666_10054955
328 Ga0070682_100000032
329 Ga0068868_100000218
330 Ga0068868_100000568
331 Ga0070689_100064461
332 Ga0070661_100000255
333 Ga0070668_100059768
334 Ga0070668_100508451
335 Ga0070673_100011054
336 Ga0070667_100009647
337 Ga0070667_100128979
338 Ga0070667_100440694
339 Ga0070714_100015268
340 Ga0070711_100113540
341 Ga0070663_100001196
342 Ga0070663_100167451
343 Ga0070662_100000001
344 Ga0070662_100394291
345 Ga0070685_10000191
346 Ga0070685_10270517
347 Ga0070679_100001834
348 Ga0070684_100005142
349 Ga0070684_100016405
350 Ga0070684_100747045
351 Ga0070693_100003939
352 Ga0070665_100009217
353 Ga0070665_100010578
354 Ga0070665_100630396
355 Ga0068855_100150905
356 Ga0068854_100000267
357 Ga0068856_100001040
358 Ga0068856_100006944
359 Ga0068852_100000132
360 Ga0068852_100009749
361 Ga0068864_100000024
362 Ga0068861_100183387
363 Ga0068851_10000258
364 Ga0068851_10001500
365 Ga0068862_100004764
366 Ga0081455_10119587
367 Ga0081540_1000181
368 Ga0075363_100147223
369 Ga0068871_100097042
370 Ga0075431_100018190
371 Ga0075433_10006968
372 Ga0075434_100112121
373 Ga0068865_100000039
374 Ga0105245_10002902
375 Ga0105247_10000369
376 Ga0105247_10193839
377 Ga0105243_10009809
378 Ga0105242_10001159
379 Ga0105242_10004215
380 Ga0105248_10000017
381 Ga0105238_10134353
382 Ga0105249_10053767
383 Ga0105239_10175629
384 Ga0105239_10218822
385 Ga0105246_10566459
386 Ga0157371_10006241
387 Ga0157370_10002517
388 Ga0157369_10000803
389 Ga0157378_10219240
390 Ga0163162_10299810
391 Ga0157372_10000407
392 Ga0157375_10001906
393 Ga0157375_10072166
394 Ga0157375_11152570
395 Ga0157379_10183236
396 Ga0163161_10000103
397 Ga0207656_10000279
398 Ga0207656_10067048
399 Ga0207710_10000227
400 Ga0207680_10021847
401 Ga0207680_10151765
402 Ga0207693_10010235
403 Ga0207663_10120193
404 Ga0207649_10000015
405 Ga0207652_10000513
406 Ga0207694_10151185
407 Ga0207687_10000025
408 Ga0207687_10001391
409 Ga0207700_10000019
410 Ga0207664_10062896
411 Ga0207690_10020960
412 Ga0207706_10000003
413 Ga0207686_10000035
414 Ga0207686_10022682
415 Ga0207709_10005656
416 Ga0207669_10077449
417 Ga0207704_10000165
418 Ga0207691_10000286
419 Ga0207711_10000011
420 Ga0207661_10000545
421 Ga0207661_10001203
422 Ga0207661_10064362
423 Ga0207661_10262793
424 Ga0207679_10100804
425 Ga0207667_10131618
426 Ga0207668_10016227
427 Ga0207658_10006639
428 Ga0207658_10071087
429 Ga0207658_10148442
430 Ga0207677_10000163
431 Ga0207677_10001061
432 Ga0207639_10054317
433 Ga0207678_10002590
434 Ga0207678_10365997
435 Ga0207702_10000349
436 Ga0207702_10044730
437 Ga0207641_10002521
438 Ga0207641_10587622
439 Ga0207676_10000048
440 Ga0207675_100218416
441 Ga0207683_10190878
442 Ga0207698_10000014
443 Ga0207698_10014780
444 Ga0268266_10000369
445 Ga0268266_10009239
446 Ga0268266_10641789
447 Ga0268265_10098167
448 Ga0268264_10061575
449 Ga0265337_1000060
450 Ga0265326_10000056
451 Ga0265319_1000037
452 Ga0265322_10000017
453 Ga0265336_10003958
454 Ga0265338_10000051
455 Ga0265328_10000258
456 Ga0265320_10000068
457 Ga0265325_10024342
458 Ga0265329_10007182
459 Ga0265339_10072518
460 Ga0265331_10000606
461 Ga0265327_10000317
462 Ga0265314_10000973
463 Ga0265342_10028625
464 Ga0373954_0250599
465 Ga0451853_0880571
466 Ga0466963_0009227
467 Ga0466963_0014072
468 Ga0466957_0027884
469 Ga0466967_0000013
470 Ga0466967_0471954
471 Ga0495629_0000201
472 Ga0495629_0008550
473 Ga0495629_0053857
474 Ga0495629_0156269
475 Ga0495651_0129850
476 Ga0495651_0175032
477 Ga0495653_0015647
478 Ga0495653_0270435
479 Ga0495664_0214803
480 Ga0495594_0000001
481 Ga0495608_0000042
482 Ga0495608_0002177
483 Ga0495610_0049855
484 Ga0495618_0000051
485 Ga0495628_0152053
486 Ga0495630_0006964
487 Ga0495644_0075026
488 Ga0495652_0007230
489 Ga0495587_0011085
490 Ga0495645_0059636
491 Ga0495645_0096347
492 Ga0495645_0368895
493 Ga0495622_0000033
494 Ga0495667_0397829
495 Ga0495634_0000050
496 Ga0495634_0019613
497 Ga0495634_0195048
498 Ga0495588_0000204
499 Ga0495657_0000040
500 Ga0495657_0001105
501 Ga0495647_0000549
502 Ga0495658_0000001
503 Ga0495658_0026703
504 Ga0495613_0000067
505 Ga0495613_0000155
506 Ga0495624_0000031
507 Ga0495624_0144355
508 Ga0495670_0007376
509 Ga0495600_0000376
510 Ga0495600_0000973
511 Ga0495600_0098966
512 Ga0495604_0016905
513 Ga0495674_0000024
514 Ga0495676_0004042
515 Ga0495680_0006169
516 Ga0495680_0088592
517 Ga0495680_0141202
518 Ga0495675_0000036
519 Ga0495675_0026910
520 Ga0495685_026729
521 Ga0495686_0041061
522 Ga0495593_0156147
523 Ga0495602_0000268
524 Ga0495602_0031787
525 Ga0495602_0060096
526 Ga0495602_0395529
527 Ga0496100_0000019
528 Ga0496101_0000005
529 Ga0496101_0290036
530 Ga0496102_0000021
531 Ga0496102_0059006
532 Ga0496103_0000001
533 Ga0496103_0195526
534 Ga0496104_0099432
535 Ga0496105_0000002
536 Ga0496105_0000900
537 Ga0496105_0318520
538 Ga0496106_0000033
539 Ga0496106_0575038
540 Ga0496107_0000004
541 Ga0496108_0000239
542 Ga0496108_0007751
543 Ga0496108_0504342
544 Ga0496109_0000011
545 Ga0496109_0000034
546 Ga0496109_0087074
547 Ga0496109_0168950
548 Ga0496111_0000020
549 Ga0496111_0103752
550 Ga0496111_0112664
551 Ga0496112_0000641
552 Ga0496113_0000002
553 Ga0496113_0001044
554 Ga0496113_0133551
555 Ga0496113_0159907
556 Ga0496114_0062040
557 Ga0496115_0000022
558 Ga0496115_0059140
559 Ga0496116_0000138
560 Ga0496117_0002715
561 Ga0496118_0005655
562 Ga0496119_0004108
563 Ga0496119_0005578
564 Ga0496119_0015712
565 Ga0496119_0032537
566 Ga0496119_0086856
567 Ga0496120_0001479
568 Ga0496120_0041605
569 Ga0496121_0019534
570 Ga0496121_0028618
571 Ga0496121_0038016
572 Ga0496121_0188172
573 Ga0496124_0030468
574 Ga0496124_0327489
575 Ga0496125_0025447
576 Ga0496125_0038395
577 Ga0496125_0181459
578 Ga0496126_0012060
579 Ga0496126_0019445
580 Ga0496126_0133432
581 Ga0501031_0003106
582 Ga0501032_0001727
583 Ga0501033_0001690
584 Ga0501034_0009478
585 Ga0501034_0451002
586 Ga0501036_0001272
587 Ga0501037_0001236
588 Ga0501038_0010265
589 Ga0501040_0024987
590 Ga0501042_0004801
591 Ga0501043_0001769
592 Ga0501043_0188668
593 Ga0501046_0002090
594 Ga0501047_0007106
595 Ga0501047_0027884
596 Ga0501047_0047141
597 Ga0501047_0238094
598 Ga0501047_0401956
599 Ga0501048_0001315
600 Ga0501067_0032753
601 Ga0501068_0006444
602 Ga0501069_0006122
603 Ga0501069_0017773
604 Ga0501070_0002097
605 Ga0501070_0197417
606 Ga0501071_0021920
607 Ga0501071_0173344
608 Ga0501072_0294986
609 Ga0501073_0001857
610 Ga0501074_0010325
611 Ga0501074_0037754
612 Ga0501074_0135106
613 Ga0501079_0007755
614 Ga0501079_0046739
615 Ga0501080_0023429
616 Ga0501080_0024705
617 Ga0501080_0724377
618 Ga0501081_0040522
619 Ga0501083_0003852
620 Ga0501083_0011140
621 Ga0501083_0012682
622 Ga0501035_0000614
623 Ga0501035_0235336
624 Ga0501044_0008924
625 Ga0501044_0121748
626 Ga0501045_0020792
627 nmdc:mga03n38_138526_c1
628 nmdc:mga06r32_98922_c1
629 nmdc:mga0a205_1_c2
630 Ga0495601_0000019
631 Ga0495601_0172589
632 Ga0495612_0000208
633 Ga0495612_0003950
634 Ga0495655_0000008
635 Ga0495595_0000009
636 Ga0495595_0003003
637 Ga0495619_0000057
638 Ga0495619_0118004
639 Ga0500566_0008561
640 Ga0500628_000023
641 Ga0501084_0081550
642 Ga0501082_0016254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

94

213

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qcl-assembly1.cif.gz_A citryl-coa lyase core module of chlorobium limicola atp citrate lyase in complex with acetyl-coa and l-malate 0.4007 64 207
6qcl-assembly1.cif.gz_A citryl-coa lyase core module of chlorobium limicola atp citrate lyase in complex with acetyl-coa and l-malate 0.2984 64 207
4huq-assembly1.cif.gz_S crystal structure of a transporter 0.2886 64 216
4huq-assembly1.cif.gz_S crystal structure of a transporter 0.2699 64 216
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.264 64 225
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7384 81 196 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7056 81 196 1.10.1760.20
af_I1LJ83_112_274_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3245 15 223 1.20.1250.20
af_A0A1D6MC51_708_938_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.3238 65 185 3.10.110.10
af_O17926_26_276_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3044 28 232 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A640Y8Z8-F1-model_v4 TVP38/TMEM64 family membrane protein 0.9416 15 229 GO:0005886
AF-A0A2T4UIE1-F1-model_v4 TVP38/TMEM64 family membrane protein 0.8962 1 228 GO:0005886
AF-H0E1G3-F1-model_v4 TVP38/TMEM64 family membrane protein 0.8889 10 228 GO:0005886
AF-A0A7V9AET0-F1-model_v4 TVP38/TMEM64 family membrane protein 0.8789 12 224 GO:0005886
AF-A0A640Y8Z8-F1-model_v4 TVP38/TMEM64 family membrane protein 0.8641 15 229 GO:0005886

Map