F405793

General Info

Members Datasets Scaffolds Average Seq Length
321 193 302 204

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10040595|JGI24739J22299_100405952
Length 219
Sequence MPQDRHLTLFHSPRSRSAGARMLLEELGADYELHAFDLSTGKHHEADYLAINPLGKVPALRHGDVIVTEQPAVYLYAAELYPEAGLSPAPGDALRGPYLRWMTFYGSCFEPAIVDRSMNRPPAAYSTSPYGDFDAVINALDAQLAKGPYLLGERFTAADVLWGAALNWTTMFKLIPETPRIRAYIDRILARPAIQRAQAADAALAEEQDKAKEAAATAR

Samples

Sample ID Description Type Environment
1 2519103095 Burkholderia sp. KJ006 Isolate Nodule
2 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
3 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
4 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
5 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
6 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
7 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
8 2818991452 Burkholderia cepacia 561 Isolate Unclassified
9 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
10 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
11 2928163908 Burkholderia sp. 567 Isolate Unclassified
12 2928170801 Burkholderia sp. 572 Isolate Unclassified
13 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
184 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
189 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
190 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
191 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
192 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
193 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.46
Metatranscriptomes 0.62
Isolates 5.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 0.31
Rhizoplane 1.25
Rhizosphere 81.31
Stem 0
Stem Tuber 0
Unclassified 8.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10040595 3300001989 Bacteria 1552
2 rootH2_10018518 3300003320 Bacteria 6999
3 rootH2_10037823 3300003320 Bacteria 1039
4 Ga0055532_1000270 3300003758 Bacteria 33945
5 Ga0055532_1000345 3300003758 Bacteria 25200
6 Ga0055532_1000976 3300003758 Bacteria 9128
7 Ga0055527_1000216 3300003760 Bacteria 37363
8 Ga0055535_1000512 3300003761 Bacteria 33945
9 Ga0055535_1001830 3300003761 Bacteria 9128
10 Ga0055542_1001562 3300003762 Bacteria 10761
11 Ga0055529_1001267 3300003763 Bacteria 9128
12 Ga0055529_1003044 3300003763 Bacteria 2932
13 Ga0055541_1008466 3300003841 Bacteria 1637
14 Ga0070658_10019544 3300005327 Bacteria 5424
15 Ga0070658_10074259 3300005327 Bacteria 2788
16 Ga0070676_10074640 3300005328 Bacteria 2043
17 Ga0070666_10002220 3300005335 Bacteria 11744
18 Ga0070660_100000112 3300005339 Bacteria 50685
19 Ga0070661_100104755 3300005344 Bacteria 2108
20 Ga0070659_100000020 3300005366 Bacteria 155952
21 Ga0070659_100004923 3300005366 Bacteria 9553
22 Ga0070659_100423809 3300005366 Bacteria 1126
23 Ga0070709_10016455 3300005434 Bacteria 4223
24 Ga0070714_100190189 3300005435 Bacteria 1873
25 Ga0070714_100374158 3300005435 Bacteria 1342
26 Ga0070713_100000001 3300005436 Bacteria 257984
27 Ga0070713_100045207 3300005436 Bacteria 3607
28 Ga0070710_10075254 3300005437 Bacteria 1956
29 Ga0070711_100029168 3300005439 Bacteria 3638
30 Ga0070663_100047513 3300005455 Bacteria 3040
31 Ga0070681_10116472 3300005458 Bacteria 2609
32 Ga0070681_10155150 3300005458 Bacteria 2215
33 Ga0070681_10832969 3300005458 Unclassified 840
34 Ga0068853_100001987 3300005539 Bacteria 15095
35 Ga0068853_100014966 3300005539 Bacteria 6372
36 Ga0068853_100254750 3300005539 Bacteria 1612
37 Ga0070695_100017839 3300005545 Bacteria 4307
38 Ga0070693_100157126 3300005547 Bacteria 1445
39 Ga0070693_100538304 3300005547 Unclassified 834
40 Ga0070665_100064157 3300005548 Bacteria 3683
41 Ga0070665_100163058 3300005548 Bacteria 2231
42 Ga0068855_100044256 3300005563 Bacteria 5269
43 Ga0068855_100051348 3300005563 Bacteria 4857
44 Ga0068855_100098521 3300005563 Bacteria 3367
45 Ga0068855_100325369 3300005563 Bacteria 1698
46 Ga0068857_100001780 3300005577 Bacteria 17332
47 Ga0068857_100250449 3300005577 Bacteria 1624
48 Ga0068854_100004056 3300005578 Bacteria 9197
49 Ga0068854_100115189 3300005578 Bacteria 2033
50 Ga0068854_100162860 3300005578 Bacteria 1729
51 Ga0068856_100000945 3300005614 Bacteria 31113
52 Ga0068856_100780535 3300005614 Bacteria 975
53 Ga0068852_100015939 3300005616 Bacteria 5848
54 Ga0068870_10412083 3300005840 Bacteria 882
55 Ga0068858_100057575 3300005842 Bacteria 3592
56 Ga0070716_100059359 3300006173 Bacteria 2205
57 Ga0070712_100000051 3300006175 Bacteria 62931
58 Ga0070712_100000572 3300006175 Bacteria 21422
59 Ga0097621_100088958 3300006237 Bacteria 2581
60 Ga0068871_100299631 3300006358 Bacteria 1411
61 Ga0068871_100931909 3300006358 Bacteria 806
62 Ga0075436_100000166 3300006914 Bacteria 41286
63 Ga0075436_100060016 3300006914 Bacteria 2627
64 Ga0075436_100475929 3300006914 Bacteria 912
65 Ga0075435_100071979 3300007076 Bacteria 2824
66 Ga0105250_10009828 3300009092 Bacteria 4017
67 Ga0105240_10003381 3300009093 Bacteria 24804
68 Ga0105240_10012230 3300009093 Bacteria 11864
69 Ga0105240_10021034 3300009093 Bacteria 8684
70 Ga0105240_10075847 3300009093 Bacteria 4146
71 Ga0105240_10097151 3300009093 Bacteria 3589
72 Ga0105240_10130383 3300009093 Bacteria 3017
73 Ga0105241_10079701 3300009174 Bacteria 2561
74 Ga0105241_10080622 3300009174 Unclassified 2548
75 Ga0105241_10813539 3300009174 Bacteria 862
76 Ga0105241_10862033 3300009174 Bacteria 838
77 Ga0105242_10026770 3300009176 Bacteria 4573
78 Ga0105237_10039035 3300009545 Bacteria 4794
79 Ga0105237_10279500 3300009545 Bacteria 1672
80 Ga0105237_10396940 3300009545 Bacteria 1384
81 Ga0105238_10004523 3300009551 Bacteria 13777
82 Ga0105238_10190800 3300009551 Bacteria 2025
83 Ga0105238_10281465 3300009551 Bacteria 1644
84 Ga0105239_10018340 3300010375 Bacteria 7737
85 Ga0105239_10122427 3300010375 Bacteria 2890
86 Ga0105239_10209698 3300010375 Bacteria 2184
87 Ga0105239_10260051 3300010375 Bacteria 1950
88 Ga0105239_10260964 3300010375 Bacteria 1947
89 Ga0105239_10664291 3300010375 Bacteria 1191
90 Ga0157373_10007369 3300013100 Bacteria 8187
91 Ga0157373_10386184 3300013100 Bacteria 1002
92 Ga0157370_10011089 3300013104 Bacteria 9448
93 Ga0157370_10017311 3300013104 Bacteria 7276
94 Ga0157369_10018399 3300013105 Bacteria 7835
95 Ga0157369_10023950 3300013105 Bacteria 6794
96 Ga0157369_10233527 3300013105 Bacteria 1922
97 Ga0157369_10836562 3300013105 Bacteria 945
98 Ga0157374_10163174 3300013296 Unclassified 2171
99 Ga0157378_11259041 3300013297 Unclassified 780
100 Ga0157378_11591856 3300013297 Bacteria 699
101 Ga0163162_10408052 3300013306 Unclassified 1491
102 Ga0157372_10047732 3300013307 Bacteria 4759
103 Ga0157372_10818113 3300013307 Bacteria 1082
104 Ga0163163_10447825 3300014325 Bacteria 1351
105 Ga0157379_10000442 3300014968 Bacteria 33636
106 Ga0157379_10021079 3300014968 Bacteria 5767
107 Ga0157379_10250561 3300014968 Bacteria 1608
108 Ga0182007_10016347 3300015262 Bacteria 2739
109 Ga0182005_1002667 3300015265 Bacteria 6283
110 Ga0163161_10227941 3300017792 Bacteria 1445
111 Ga0206351_10321852 3300020077 Bacteria 1420
112 Ga0154015_1578908 3300020610 Bacteria 8087
113 Ga0213873_10008531 3300021358 Bacteria 2097
114 Ga0213872_10143699 3300021361 Bacteria 1046
115 Ga0213876_10000345 3300021384 Bacteria 40189
116 Ga0209566_100089 3300025225 Bacteria 142951
117 Ga0209566_104455 3300025225 Bacteria 1910
118 Ga0209674_102569 3300025226 Bacteria 3805
119 Ga0209672_100012 3300025228 Bacteria 795742
120 Ga0209672_107091 3300025228 Bacteria 1759
121 Ga0209147_100007 3300025229 Bacteria 795684
122 Ga0209147_100149 3300025229 Bacteria 102676
123 Ga0209147_100414 3300025229 Bacteria 28331
124 Ga0209563_110291 3300025230 Bacteria 1371
125 Ga0209258_100014 3300025242 Bacteria 720132
126 Ga0209258_100618 3300025242 Bacteria 28331
127 Ga0209148_1000745 3300025254 Bacteria 25089
128 Ga0209148_1002976 3300025254 Bacteria 5090
129 Ga0209759_1008683 3300025256 Bacteria 3144
130 Ga0209759_1009952 3300025256 Bacteria 2832
131 Ga0209455_1000269 3300025272 Bacteria 58101
132 Ga0209455_1000501 3300025272 Bacteria 28331
133 Ga0207680_10004040 3300025903 Bacteria 6933
134 Ga0207647_10316397 3300025904 Bacteria 887
135 Ga0207699_10000116 3300025906 Bacteria 56075
136 Ga0207705_10018955 3300025909 Bacteria 4921
137 Ga0207705_10052709 3300025909 Bacteria 2930
138 Ga0207654_10525008 3300025911 Bacteria 838
139 Ga0207707_10110194 3300025912 Bacteria 2406
140 Ga0207707_10221199 3300025912 Unclassified 1648
141 Ga0207707_10459832 3300025912 Bacteria 1088
142 Ga0207695_10008712 3300025913 Bacteria 12650
143 Ga0207695_10011527 3300025913 Bacteria 10697
144 Ga0207695_10013124 3300025913 Bacteria 9890
145 Ga0207695_10043087 3300025913 Bacteria 4813
146 Ga0207695_10043124 3300025913 Bacteria 4811
147 Ga0207695_10157491 3300025913 Bacteria 2205
148 Ga0207671_10018622 3300025914 Bacteria 5321
149 Ga0207671_10033517 3300025914 Bacteria 3820
150 Ga0207671_10097720 3300025914 Bacteria 2220
151 Ga0207671_10144473 3300025914 Bacteria 1835
152 Ga0207693_10000052 3300025915 Bacteria 98125
153 Ga0207693_10001911 3300025915 Bacteria 18229
154 Ga0207663_10007920 3300025916 Bacteria 5543
155 Ga0207663_10872452 3300025916 Bacteria 719
156 Ga0207657_10000338 3300025919 Bacteria 49545
157 Ga0207700_10036179 3300025928 Bacteria 3563
158 Ga0207664_10906751 3300025929 Unclassified 791
159 Ga0207690_10000011 3300025932 Bacteria 295252
160 Ga0207690_10008346 3300025932 Bacteria 6148
161 Ga0207686_10008217 3300025934 Bacteria 5631
162 Ga0207679_10507449 3300025945 Unclassified 1077
163 Ga0207667_10003084 3300025949 Bacteria 20648
164 Ga0207667_10023012 3300025949 Bacteria 6868
165 Ga0207667_10114009 3300025949 Bacteria 2786
166 Ga0207667_10268381 3300025949 Bacteria 1744
167 Ga0207640_10000946 3300025981 Bacteria 16207
168 Ga0207703_10550602 3300026035 Bacteria 1088
169 Ga0207639_10023846 3300026041 Bacteria 4422
170 Ga0207639_10342599 3300026041 Bacteria 1333
171 Ga0207678_10001890 3300026067 Bacteria 19107
172 Ga0207702_10000011 3300026078 Bacteria 284514
173 Ga0207702_10001087 3300026078 Bacteria 27813
174 Ga0207702_10871253 3300026078 Bacteria 892
175 Ga0207674_10000002 3300026116 Bacteria 279738
176 Ga0207674_10200148 3300026116 Bacteria 1947
177 Ga0207674_10240308 3300026116 Bacteria 1758
178 Ga0207698_10035161 3300026142 Bacteria 3662
179 Ga0268266_10127035 3300028379 Bacteria 2277
180 Ga0268266_10176713 3300028379 Bacteria 1941
181 Ga0268266_10339158 3300028379 Bacteria 1410
182 Ga0265318_10000025 3300028577 Bacteria 159237
183 Ga0265322_10071389 3300028654 Bacteria 985
184 Ga0265338_10006089 3300028800 Bacteria 15492
185 Ga0265338_10061372 3300028800 Bacteria 3295
186 Ga0265330_10008943 3300031235 Bacteria 4783
187 Ga0265332_10000392 3300031238 Bacteria 31919
188 Ga0265328_10000085 3300031239 Bacteria 48380
189 Ga0265328_10013604 3300031239 Bacteria 3218
190 Ga0265328_10018930 3300031239 Bacteria 2649
191 Ga0265320_10002137 3300031240 Bacteria 13864
192 Ga0265320_10007737 3300031240 Bacteria 6641
193 Ga0265325_10000454 3300031241 Bacteria 29581
194 Ga0265325_10003265 3300031241 Bacteria 10660
195 Ga0265325_10013138 3300031241 Bacteria 4719
196 Ga0265329_10009638 3300031242 Bacteria 3589
197 Ga0265340_10018508 3300031247 Bacteria 3592
198 Ga0265340_10056365 3300031247 Bacteria 1890
199 Ga0265339_10011077 3300031249 Bacteria 5569
200 Ga0265339_10063198 3300031249 Bacteria 1989
201 Ga0265339_10076733 3300031249 Bacteria 1771
202 Ga0265331_10000091 3300031250 Bacteria 123475
203 Ga0265327_10043092 3300031251 Bacteria 2417
204 Ga0265327_10141898 3300031251 Bacteria 1122
205 Ga0265316_10000006 3300031344 Bacteria 289686
206 Ga0265316_10065824 3300031344 Bacteria 2806
207 Ga0265316_10078691 3300031344 Unclassified 2531
208 Ga0265316_10080645 3300031344 Bacteria 2495
209 Ga0265313_10001574 3300031595 Bacteria 21173
210 Ga0265314_10000056 3300031711 Bacteria 171647
211 Ga0265314_10007961 3300031711 Bacteria 9140
212 Ga0265314_10023241 3300031711 Bacteria 4732
213 Ga0265314_10147130 3300031711 Bacteria 1450
214 Ga0265314_10261368 3300031711 Bacteria 988
215 Ga0265342_10010588 3300031712 Bacteria 6380
216 Ga0265342_10044452 3300031712 Bacteria 2677
217 Ga0373934_0223373 3300035086 Unclassified 777
218 Ga0373923_0091991 3300035111 Bacteria 1328
219 Ga0373945_0099251 3300035116 Bacteria 1138
220 Ga0373956_0027688 3300035119 Bacteria 2463
221 Ga0373955_0095613 3300035172 Bacteria 1699
222 Ga0373931_0001844 3300035691 Bacteria 9221
223 Ga0373935_0045247 3300035692 Bacteria 2777
224 Ga0373933_0108741 3300035724 Bacteria 1727
225 Ga0373933_0292285 3300035724 Bacteria 1054
226 Ga0373937_0005420 3300036401 Bacteria 10917
227 Ga0373937_0035641 3300036401 Bacteria 4530
228 Ga0373937_0245840 3300036401 Bacteria 1686
229 Ga0373937_0517066 3300036401 Bacteria 1134
230 Ga0373925_0259049 3300037068 Unclassified 1397
231 Ga0395900_0000015 3300037418 Bacteria 384313
232 Ga0395900_0132835 3300037418 Bacteria 2550
233 Ga0395900_0162401 3300037418 Bacteria 2278
234 Ga0395898_0092849 3300037466 Bacteria 2902
235 Ga0436364_0680739 3300037853 Bacteria 1507
236 Ga0395901_0039650 3300038443 Bacteria 4875
237 Ga0436365_0210722 3300039437 Bacteria 3779
238 Ga0436365_1541345 3300039437 Bacteria 20116
239 Ga0436361_0359572 3300039447 Bacteria 2021
240 Ga0436362_0740156 3300039453 Bacteria 2632
241 Ga0466986_0020770 3300044650 Bacteria 4331
242 Ga0466957_0010211 3300044842 Bacteria 5378
243 Ga0466959_0058668 3300045049 Bacteria 2803
244 Ga0466967_0998882 3300045976 Bacteria 833
245 Ga0495629_0015346 3300046459 Bacteria 5501
246 Ga0495665_0365400 3300046531 Bacteria 734
247 Ga0495587_0011297 3300046536 Bacteria 5660
248 Ga0495581_0024576 3300047315 Bacteria 3492
249 Ga0495604_0438135 3300047317 Bacteria 855
250 Ga0495674_0151222 3300047319 Bacteria 1946
251 Ga0495672_0000374 3300047320 Bacteria 55795
252 Ga0495672_0357493 3300047320 Bacteria 677
253 Ga0495680_0195178 3300047322 Bacteria 1455
254 Ga0495680_0430526 3300047322 Bacteria 906
255 Ga0495675_0079999 3300047444 Bacteria 2058
256 Ga0495675_0237988 3300047444 Bacteria 1097
257 Ga0495593_0005445 3300047673 Bacteria 7521
258 Ga0495602_0148214 3300048088 Bacteria 1848
259 Ga0495602_0535439 3300048088 Unclassified 814
260 Ga0495602_0658917 3300048088 Unclassified 714
261 Ga0495614_0016498 3300048089 Bacteria 3214
262 Ga0496101_0414020 3300048904 Bacteria 1062
263 Ga0496112_0240241 3300048915 Bacteria 1764
264 Ga0496116_0166302 3300048919 Bacteria 1202
265 Ga0496117_0083001 3300048920 Bacteria 2096
266 Ga0496117_0156762 3300048920 Bacteria 1339
267 Ga0496118_0045048 3300048921 Bacteria 3448
268 Ga0496118_0068143 3300048921 Bacteria 2586
269 Ga0496118_0179434 3300048921 Bacteria 1281
270 Ga0496121_0009997 3300048924 Bacteria 10787
271 Ga0496122_0209094 3300048925 Bacteria 1132
272 Ga0496124_0053723 3300048927 Bacteria 3413
273 Ga0496125_0091851 3300048928 Bacteria 2272
274 Ga0496126_0000452 3300048929 Bacteria 81928
275 Ga0501033_0178908 3300049570 Bacteria 1521
276 Ga0501033_0405436 3300049570 Bacteria 950
277 Ga0501036_0012532 3300049572 Bacteria 7031
278 Ga0501037_0076986 3300049573 Bacteria 2421
279 Ga0501037_0079123 3300049573 Bacteria 2386
280 Ga0501038_0082018 3300049574 Bacteria 2716
281 Ga0501038_0284288 3300049574 Bacteria 1301
282 Ga0501047_0226996 3300049581 Bacteria 1722
283 Ga0501069_0275756 3300049585 Bacteria 983
284 Ga0501070_0000025 3300049586 Bacteria 152175
285 Ga0501074_0487256 3300049590 Bacteria 874
286 Ga0501080_0018708 3300049742 Bacteria 6411
287 Ga0501035_0000712 3300049822 Bacteria 35996
288 Ga0501035_0017914 3300049822 Bacteria 6532
289 Ga0501035_0255252 3300049822 Bacteria 1488
290 Ga0501044_0001321 3300049823 Bacteria 29184
291 Ga0501044_0033120 3300049823 Bacteria 5430
292 Ga0501044_0038745 3300049823 Bacteria 4976
293 nmdc:mga0rr50_52690_c1 3300050513 Bacteria 3024
294 nmdc:mga0rr50_61013_c1 3300050513 Bacteria 2839
295 nmdc:mga08x19_50437_c1 3300050514 Bacteria 2671
296 nmdc:mga08x19_86_c1 3300050514 Bacteria 83486
297 nmdc:mga08x19_88932_c1 3300050514 Bacteria 2036
298 Ga0500643_000008 3300053087 Bacteria 457931
299 Ga0500555_049295 3300053103 Bacteria 1155
300 Ga0500568_0020710 3300053139 Bacteria 2841
301 Ga0501084_0666418 3300054114 Bacteria 878
302 Ga0501082_0003835 3300060353 Bacteria 13147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0099251 Ga0373945_0099251_611_1120 165
2 3300005366 Ga0070659_100423809 Ga0070659_1004238093 174
3 3300047317 Ga0495604_0438135 Ga0495604_0438135_303_845 176
4 3300046531 Ga0495665_0365400 Ga0495665_0365400_36_590 180
5 3300048088 Ga0495602_0658917 Ga0495602_0658917_125_679 180
6 3300003320 rootH2_10037823 rootH2_100378232 185
7 3300013296 Ga0157374_10163174 Ga0157374_101631742 186
8 3300005578 Ga0068854_100115189 Ga0068854_1001151895 193
9 3300017792 Ga0163161_10227941 Ga0163161_102279411 193
10 3300047320 Ga0495672_0000374 Ga0495672_0000374_13171_13764 193
11 3300005328 Ga0070676_10074640 Ga0070676_100746403 194
12 3300005458 Ga0070681_10116472 Ga0070681_101164722 194
13 3300005458 Ga0070681_10155150 Ga0070681_101551503 194
14 3300005539 Ga0068853_100254750 Ga0068853_1002547501 194
15 3300005548 Ga0070665_100163058 Ga0070665_1001630583 194
16 3300005577 Ga0068857_100250449 Ga0068857_1002504493 194
17 3300009093 Ga0105240_10003381 Ga0105240_100033818 194
18 3300009093 Ga0105240_10075847 Ga0105240_100758474 194
19 3300009174 Ga0105241_10813539 Ga0105241_108135391 194
20 3300009545 Ga0105237_10396940 Ga0105237_103969403 194
21 3300009551 Ga0105238_10190800 Ga0105238_101908003 194
22 3300010375 Ga0105239_10122427 Ga0105239_101224274 194
23 3300010375 Ga0105239_10209698 Ga0105239_102096981 194
24 3300013297 Ga0157378_11591856 Ga0157378_115918561 194
25 3300021361 Ga0213872_10143699 Ga0213872_101436992 194
26 3300025912 Ga0207707_10221199 Ga0207707_102211992 194
27 3300025912 Ga0207707_10459832 Ga0207707_104598322 194
28 3300025913 Ga0207695_10008712 Ga0207695_100087123 194
29 3300025913 Ga0207695_10157491 Ga0207695_101574913 194
30 3300025914 Ga0207671_10097720 Ga0207671_100977201 194
31 3300026041 Ga0207639_10342599 Ga0207639_103425992 194
32 3300026116 Ga0207674_10200148 Ga0207674_102001483 194
33 3300028379 Ga0268266_10176713 Ga0268266_101767133 194
34 3300028379 Ga0268266_10339158 Ga0268266_103391583 194
35 3300028654 Ga0265322_10071389 Ga0265322_100713892 194
36 3300031235 Ga0265330_10008943 Ga0265330_100089432 194
37 3300031238 Ga0265332_10000392 Ga0265332_1000039214 194
38 3300031239 Ga0265328_10013604 Ga0265328_100136043 194
39 3300031240 Ga0265320_10007737 Ga0265320_100077375 194
40 3300031242 Ga0265329_10009638 Ga0265329_100096381 194
41 3300031250 Ga0265331_10000091 Ga0265331_1000009144 194
42 3300031251 Ga0265327_10141898 Ga0265327_101418982 194
43 3300031344 Ga0265316_10000006 Ga0265316_1000000668 194
44 3300031344 Ga0265316_10078691 Ga0265316_100786913 194
45 3300031711 Ga0265314_10000056 Ga0265314_10000056141 194
46 3300031711 Ga0265314_10147130 Ga0265314_101471303 194
47 3300031712 Ga0265342_10010588 Ga0265342_100105886 194
48 3300037418 Ga0395900_0162401 Ga0395900_0162401_1284_1880 194
49 3300037466 Ga0395898_0092849 Ga0395898_0092849_545_1141 194
50 3300038443 Ga0395901_0039650 Ga0395901_0039650_248_844 194
51 3300039447 Ga0436361_0359572 Ga0436361_0359572_1160_1756 194
52 3300046536 Ga0495587_0011297 Ga0495587_0011297_3697_4293 194
53 3300047320 Ga0495672_0357493 Ga0495672_0357493_16_612 194
54 3300047444 Ga0495675_0237988 Ga0495675_0237988_385_975 194
55 3300049822 Ga0501035_0255252 Ga0501035_0255252_280_876 194
56 3300053103 Ga0500555_049295 Ga0500555_049295_56_652 194
57 3300005434 Ga0070709_10016455 Ga0070709_100164554 195
58 3300005435 Ga0070714_100190189 Ga0070714_1001901892 195
59 3300005435 Ga0070714_100374158 Ga0070714_1003741581 195
60 3300005436 Ga0070713_100000001 Ga0070713_10000000134 195
61 3300005436 Ga0070713_100045207 Ga0070713_1000452073 195
62 3300005437 Ga0070710_10075254 Ga0070710_100752541 195
63 3300005439 Ga0070711_100029168 Ga0070711_1000291684 195
64 3300005458 Ga0070681_10832969 Ga0070681_108329691 195
65 3300005539 Ga0068853_100014966 Ga0068853_1000149667 195
66 3300005545 Ga0070695_100017839 Ga0070695_1000178393 195
67 3300005547 Ga0070693_100157126 Ga0070693_1001571262 195
68 3300005547 Ga0070693_100538304 Ga0070693_1005383041 195
69 3300005563 Ga0068855_100044256 Ga0068855_1000442564 195
70 3300005577 Ga0068857_100001780 Ga0068857_1000017808 195
71 3300005578 Ga0068854_100162860 Ga0068854_1001628602 195
72 3300005614 Ga0068856_100000945 Ga0068856_1000009457 195
73 3300005614 Ga0068856_100780535 Ga0068856_1007805352 195
74 3300005616 Ga0068852_100015939 Ga0068852_1000159396 195
75 3300005842 Ga0068858_100057575 Ga0068858_1000575752 195
76 3300006173 Ga0070716_100059359 Ga0070716_1000593593 195
77 3300006175 Ga0070712_100000051 Ga0070712_10000005134 195
78 3300006175 Ga0070712_100000572 Ga0070712_1000005725 195
79 3300006237 Ga0097621_100088958 Ga0097621_1000889581 195
80 3300006358 Ga0068871_100299631 Ga0068871_1002996312 195
81 3300006358 Ga0068871_100931909 Ga0068871_1009319091 195
82 3300006914 Ga0075436_100000166 Ga0075436_10000016641 195
83 3300006914 Ga0075436_100060016 Ga0075436_1000600163 195
84 3300006914 Ga0075436_100475929 Ga0075436_1004759292 195
85 3300007076 Ga0075435_100071979 Ga0075435_1000719794 195
86 3300009093 Ga0105240_10021034 Ga0105240_100210347 195
87 3300009174 Ga0105241_10079701 Ga0105241_100797013 195
88 3300009174 Ga0105241_10080622 Ga0105241_100806224 195
89 3300009174 Ga0105241_10862033 Ga0105241_108620332 195
90 3300009545 Ga0105237_10039035 Ga0105237_100390354 195
91 3300009551 Ga0105238_10004523 Ga0105238_100045236 195
92 3300009551 Ga0105238_10281465 Ga0105238_102814653 195
93 3300010375 Ga0105239_10018340 Ga0105239_100183409 195
94 3300013100 Ga0157373_10007369 Ga0157373_100073694 195
95 3300013104 Ga0157370_10011089 Ga0157370_100110896 195
96 3300013105 Ga0157369_10018399 Ga0157369_100183999 195
97 3300013297 Ga0157378_11259041 Ga0157378_112590412 195
98 3300013306 Ga0163162_10408052 Ga0163162_104080521 195
99 3300013307 Ga0157372_10047732 Ga0157372_100477323 195
100 3300014325 Ga0163163_10447825 Ga0163163_104478253 195
101 3300014968 Ga0157379_10000442 Ga0157379_1000044221 195
102 3300014968 Ga0157379_10021079 Ga0157379_100210793 195
103 3300014968 Ga0157379_10250561 Ga0157379_102505613 195
104 3300025906 Ga0207699_10000116 Ga0207699_1000011644 195
105 3300025911 Ga0207654_10525008 Ga0207654_105250082 195
106 3300025912 Ga0207707_10110194 Ga0207707_101101943 195
107 3300025913 Ga0207695_10043087 Ga0207695_100430874 195
108 3300025914 Ga0207671_10018622 Ga0207671_100186225 195
109 3300025915 Ga0207693_10000052 Ga0207693_1000005237 195
110 3300025915 Ga0207693_10001911 Ga0207693_100019116 195
111 3300025916 Ga0207663_10007920 Ga0207663_100079207 195
112 3300025916 Ga0207663_10872452 Ga0207663_108724521 195
113 3300025928 Ga0207700_10036179 Ga0207700_100361793 195
114 3300025929 Ga0207664_10906751 Ga0207664_109067512 195
115 3300025945 Ga0207679_10507449 Ga0207679_105074492 195
116 3300025949 Ga0207667_10023012 Ga0207667_100230123 195
117 3300026035 Ga0207703_10550602 Ga0207703_105506022 195
118 3300026078 Ga0207702_10000011 Ga0207702_10000011226 195
119 3300026078 Ga0207702_10001087 Ga0207702_1000108717 195
120 3300026078 Ga0207702_10871253 Ga0207702_108712532 195
121 3300026116 Ga0207674_10000002 Ga0207674_10000002227 195
122 3300026142 Ga0207698_10035161 Ga0207698_100351614 195
123 3300028800 Ga0265338_10061372 Ga0265338_100613721 195
124 3300031240 Ga0265320_10002137 Ga0265320_100021377 195
125 3300031241 Ga0265325_10000454 Ga0265325_100004546 195
126 3300031241 Ga0265325_10013138 Ga0265325_100131384 195
127 3300031249 Ga0265339_10011077 Ga0265339_100110778 195
128 3300031344 Ga0265316_10065824 Ga0265316_100658243 195
129 3300031595 Ga0265313_10001574 Ga0265313_100015744 195
130 3300031711 Ga0265314_10261368 Ga0265314_102613682 195
131 3300035111 Ga0373923_0091991 Ga0373923_0091991_403_1002 195
132 3300035119 Ga0373956_0027688 Ga0373956_0027688_1355_1954 195
133 3300035172 Ga0373955_0095613 Ga0373955_0095613_954_1553 195
134 3300035691 Ga0373931_0001844 Ga0373931_0001844_8316_8915 195
135 3300035692 Ga0373935_0045247 Ga0373935_0045247_1516_2115 195
136 3300035724 Ga0373933_0108741 Ga0373933_0108741_657_1256 195
137 3300035724 Ga0373933_0292285 Ga0373933_0292285_99_698 195
138 3300036401 Ga0373937_0005420 Ga0373937_0005420_604_1203 195
139 3300036401 Ga0373937_0035641 Ga0373937_0035641_2673_3272 195
140 3300036401 Ga0373937_0245840 Ga0373937_0245840_511_1110 195
141 3300037068 Ga0373925_0259049 Ga0373925_0259049_350_949 195
142 3300047322 Ga0495680_0430526 Ga0495680_0430526_141_740 195
143 3300048088 Ga0495602_0148214 Ga0495602_0148214_326_925 195
144 3300048088 Ga0495602_0535439 Ga0495602_0535439_144_743 195
145 3300048929 Ga0496126_0000452 Ga0496126_0000452_2455_3054 195
146 3300050513 nmdc:mga0rr50_52690_c1 nmdc:mga0rr50_52690_c1_2056_2655 195
147 3300050513 nmdc:mga0rr50_61013_c1 nmdc:mga0rr50_61013_c1_1699_2298 195
148 3300050514 nmdc:mga08x19_50437_c1 nmdc:mga08x19_50437_c1_253_852 195
149 3300050514 nmdc:mga08x19_86_c1 nmdc:mga08x19_86_c1_20171_20770 195
150 3300050514 nmdc:mga08x19_88932_c1 nmdc:mga08x19_88932_c1_1089_1688 195
151 3300054114 Ga0501084_0666418 Ga0501084_0666418_155_781 195
152 3300003320 rootH2_10018518 rootH2_100185184 196
153 3300005335 Ga0070666_10002220 Ga0070666_100022201 196
154 3300005539 Ga0068853_100001987 Ga0068853_1000019875 196
155 3300005548 Ga0070665_100064157 Ga0070665_1000641575 196
156 3300005563 Ga0068855_100098521 Ga0068855_1000985214 196
157 3300009176 Ga0105242_10026770 Ga0105242_100267705 196
158 3300021358 Ga0213873_10008531 Ga0213873_100085313 196
159 3300025903 Ga0207680_10004040 Ga0207680_100040405 196
160 3300025934 Ga0207686_10008217 Ga0207686_100082175 196
161 3300025949 Ga0207667_10268381 Ga0207667_102683813 196
162 3300026041 Ga0207639_10023846 Ga0207639_100238466 196
163 3300028379 Ga0268266_10127035 Ga0268266_101270354 196
164 3300028577 Ga0265318_10000025 Ga0265318_10000025170 196
165 3300028800 Ga0265338_10006089 Ga0265338_1000608916 196
166 3300031241 Ga0265325_10003265 Ga0265325_100032655 196
167 3300031247 Ga0265340_10018508 Ga0265340_100185084 196
168 3300031247 Ga0265340_10056365 Ga0265340_100563652 196
169 3300031249 Ga0265339_10063198 Ga0265339_100631983 196
170 3300031249 Ga0265339_10076733 Ga0265339_100767333 196
171 3300031711 Ga0265314_10007961 Ga0265314_100079615 196
172 3300031711 Ga0265314_10023241 Ga0265314_100232412 196
173 3300031712 Ga0265342_10044452 Ga0265342_100444522 196
174 3300035086 Ga0373934_0223373 Ga0373934_0223373_61_663 196
175 3300036401 Ga0373937_0517066 Ga0373937_0517066_135_737 196
176 3300039437 Ga0436365_0210722 Ga0436365_0210722_1661_2266 196
177 3300039453 Ga0436362_0740156 Ga0436362_0740156_122_727 196
178 3300045049 Ga0466959_0058668 Ga0466959_0058668_2160_2762 196
179 3300049570 Ga0501033_0178908 Ga0501033_0178908_29_634 196
180 3300049573 Ga0501037_0076986 Ga0501037_0076986_270_875 196
181 3300049574 Ga0501038_0284288 Ga0501038_0284288_195_800 196
182 3300049581 Ga0501047_0226996 Ga0501047_0226996_745_1350 196
183 3300049585 Ga0501069_0275756 Ga0501069_0275756_171_776 196
184 3300049586 Ga0501070_0000025 Ga0501070_0000025_139587_140192 196
185 3300049590 Ga0501074_0487256 Ga0501074_0487256_170_775 196
186 3300049742 Ga0501080_0018708 Ga0501080_0018708_4090_4695 196
187 3300049822 Ga0501035_0000712 Ga0501035_0000712_6255_6860 196
188 3300049823 Ga0501044_0001321 Ga0501044_0001321_12257_12862 196
189 3300049823 Ga0501044_0038745 Ga0501044_0038745_2635_3240 196
190 3300053087 Ga0500643_000008 Ga0500643_000008_335123_335725 196
191 3300053139 Ga0500568_0020710 Ga0500568_0020710_1170_1772 196
192 3300021384 Ga0213876_10000345 Ga0213876_1000034512 197
193 3300039437 Ga0436365_1541345 Ga0436365_1541345_9005_9613 197
194 3300060353 Ga0501082_0003835 Ga0501082_0003835_7554_8159 197
195 3300005840 Ga0068870_10412083 Ga0068870_104120831 198
196 3300013105 Ga0157369_10836562 Ga0157369_108365622 198
197 3300005327 Ga0070658_10019544 Ga0070658_100195444 204
198 3300005563 Ga0068855_100325369 Ga0068855_1003253693 204
199 3300009093 Ga0105240_10012230 Ga0105240_100122307 204
200 3300010375 Ga0105239_10260051 Ga0105239_102600513 204
201 3300010375 Ga0105239_10260964 Ga0105239_102609641 204
202 3300025909 Ga0207705_10018955 Ga0207705_100189554 204
203 3300025913 Ga0207695_10011527 Ga0207695_100115275 204
204 3300025913 Ga0207695_10043124 Ga0207695_100431242 204
205 3300025914 Ga0207671_10144473 Ga0207671_101444732 204
206 3300025949 Ga0207667_10114009 Ga0207667_101140093 204
207 3300003758 Ga0055532_1000976 Ga0055532_10009768 205
208 3300003761 Ga0055535_1001830 Ga0055535_10018308 205
209 3300003763 Ga0055529_1001267 Ga0055529_10012672 205
210 3300005366 Ga0070659_100004923 Ga0070659_1000049234 205
211 3300005578 Ga0068854_100004056 Ga0068854_1000040562 205
212 3300009093 Ga0105240_10097151 Ga0105240_100971513 205
213 3300013100 Ga0157373_10386184 Ga0157373_103861841 205
214 3300013105 Ga0157369_10023950 Ga0157369_100239506 205
215 3300015262 Ga0182007_10016347 Ga0182007_100163472 205
216 3300020077 Ga0206351_10321852 Ga0206351_103218522 205
217 3300020610 Ga0154015_1578908 Ga0154015_15789082 205
218 3300025225 Ga0209566_104455 Ga0209566_1044552 205
219 3300025226 Ga0209674_102569 Ga0209674_1025692 205
220 3300025228 Ga0209672_107091 Ga0209672_1070912 205
221 3300025229 Ga0209147_100414 Ga0209147_10041424 205
222 3300025230 Ga0209563_110291 Ga0209563_1102912 205
223 3300025242 Ga0209258_100618 Ga0209258_10061824 205
224 3300025254 Ga0209148_1002976 Ga0209148_10029763 205
225 3300025256 Ga0209759_1009952 Ga0209759_10099523 205
226 3300025272 Ga0209455_1000501 Ga0209455_100050124 205
227 3300025904 Ga0207647_10316397 Ga0207647_103163971 205
228 3300025913 Ga0207695_10013124 Ga0207695_100131248 205
229 3300025932 Ga0207690_10008346 Ga0207690_100083466 205
230 3300025981 Ga0207640_10000946 Ga0207640_100009462 205
231 3300037418 Ga0395900_0132835 Ga0395900_0132835_1721_2389 205
232 3300048921 Ga0496118_0179434 Ga0496118_0179434_447_1106 206
233 3300046459 Ga0495629_0015346 Ga0495629_0015346_1551_2174 207
234 3300047315 Ga0495581_0024576 Ga0495581_0024576_1181_1804 207
235 3300047319 Ga0495674_0151222 Ga0495674_0151222_901_1524 207
236 3300047322 Ga0495680_0195178 Ga0495680_0195178_577_1200 207
237 3300047444 Ga0495675_0079999 Ga0495675_0079999_849_1472 207
238 3300047673 Ga0495593_0005445 Ga0495593_0005445_885_1508 207
239 3300048089 Ga0495614_0016498 Ga0495614_0016498_2314_2937 207
240 3300037853 Ga0436364_0680739 Ga0436364_0680739_648_1274 208
241 3300049570 Ga0501033_0405436 Ga0501033_0405436_124_750 208
242 3300049572 Ga0501036_0012532 Ga0501036_0012532_5091_5717 208
243 3300049573 Ga0501037_0079123 Ga0501037_0079123_218_844 208
244 3300049574 Ga0501038_0082018 Ga0501038_0082018_902_1528 208
245 3300049822 Ga0501035_0017914 Ga0501035_0017914_5876_6502 208
246 3300049823 Ga0501044_0033120 Ga0501044_0033120_4331_4957 208
247 3300044650 Ga0466986_0020770 Ga0466986_0020770_3153_3821 212
248 3300045976 Ga0466967_0998882 Ga0466967_0998882_77_745 212
249 3300031239 Ga0265328_10000085 Ga0265328_1000008512 213
250 3300031239 Ga0265328_10018930 Ga0265328_100189303 215
251 3300031251 Ga0265327_10043092 Ga0265327_100430922 215
252 3300031344 Ga0265316_10080645 Ga0265316_100806453 215
253 iso_pu_bacteria 2519103095 2519460908 215
254 iso_pu_bacteria 2582581311 2585289810 215
255 iso_pu_bacteria 2599185178 2599448661 215
256 iso_pu_bacteria 2599185239 2599735963 215
257 iso_pu_bacteria 2816332253 2817259244 215
258 iso_pu_bacteria 2816332256 2817280347 215
259 iso_pu_bacteria 2816332286 2817452469 215
260 iso_pu_bacteria 2818991452 2819629991 215
261 iso_pu_bacteria 2900577576 2900581709 215
262 iso_pu_bacteria 2928157003 2928158050 215
263 iso_pu_bacteria 2928163908 2928165838 215
264 iso_pu_bacteria 2928170801 2928174037 215
265 iso_pu_bacteria 2981990288 2981991082 215
266 iso_pu_bacteria 641736154 642417036 215
267 iso_pu_bacteria 8018845410 8018848672 215
268 iso_pu_bacteria 8020807995 8020808918 215
269 iso_pu_bacteria 8021120328 8021126293 215
270 iso_pu_bacteria 8040167225 8040167740 215
271 iso_pu_bacteria 8040173305 8040178893 215
272 3300037418 Ga0395900_0000015 Ga0395900_0000015_360555_361205 216
273 3300001989 JGI24739J22299_10040595 JGI24739J22299_100405952 219
274 3300003758 Ga0055532_1000270 Ga0055532_100027020 219
275 3300003758 Ga0055532_1000345 Ga0055532_100034513 219
276 3300003760 Ga0055527_1000216 Ga0055527_100021616 219
277 3300003761 Ga0055535_1000512 Ga0055535_100051220 219
278 3300003762 Ga0055542_1001562 Ga0055542_100156212 219
279 3300003763 Ga0055529_1003044 Ga0055529_10030442 219
280 3300003841 Ga0055541_1008466 Ga0055541_10084661 219
281 3300005327 Ga0070658_10074259 Ga0070658_100742593 219
282 3300005339 Ga0070660_100000112 Ga0070660_10000011244 219
283 3300005344 Ga0070661_100104755 Ga0070661_1001047553 219
284 3300005366 Ga0070659_100000020 Ga0070659_100000020136 219
285 3300005455 Ga0070663_100047513 Ga0070663_1000475133 219
286 3300005563 Ga0068855_100051348 Ga0068855_1000513481 219
287 3300009092 Ga0105250_10009828 Ga0105250_100098286 219
288 3300009093 Ga0105240_10130383 Ga0105240_101303832 219
289 3300009545 Ga0105237_10279500 Ga0105237_102795002 219
290 3300010375 Ga0105239_10664291 Ga0105239_106642912 219
291 3300013104 Ga0157370_10017311 Ga0157370_100173114 219
292 3300013105 Ga0157369_10233527 Ga0157369_102335272 219
293 3300013307 Ga0157372_10818113 Ga0157372_108181132 219
294 3300015265 Ga0182005_1002667 Ga0182005_10026675 219
295 3300025225 Ga0209566_100089 Ga0209566_10008995 219
296 3300025228 Ga0209672_100012 Ga0209672_100012229 219
297 3300025229 Ga0209147_100007 Ga0209147_100007543 219
298 3300025229 Ga0209147_100149 Ga0209147_10014914 219
299 3300025242 Ga0209258_100014 Ga0209258_100014160 219
300 3300025254 Ga0209148_1000745 Ga0209148_100074515 219
301 3300025256 Ga0209759_1008683 Ga0209759_10086832 219
302 3300025272 Ga0209455_1000269 Ga0209455_100026941 219
303 3300025909 Ga0207705_10052709 Ga0207705_100527092 219
304 3300025914 Ga0207671_10033517 Ga0207671_100335173 219
305 3300025919 Ga0207657_10000338 Ga0207657_1000033821 219
306 3300025932 Ga0207690_10000011 Ga0207690_10000011251 219
307 3300025949 Ga0207667_10003084 Ga0207667_100030846 219
308 3300026067 Ga0207678_10001890 Ga0207678_1000189010 219
309 3300026116 Ga0207674_10240308 Ga0207674_102403082 219
310 3300044842 Ga0466957_0010211 Ga0466957_0010211_4344_5003 219
311 3300048904 Ga0496101_0414020 Ga0496101_0414020_257_916 219
312 3300048915 Ga0496112_0240241 Ga0496112_0240241_772_1431 219
313 3300048919 Ga0496116_0166302 Ga0496116_0166302_399_1058 219
314 3300048920 Ga0496117_0083001 Ga0496117_0083001_1063_1722 219
315 3300048920 Ga0496117_0156762 Ga0496117_0156762_361_1020 219
316 3300048921 Ga0496118_0045048 Ga0496118_0045048_2714_3373 219
317 3300048921 Ga0496118_0068143 Ga0496118_0068143_1852_2511 219
318 3300048924 Ga0496121_0009997 Ga0496121_0009997_7766_8425 219
319 3300048925 Ga0496122_0209094 Ga0496122_0209094_153_812 219
320 3300048927 Ga0496124_0053723 Ga0496124_0053723_926_1585 219
321 3300048928 Ga0496125_0091851 Ga0496125_0091851_1439_2098 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

130

192

0.96

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

5

79

0.95

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

130

187

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

9

85

0.88

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

13

80

0.87

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

131

201

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ai8-assembly1.cif.gz_B crystal structure of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione 0.8419 7 195
3m8n-assembly1.cif.gz_B crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.8371 7 193
8aib-assembly1.cif.gz_B r11a variant of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione 0.8361 7 195
3uap-assembly1.cif.gz_A crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath 0.834 7 202
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.832 8 202
ID Description Score Start End Superfamily
af_I1KAF0_1_75_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9599 8 79 3.40.30.10
af_D3Z8I7_45_138_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.958 7 81 3.40.30.10
af_Q9FHE1_1_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9536 6 82 3.40.30.10
3ljrB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9466 6 81 3.40.30.10
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9447 5 81 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7Z2VU61-F1-model_v4 Glutathione S-transferase family protein 0.9794 4 208 GO:0016740
AF-A0A2S8GXL6-F1-model_v4 deleted 0.9786 6 208
AF-F6G513-F1-model_v4 Glutathione s-transferase protein 0.9785 1 212 GO:0016740
AF-A0A0S4V8X2-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9754 29 212 GO:0004364
AF-B9TCR5-F1-model_v4 GST N-terminal domain-containing protein 0.9751 41 190 GO:0004364
GO:0005737

Feature Viewer

pLDDT pTM Quality
94.48 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map