F405731

General Info

Members Datasets Scaffolds Average Seq Length
320 221 303 122

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_1093636|Ga0501072_1093636_46_480
Length 144
Sequence VVATIEVKEWAMKYAILIYDENTANPDPNPEPAVWGQVMAEYNAFTKAITDAGVYLGGEALQPNPTATTVRVRDGRTMTTDGPFAETKEGLGGFYVLDCRDLDEALAWAAKCPGSWYGSVEVRPVVTFEEYDPSEIEHKAIGAA

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2791355199
3 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
4 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
5 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
6 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
7 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
8 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
9 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
10 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
141 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
209 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
210 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
213 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
217 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
218 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
219 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
220 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
221 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 4.08
Isolates 5.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.31
Nodule 2.5
Rhizoplane 4.69
Rhizosphere 78.75
Stem 0
Stem Tuber 0
Unclassified 8.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000068 3300003203 Bacteria 47530
2 JGI25406J46586_10000392 3300003203 Bacteria 20055
3 JGI25165J46597_1002847 3300003214 Bacteria 4952
4 rootH1_10026874 3300003323 Bacteria 6311
5 Ga0058863_11355406 3300004799 Bacteria 515
6 Ga0058863_11725556 3300004799 Unclassified 683
7 Ga0058862_11231578 3300004803 Bacteria 527
8 Ga0058862_12600947 3300004803 Unclassified 1087
9 Ga0070658_10047402 3300005327 Bacteria 3478
10 Ga0070658_10478795 3300005327 Unclassified 1074
11 Ga0070683_102203766 3300005329 Bacteria 529
12 Ga0070680_100004402 3300005336 Bacteria 10602
13 Ga0070680_101177499 3300005336 Bacteria 663
14 Ga0070660_100006119 3300005339 Bacteria 8323
15 Ga0070660_100181120 3300005339 Unclassified 1705
16 Ga0070661_101922877 3300005344 Unclassified 503
17 Ga0070675_101195860 3300005354 Bacteria 700
18 Ga0070673_100293300 3300005364 Bacteria 1430
19 Ga0070714_100763337 3300005435 Bacteria 935
20 Ga0070714_101380415 3300005435 Bacteria 688
21 Ga0070710_10333035 3300005437 Bacteria 1000
22 Ga0070711_101348356 3300005439 Bacteria 620
23 Ga0070663_100166645 3300005455 Bacteria 1700
24 Ga0070707_101707396 3300005468 Bacteria 597
25 Ga0070698_100005551 3300005471 Bacteria 13787
26 Ga0070699_100096047 3300005518 Bacteria 2596
27 Ga0070679_101334317 3300005530 Unclassified 663
28 Ga0070679_101640053 3300005530 Unclassified 591
29 Ga0070697_101708681 3300005536 Bacteria 563
30 Ga0068853_100176497 3300005539 Bacteria 1935
31 Ga0068853_100905256 3300005539 Bacteria 847
32 Ga0070665_100002251 3300005548 Bacteria 21447
33 Ga0068855_100042352 3300005563 Bacteria 5395
34 Ga0068855_100097090 3300005563 Bacteria 3394
35 Ga0068855_100278051 3300005563 Bacteria 1860
36 Ga0068855_101278884 3300005563 Unclassified 760
37 Ga0068854_100102675 3300005578 Bacteria 2146
38 Ga0068854_100804480 3300005578 Bacteria 819
39 Ga0068856_100637434 3300005614 Unclassified 1086
40 Ga0068856_100775398 3300005614 Bacteria 979
41 Ga0068856_100998924 3300005614 Bacteria 855
42 Ga0068856_101889514 3300005614 Bacteria 608
43 Ga0070702_101253448 3300005615 Bacteria 600
44 Ga0068852_100008718 3300005616 Bacteria 7496
45 Ga0068852_100056817 3300005616 Bacteria 3384
46 Ga0068852_100698811 3300005616 Bacteria 1024
47 Ga0068852_102862060 3300005616 Unclassified 500
48 Ga0068859_100524523 3300005617 Bacteria 1279
49 Ga0068864_101220074 3300005618 Bacteria 751
50 Ga0068863_100696218 3300005841 Bacteria 1010
51 Ga0068863_101754375 3300005841 Unclassified 630
52 Ga0068858_101413762 3300005842 Unclassified 685
53 Ga0068860_101322085 3300005843 Bacteria 742
54 Ga0068862_100176713 3300005844 Bacteria 1914
55 Ga0081455_10031982 3300005937 Bacteria 4749
56 Ga0081455_10501718 3300005937 Bacteria 815
57 Ga0081538_10110726 3300005981 Bacteria 1349
58 Ga0081540_1023801 3300005983 Bacteria 3569
59 Ga0081539_10000321 3300005985 Bacteria 106887
60 Ga0081539_10081619 3300005985 Bacteria 1697
61 Ga0070717_10004731 3300006028 Bacteria 9893
62 Ga0070717_10020055 3300006028 Bacteria 5252
63 Ga0070717_10553800 3300006028 Bacteria 1041
64 Ga0070717_11796590 3300006028 Bacteria 554
65 Ga0075365_10106564 3300006038 Bacteria 1923
66 Ga0075365_10391440 3300006038 Bacteria 980
67 Ga0075364_10683122 3300006051 Bacteria 701
68 Ga0070712_101499657 3300006175 Bacteria 589
69 Ga0075369_10521463 3300006186 Bacteria 566
70 Ga0097621_101121928 3300006237 Bacteria 739
71 Ga0075370_10215932 3300006353 Bacteria 1133
72 Ga0075370_10474366 3300006353 Bacteria 754
73 Ga0075433_10074879 3300006852 Unclassified 2979
74 Ga0075434_100402375 3300006871 Bacteria 1390
75 Ga0075434_102202567 3300006871 Bacteria 555
76 Ga0068865_100289939 3300006881 Unclassified 1306
77 Ga0097620_100524568 3300006931 Bacteria 1279
78 Ga0075435_100210546 3300007076 Unclassified 1649
79 Ga0075435_100606496 3300007076 Bacteria 949
80 Ga0105240_10049778 3300009093 Bacteria 5286
81 Ga0111539_10155331 3300009094 Bacteria 2677
82 Ga0105245_10056450 3300009098 Bacteria 3530
83 Ga0105245_10508464 3300009098 Bacteria 1222
84 Ga0105245_11151663 3300009098 Bacteria 823
85 Ga0105247_10428953 3300009101 Bacteria 948
86 Ga0105241_10022865 3300009174 Bacteria 4634
87 Ga0105241_10028927 3300009174 Bacteria 4130
88 Ga0105248_13087344 3300009177 Bacteria 530
89 Ga0105237_10025461 3300009545 Bacteria 6050
90 Ga0105237_10063306 3300009545 Unclassified 3697
91 Ga0105237_10809272 3300009545 Bacteria 944
92 Ga0105237_10906811 3300009545 Bacteria 888
93 Ga0105238_10460630 3300009551 Bacteria 1269
94 Ga0105238_11137248 3300009551 Bacteria 804
95 Ga0105249_10803779 3300009553 Bacteria 1005
96 Ga0105249_11225002 3300009553 Unclassified 822
97 Ga0099796_10172382 3300010159 Bacteria 864
98 Ga0099796_10347888 3300010159 Bacteria 638
99 Ga0105239_10032732 3300010375 Bacteria 5713
100 Ga0105239_10172420 3300010375 Bacteria 2419
101 Ga0157371_10341818 3300013102 Bacteria 1089
102 Ga0157370_10002159 3300013104 Bacteria 24010
103 Ga0157369_10003960 3300013105 Bacteria 17565
104 Ga0157369_10618847 3300013105 Bacteria 1117
105 Ga0157374_12180377 3300013296 Bacteria 581
106 Ga0157378_10005423 3300013297 Bacteria 11182
107 Ga0157378_11940084 3300013297 Bacteria 638
108 Ga0157372_10013721 3300013307 Bacteria 8659
109 Ga0157375_10485308 3300013308 Bacteria 1400
110 Ga0163163_10063397 3300014325 Bacteria 3664
111 Ga0163163_13281582 3300014325 Bacteria 504
112 Ga0157376_10662046 3300014969 Bacteria 1046
113 Ga0163161_10751018 3300017792 Bacteria 816
114 Ga0197907_10758024 3300020069 Unclassified 1123
115 Ga0206349_1931317 3300020075 Unclassified 982
116 Ga0206351_10421577 3300020077 Unclassified 721
117 Ga0206352_11180738 3300020078 Unclassified 643
118 Ga0206350_10480873 3300020080 Unclassified 800
119 Ga0206354_11334399 3300020081 Unclassified 947
120 Ga0206353_10348940 3300020082 Unclassified 715
121 Ga0213876_10000513 3300021384 Bacteria 29954
122 Ga0213876_10482434 3300021384 Bacteria 660
123 Ga0224712_10216414 3300022467 Unclassified 875
124 Ga0209758_1037958 3300025297 Bacteria 1854
125 Ga0207692_10615676 3300025898 Bacteria 699
126 Ga0207647_10020304 3300025904 Bacteria 4456
127 Ga0207699_10448348 3300025906 Bacteria 925
128 Ga0207705_10088958 3300025909 Bacteria 2259
129 Ga0207705_10552128 3300025909 Unclassified 895
130 Ga0207684_10254824 3300025910 Bacteria 1514
131 Ga0207654_10095468 3300025911 Bacteria 1821
132 Ga0207654_10275476 3300025911 Bacteria 1136
133 Ga0207707_11026351 3300025912 Bacteria 676
134 Ga0207695_10000062 3300025913 Bacteria 351979
135 Ga0207671_10063705 3300025914 Bacteria 2740
136 Ga0207671_10451872 3300025914 Bacteria 1023
137 Ga0207660_10026454 3300025917 Bacteria 3951
138 Ga0207657_10010710 3300025919 Bacteria 9131
139 Ga0207657_10189580 3300025919 Unclassified 1659
140 Ga0207652_11522131 3300025921 Unclassified 573
141 Ga0207694_10410992 3300025924 Bacteria 1126
142 Ga0207694_11204631 3300025924 Bacteria 641
143 Ga0207659_10527358 3300025926 Bacteria 1002
144 Ga0207687_10013648 3300025927 Bacteria 5303
145 Ga0207687_11100660 3300025927 Bacteria 682
146 Ga0207700_10386948 3300025928 Bacteria 1224
147 Ga0207664_11104145 3300025929 Bacteria 709
148 Ga0207667_10082694 3300025949 Bacteria 3325
149 Ga0207667_10100312 3300025949 Bacteria 2986
150 Ga0207667_11005787 3300025949 Unclassified 821
151 Ga0207651_10201024 3300025960 Bacteria 1597
152 Ga0207712_10498583 3300025961 Bacteria 1040
153 Ga0207640_10622286 3300025981 Bacteria 916
154 Ga0207703_11174087 3300026035 Unclassified 738
155 Ga0207639_10092943 3300026041 Unclassified 2418
156 Ga0207678_10185789 3300026067 Bacteria 1775
157 Ga0207702_10367460 3300026078 Unclassified 1380
158 Ga0207702_10568229 3300026078 Bacteria 1110
159 Ga0207702_12266310 3300026078 Bacteria 531
160 Ga0207676_11418235 3300026095 Bacteria 691
161 Ga0207675_100006255 3300026118 Bacteria 11299
162 Ga0207683_11478727 3300026121 Bacteria 627
163 Ga0207698_10048261 3300026142 Bacteria 3231
164 Ga0207698_10050037 3300026142 Bacteria 3185
165 Ga0207698_10235880 3300026142 Bacteria 1664
166 Ga0268266_10000999 3300028379 Bacteria 35669
167 Ga0268264_10922694 3300028381 Bacteria 877
168 Ga0265319_1010638 3300028563 Bacteria 3827
169 Ga0265318_10023658 3300028577 Bacteria 2445
170 Ga0265336_10008587 3300028666 Bacteria 3573
171 Ga0265338_10135560 3300028800 Bacteria 1936
172 Ga0307511_10020639 3300030521 Bacteria 6232
173 Ga0265773_1005510 3300031018 Bacteria 924
174 Ga0265332_10023004 3300031238 Bacteria 2749
175 Ga0265320_10008221 3300031240 Bacteria 6404
176 Ga0265320_10022495 3300031240 Bacteria 3370
177 Ga0265339_10014296 3300031249 Bacteria 4786
178 Ga0307509_10763852 3300031507 Bacteria 632
179 Ga0265313_10082826 3300031595 Bacteria 1453
180 Ga0307508_10451458 3300031616 Bacteria 878
181 Ga0265342_10000065 3300031712 Bacteria 112156
182 Ga0265342_10215443 3300031712 Bacteria 1037
183 Ga0307411_11386965 3300032005 Bacteria 643
184 Ga0307415_100344447 3300032126 Bacteria 1252
185 Ga0307507_10469561 3300033179 Bacteria 688
186 Ga0307510_10219366 3300033180 Bacteria 1415
187 Ga0316215_1005380 3300033544 Bacteria 1233
188 Ga0373948_0140412 3300034817 Bacteria 597
189 Ga0373951_0162315 3300035091 Bacteria 633
190 Ga0373933_0437312 3300035724 Bacteria 855
191 Ga0395899_0008881 3300037312 Bacteria 7737
192 Ga0395900_0054704 3300037418 Bacteria 4109
193 Ga0395900_0460056 3300037418 Bacteria 1227
194 Ga0395898_0012617 3300037466 Bacteria 8735
195 Ga0395898_0071991 3300037466 Bacteria 3340
196 Ga0395898_1229738 3300037466 Bacteria 680
197 Ga0436364_0121479 3300037853 Bacteria 978
198 Ga0436364_0263572 3300037853 Bacteria 894
199 Ga0436364_1236444 3300037853 Bacteria 586
200 Ga0395901_0022068 3300038443 Bacteria 6524
201 Ga0436365_1459901 3300039437 Bacteria 1155
202 Ga0436363_0095440 3300039450 Unclassified 515
203 Ga0451787_675861 3300041441 Bacteria 637
204 Ga0451807_1846012 3300041486 Unclassified 3176
205 Ga0466957_0113909 3300044842 Bacteria 1718
206 Ga0466959_0210994 3300045049 Bacteria 1349
207 Ga0451576_1326035 3300045051 Bacteria 750
208 Ga0466967_0430394 3300045976 Bacteria 1287
209 Ga0495651_0612435 3300046462 Bacteria 686
210 Ga0495606_0000960 3300046507 Bacteria 42272
211 Ga0495606_0081428 3300046507 Bacteria 2012
212 Ga0495610_0123605 3300046512 Bacteria 1131
213 Ga0495628_0816181 3300046516 Bacteria 652
214 Ga0495648_0002325 3300046524 Bacteria 17689
215 Ga0495621_0123875 3300046539 Bacteria 1001
216 Ga0495658_0874425 3300046683 Bacteria 575
217 Ga0495626_0128393 3300048091 Bacteria 1084
218 Ga0496103_0288339 3300048906 Bacteria 1056
219 Ga0496104_0167010 3300048907 Bacteria 2110
220 Ga0496105_0362834 3300048908 Bacteria 1155
221 Ga0496108_0293216 3300048911 Bacteria 1416
222 Ga0496108_0655494 3300048911 Bacteria 912
223 Ga0496109_0089738 3300048912 Bacteria 2842
224 Ga0496110_0181270 3300048913 Bacteria 1912
225 Ga0496111_0164748 3300048914 Bacteria 1646
226 Ga0496111_0167330 3300048914 Bacteria 1633
227 Ga0496112_0000037 3300048915 Bacteria 96876
228 Ga0496112_0271667 3300048915 Bacteria 1643
229 Ga0496113_0124216 3300048916 Bacteria 2020
230 Ga0496114_1169482 3300048917 Bacteria 655
231 Ga0496118_0476172 3300048921 Bacteria 627
232 Ga0496121_0038715 3300048924 Bacteria 4215
233 Ga0496123_0258693 3300048926 Bacteria 854
234 Ga0496126_0037056 3300048929 Bacteria 4554
235 Ga0496126_0845801 3300048929 Bacteria 698
236 Ga0501033_0076627 3300049570 Bacteria 2455
237 Ga0501036_0098819 3300049572 Bacteria 2468
238 Ga0501036_0916121 3300049572 Bacteria 719
239 Ga0501037_0188049 3300049573 Bacteria 1463
240 Ga0501039_0726366 3300049575 Unclassified 776
241 Ga0501039_0899847 3300049575 Bacteria 689
242 Ga0501040_0425280 3300049576 Bacteria 955
243 Ga0501041_0013774 3300049577 Bacteria 4796
244 Ga0501041_1019645 3300049577 Unclassified 533
245 Ga0501042_0250578 3300049578 Bacteria 1278
246 Ga0501043_0123236 3300049579 Bacteria 2033
247 Ga0501046_0089830 3300049580 Bacteria 2364
248 Ga0501046_0242117 3300049580 Bacteria 1330
249 Ga0501046_1225757 3300049580 Bacteria 515
250 Ga0501048_0059371 3300049582 Bacteria 2711
251 Ga0501068_0277942 3300049584 Bacteria 1070
252 Ga0501068_0612573 3300049584 Bacteria 710
253 Ga0501070_0441550 3300049586 Bacteria 1050
254 Ga0501070_1384397 3300049586 Unclassified 535
255 Ga0501071_0176540 3300049587 Bacteria 1600
256 Ga0501071_0551257 3300049587 Bacteria 885
257 Ga0501071_0924689 3300049587 Bacteria 673
258 Ga0501072_0058903 3300049588 Bacteria 3028
259 Ga0501072_0362448 3300049588 Bacteria 1151
260 Ga0501072_1093636 3300049588 Unclassified 620
261 Ga0501073_0334918 3300049589 Bacteria 1045
262 Ga0501074_0036991 3300049590 Bacteria 3538
263 Ga0501074_0340221 3300049590 Bacteria 1065
264 Ga0501075_0084122 3300049591 Bacteria 2409
265 Ga0501075_0253465 3300049591 Bacteria 1341
266 Ga0501076_0099051 3300049592 Bacteria 2348
267 Ga0501076_0169513 3300049592 Bacteria 1779
268 Ga0501076_0529259 3300049592 Bacteria 972
269 Ga0501077_0141602 3300049593 Bacteria 1525
270 Ga0501077_0414262 3300049593 Unclassified 862
271 Ga0501079_0096205 3300049741 Bacteria 2295
272 Ga0501079_0163264 3300049741 Bacteria 1737
273 Ga0501079_0225614 3300049741 Bacteria 1464
274 Ga0501079_0567928 3300049741 Bacteria 892
275 Ga0501080_1303431 3300049742 Bacteria 622
276 Ga0501080_1601807 3300049742 Bacteria 551
277 Ga0501081_0033169 3300049743 Bacteria 3506
278 Ga0501081_0727442 3300049743 Bacteria 745
279 Ga0501081_1105722 3300049743 Bacteria 600
280 Ga0501035_0259705 3300049822 Bacteria 1473
281 Ga0501045_0006929 3300049824 Bacteria 7855
282 nmdc:mga0yw44_666859_c1 3300050492 Bacteria 707
283 nmdc:mga06z11_997210_c1 3300050494 Bacteria 510
284 nmdc:mga08y16_227781_c1 3300050511 Bacteria 1928
285 nmdc:mga0rr50_1321793_c1 3300050513 Bacteria 611
286 nmdc:mga0rr50_189045_c1 3300050513 Unclassified 1687
287 nmdc:mga0a205_81665_c1 3300050515 Unclassified 3122
288 Ga0500559_0551453 3300053136 Bacteria 526
289 Ga0500590_262068 3300053148 Bacteria 678
290 Ga0500620_261846 3300053155 Bacteria 572
291 Ga0500622_0007226 3300053156 Bacteria 6325
292 Ga0500636_0089963 3300053177 Bacteria 1759
293 Ga0500636_0420224 3300053177 Bacteria 614
294 Ga0500637_0128836 3300053178 Bacteria 1468
295 Ga0501084_0180796 3300054114 Bacteria 1780
296 Ga0501084_0647666 3300054114 Bacteria 892
297 Ga0501082_0105553 3300060353 Bacteria 2437
298 Ga0501082_0146076 3300060353 Bacteria 2053
299 Ga0501082_1365556 3300060353 Bacteria 619
300 Ga0530510_0025722 3300061734 Bacteria 4210
301 Ga0530510_0276641 3300061734 Bacteria 1253
302 Ga0530510_0501175 3300061734 Bacteria 920
303 Ga0530510_0936883 3300061734 Bacteria 662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0095440 Ga0436363_0095440_53_340 94
2 3300034817 Ga0373948_0140412 Ga0373948_0140412_260_577 100
3 3300041441 Ga0451787_675861 Ga0451787_675861_103_471 100
4 3300046512 Ga0495610_0123605 Ga0495610_0123605_798_1103 100
5 3300048911 Ga0496108_0655494 Ga0496108_0655494_19_321 100
6 3300048926 Ga0496123_0258693 Ga0496123_0258693_30_335 100
7 3300053178 Ga0500637_0128836 Ga0500637_0128836_341_643 100
8 3300045049 Ga0466959_0210994 Ga0466959_0210994_23_337 102
9 3300005471 Ga0070698_100005551 Ga0070698_1000055517 110
10 3300005539 Ga0068853_100905256 Ga0068853_1009052562 110
11 3300005548 Ga0070665_100002251 Ga0070665_1000022513 110
12 3300005617 Ga0068859_100524523 Ga0068859_1005245233 110
13 3300005841 Ga0068863_101754375 Ga0068863_1017543751 110
14 3300005842 Ga0068858_101413762 Ga0068858_1014137622 110
15 3300006028 Ga0070717_10004731 Ga0070717_100047314 110
16 3300006028 Ga0070717_11796590 Ga0070717_117965901 110
17 3300006852 Ga0075433_10074879 Ga0075433_100748793 110
18 3300006871 Ga0075434_102202567 Ga0075434_1022025672 110
19 3300006881 Ga0068865_100289939 Ga0068865_1002899393 110
20 3300006931 Ga0097620_100524568 Ga0097620_1005245683 110
21 3300007076 Ga0075435_100210546 Ga0075435_1002105462 110
22 3300007076 Ga0075435_100606496 Ga0075435_1006064961 110
23 3300009545 Ga0105237_10063306 Ga0105237_100633063 110
24 3300009553 Ga0105249_11225002 Ga0105249_112250022 110
25 3300013308 Ga0157375_10485308 Ga0157375_104853082 110
26 3300025914 Ga0207671_10451872 Ga0207671_104518722 110
27 3300026035 Ga0207703_11174087 Ga0207703_111740871 110
28 3300026041 Ga0207639_10092943 Ga0207639_100929434 110
29 3300028379 Ga0268266_10000999 Ga0268266_100009996 110
30 3300050513 nmdc:mga0rr50_189045_c1 nmdc:mga0rr50_189045_c1_452_817 110
31 3300050515 nmdc:mga0a205_81665_c1 nmdc:mga0a205_81665_c1_103_468 110
32 3300005336 Ga0070680_100004402 Ga0070680_1000044023 111
33 iso_pu_bacteria 2513237101 2513697448 112
34 iso_pu_bacteria 2791355199 2793079530 112
35 iso_pu_bacteria 2844315083 2844316901 112
36 iso_pu_bacteria 2844315083 2844316902 112
37 iso_pu_bacteria 2874604998 2874612607 112
38 iso_pu_bacteria 2889033259 2889033639 112
39 iso_pu_bacteria 2903727486 2903733952 112
40 iso_pu_bacteria 2906602504 2906604567 112
41 iso_pu_bacteria 2906602504 2906604568 112
42 iso_pu_bacteria 2922386360 2922390214 112
43 iso_pu_bacteria 3005594810 3005596536 112
44 iso_pu_bacteria 3005710791 3005712603 112
45 iso_pu_bacteria 8006964411 8006966539 112
46 iso_pu_bacteria 8006984368 8006989368 112
47 iso_pu_bacteria 8006994254 8006997851 112
48 iso_pu_bacteria 8056673599 8056674885 112
49 iso_pu_bacteria 8056967851 8056969708 112
50 3300021384 Ga0213876_10000513 Ga0213876_1000051320 113
51 3300037853 Ga0436364_0263572 Ga0436364_0263572_225_584 113
52 3300005435 Ga0070714_101380415 Ga0070714_1013804152 115
53 3300005530 Ga0070679_101334317 Ga0070679_1013343171 115
54 3300005616 Ga0068852_102862060 Ga0068852_1028620601 115
55 3300025906 Ga0207699_10448348 Ga0207699_104483482 115
56 3300025910 Ga0207684_10254824 Ga0207684_102548242 115
57 3300025921 Ga0207652_11522131 Ga0207652_115221311 115
58 3300025929 Ga0207664_11104145 Ga0207664_111041452 115
59 3300049572 Ga0501036_0916121 Ga0501036_0916121_290_658 115
60 3300049592 Ga0501076_0529259 Ga0501076_0529259_262_630 115
61 3300049741 Ga0501079_0567928 Ga0501079_0567928_274_642 115
62 3300049742 Ga0501080_1601807 Ga0501080_1601807_115_483 115
63 3300003203 JGI25406J46586_10000068 JGI25406J46586_1000006821 116
64 3300003203 JGI25406J46586_10000392 JGI25406J46586_1000039213 116
65 3300003214 JGI25165J46597_1002847 JGI25165J46597_10028472 116
66 3300003323 rootH1_10026874 rootH1_100268742 116
67 3300004799 Ga0058863_11355406 Ga0058863_113554061 116
68 3300004799 Ga0058863_11725556 Ga0058863_117255561 116
69 3300004803 Ga0058862_11231578 Ga0058862_112315781 116
70 3300004803 Ga0058862_12600947 Ga0058862_126009473 116
71 3300005327 Ga0070658_10047402 Ga0070658_100474023 116
72 3300005327 Ga0070658_10478795 Ga0070658_104787951 116
73 3300005329 Ga0070683_102203766 Ga0070683_1022037661 116
74 3300005336 Ga0070680_101177499 Ga0070680_1011774991 116
75 3300005339 Ga0070660_100006119 Ga0070660_1000061196 116
76 3300005339 Ga0070660_100181120 Ga0070660_1001811202 116
77 3300005344 Ga0070661_101922877 Ga0070661_1019228771 116
78 3300005354 Ga0070675_101195860 Ga0070675_1011958601 116
79 3300005364 Ga0070673_100293300 Ga0070673_1002933002 116
80 3300005435 Ga0070714_100763337 Ga0070714_1007633372 116
81 3300005437 Ga0070710_10333035 Ga0070710_103330352 116
82 3300005439 Ga0070711_101348356 Ga0070711_1013483562 116
83 3300005455 Ga0070663_100166645 Ga0070663_1001666452 116
84 3300005468 Ga0070707_101707396 Ga0070707_1017073961 116
85 3300005518 Ga0070699_100096047 Ga0070699_1000960472 116
86 3300005530 Ga0070679_101640053 Ga0070679_1016400531 116
87 3300005536 Ga0070697_101708681 Ga0070697_1017086811 116
88 3300005539 Ga0068853_100176497 Ga0068853_1001764972 116
89 3300005563 Ga0068855_100042352 Ga0068855_1000423524 116
90 3300005563 Ga0068855_100097090 Ga0068855_1000970902 116
91 3300005563 Ga0068855_100278051 Ga0068855_1002780511 116
92 3300005563 Ga0068855_101278884 Ga0068855_1012788842 116
93 3300005578 Ga0068854_100102675 Ga0068854_1001026752 116
94 3300005578 Ga0068854_100804480 Ga0068854_1008044802 116
95 3300005614 Ga0068856_100637434 Ga0068856_1006374341 116
96 3300005614 Ga0068856_100775398 Ga0068856_1007753981 116
97 3300005614 Ga0068856_100998924 Ga0068856_1009989242 116
98 3300005614 Ga0068856_101889514 Ga0068856_1018895142 116
99 3300005615 Ga0070702_101253448 Ga0070702_1012534481 116
100 3300005616 Ga0068852_100008718 Ga0068852_1000087181 116
101 3300005616 Ga0068852_100056817 Ga0068852_1000568173 116
102 3300005616 Ga0068852_100698811 Ga0068852_1006988112 116
103 3300005618 Ga0068864_101220074 Ga0068864_1012200742 116
104 3300005841 Ga0068863_100696218 Ga0068863_1006962182 116
105 3300005843 Ga0068860_101322085 Ga0068860_1013220851 116
106 3300005844 Ga0068862_100176713 Ga0068862_1001767132 116
107 3300005937 Ga0081455_10031982 Ga0081455_100319822 116
108 3300005937 Ga0081455_10501718 Ga0081455_105017182 116
109 3300005981 Ga0081538_10110726 Ga0081538_101107262 116
110 3300005983 Ga0081540_1023801 Ga0081540_10238016 116
111 3300005985 Ga0081539_10000321 Ga0081539_1000032173 116
112 3300005985 Ga0081539_10081619 Ga0081539_100816192 116
113 3300006028 Ga0070717_10020055 Ga0070717_100200552 116
114 3300006028 Ga0070717_10553800 Ga0070717_105538002 116
115 3300006038 Ga0075365_10106564 Ga0075365_101065642 116
116 3300006038 Ga0075365_10391440 Ga0075365_103914402 116
117 3300006051 Ga0075364_10683122 Ga0075364_106831222 116
118 3300006175 Ga0070712_101499657 Ga0070712_1014996572 116
119 3300006186 Ga0075369_10521463 Ga0075369_105214632 116
120 3300006237 Ga0097621_101121928 Ga0097621_1011219282 116
121 3300006353 Ga0075370_10215932 Ga0075370_102159322 116
122 3300006353 Ga0075370_10474366 Ga0075370_104743662 116
123 3300006871 Ga0075434_100402375 Ga0075434_1004023752 116
124 3300009093 Ga0105240_10049778 Ga0105240_100497781 116
125 3300009094 Ga0111539_10155331 Ga0111539_101553312 116
126 3300009098 Ga0105245_10056450 Ga0105245_100564501 116
127 3300009098 Ga0105245_10508464 Ga0105245_105084642 116
128 3300009098 Ga0105245_11151663 Ga0105245_111516632 116
129 3300009101 Ga0105247_10428953 Ga0105247_104289531 116
130 3300009174 Ga0105241_10022865 Ga0105241_100228651 116
131 3300009174 Ga0105241_10028927 Ga0105241_100289275 116
132 3300009177 Ga0105248_13087344 Ga0105248_130873441 116
133 3300009545 Ga0105237_10025461 Ga0105237_100254617 116
134 3300009545 Ga0105237_10809272 Ga0105237_108092722 116
135 3300009545 Ga0105237_10906811 Ga0105237_109068112 116
136 3300009551 Ga0105238_10460630 Ga0105238_104606302 116
137 3300009551 Ga0105238_11137248 Ga0105238_111372481 116
138 3300009553 Ga0105249_10803779 Ga0105249_108037792 116
139 3300010159 Ga0099796_10172382 Ga0099796_101723821 116
140 3300010159 Ga0099796_10347888 Ga0099796_103478881 116
141 3300010375 Ga0105239_10032732 Ga0105239_100327321 116
142 3300010375 Ga0105239_10172420 Ga0105239_101724204 116
143 3300013102 Ga0157371_10341818 Ga0157371_103418182 116
144 3300013104 Ga0157370_10002159 Ga0157370_1000215914 116
145 3300013105 Ga0157369_10003960 Ga0157369_100039609 116
146 3300013105 Ga0157369_10618847 Ga0157369_106188472 116
147 3300013296 Ga0157374_12180377 Ga0157374_121803771 116
148 3300013297 Ga0157378_10005423 Ga0157378_100054235 116
149 3300013297 Ga0157378_11940084 Ga0157378_119400842 116
150 3300013307 Ga0157372_10013721 Ga0157372_100137213 116
151 3300014325 Ga0163163_10063397 Ga0163163_100633972 116
152 3300014325 Ga0163163_13281582 Ga0163163_132815821 116
153 3300014969 Ga0157376_10662046 Ga0157376_106620462 116
154 3300017792 Ga0163161_10751018 Ga0163161_107510181 116
155 3300020069 Ga0197907_10758024 Ga0197907_107580241 116
156 3300020075 Ga0206349_1931317 Ga0206349_19313171 116
157 3300020077 Ga0206351_10421577 Ga0206351_104215771 116
158 3300020078 Ga0206352_11180738 Ga0206352_111807382 116
159 3300020080 Ga0206350_10480873 Ga0206350_104808732 116
160 3300020081 Ga0206354_11334399 Ga0206354_113343991 116
161 3300020082 Ga0206353_10348940 Ga0206353_103489402 116
162 3300021384 Ga0213876_10482434 Ga0213876_104824342 116
163 3300022467 Ga0224712_10216414 Ga0224712_102164141 116
164 3300025297 Ga0209758_1037958 Ga0209758_10379582 116
165 3300025898 Ga0207692_10615676 Ga0207692_106156762 116
166 3300025904 Ga0207647_10020304 Ga0207647_100203044 116
167 3300025909 Ga0207705_10088958 Ga0207705_100889582 116
168 3300025909 Ga0207705_10552128 Ga0207705_105521281 116
169 3300025911 Ga0207654_10095468 Ga0207654_100954683 116
170 3300025911 Ga0207654_10275476 Ga0207654_102754761 116
171 3300025912 Ga0207707_11026351 Ga0207707_110263511 116
172 3300025913 Ga0207695_10000062 Ga0207695_10000062287 116
173 3300025914 Ga0207671_10063705 Ga0207671_100637054 116
174 3300025917 Ga0207660_10026454 Ga0207660_100264543 116
175 3300025919 Ga0207657_10010710 Ga0207657_100107106 116
176 3300025919 Ga0207657_10189580 Ga0207657_101895802 116
177 3300025924 Ga0207694_10410992 Ga0207694_104109922 116
178 3300025924 Ga0207694_11204631 Ga0207694_112046312 116
179 3300025926 Ga0207659_10527358 Ga0207659_105273581 116
180 3300025927 Ga0207687_10013648 Ga0207687_100136483 116
181 3300025927 Ga0207687_11100660 Ga0207687_111006602 116
182 3300025928 Ga0207700_10386948 Ga0207700_103869481 116
183 3300025949 Ga0207667_10082694 Ga0207667_100826942 116
184 3300025949 Ga0207667_10100312 Ga0207667_101003122 116
185 3300025949 Ga0207667_11005787 Ga0207667_110057872 116
186 3300025960 Ga0207651_10201024 Ga0207651_102010242 116
187 3300025961 Ga0207712_10498583 Ga0207712_104985832 116
188 3300025981 Ga0207640_10622286 Ga0207640_106222862 116
189 3300026067 Ga0207678_10185789 Ga0207678_101857892 116
190 3300026078 Ga0207702_10367460 Ga0207702_103674602 116
191 3300026078 Ga0207702_10568229 Ga0207702_105682292 116
192 3300026078 Ga0207702_12266310 Ga0207702_122663101 116
193 3300026095 Ga0207676_11418235 Ga0207676_114182352 116
194 3300026118 Ga0207675_100006255 Ga0207675_1000062553 116
195 3300026121 Ga0207683_11478727 Ga0207683_114787271 116
196 3300026142 Ga0207698_10048261 Ga0207698_100482613 116
197 3300026142 Ga0207698_10050037 Ga0207698_100500371 116
198 3300026142 Ga0207698_10235880 Ga0207698_102358802 116
199 3300028381 Ga0268264_10922694 Ga0268264_109226941 116
200 3300028563 Ga0265319_1010638 Ga0265319_10106382 116
201 3300028577 Ga0265318_10023658 Ga0265318_100236582 116
202 3300028666 Ga0265336_10008587 Ga0265336_100085872 116
203 3300028800 Ga0265338_10135560 Ga0265338_101355602 116
204 3300030521 Ga0307511_10020639 Ga0307511_100206395 116
205 3300031018 Ga0265773_1005510 Ga0265773_10055101 116
206 3300031238 Ga0265332_10023004 Ga0265332_100230043 116
207 3300031240 Ga0265320_10008221 Ga0265320_100082212 116
208 3300031240 Ga0265320_10022495 Ga0265320_100224951 116
209 3300031249 Ga0265339_10014296 Ga0265339_100142963 116
210 3300031507 Ga0307509_10763852 Ga0307509_107638521 116
211 3300031595 Ga0265313_10082826 Ga0265313_100828261 116
212 3300031616 Ga0307508_10451458 Ga0307508_104514582 116
213 3300031712 Ga0265342_10000065 Ga0265342_1000006555 116
214 3300031712 Ga0265342_10215443 Ga0265342_102154431 116
215 3300032005 Ga0307411_11386965 Ga0307411_113869652 116
216 3300032126 Ga0307415_100344447 Ga0307415_1003444471 116
217 3300033179 Ga0307507_10469561 Ga0307507_104695612 116
218 3300033180 Ga0307510_10219366 Ga0307510_102193662 116
219 3300033544 Ga0316215_1005380 Ga0316215_10053802 116
220 3300035091 Ga0373951_0162315 Ga0373951_0162315_180_530 116
221 3300035724 Ga0373933_0437312 Ga0373933_0437312_438_788 116
222 3300037312 Ga0395899_0008881 Ga0395899_0008881_3953_4336 116
223 3300037418 Ga0395900_0054704 Ga0395900_0054704_1242_1625 116
224 3300037418 Ga0395900_0460056 Ga0395900_0460056_782_1132 116
225 3300037466 Ga0395898_0012617 Ga0395898_0012617_3267_3650 116
226 3300037466 Ga0395898_0071991 Ga0395898_0071991_126_476 116
227 3300037466 Ga0395898_1229738 Ga0395898_1229738_65_430 116
228 3300037853 Ga0436364_0121479 Ga0436364_0121479_270_620 116
229 3300037853 Ga0436364_1236444 Ga0436364_1236444_78_428 116
230 3300038443 Ga0395901_0022068 Ga0395901_0022068_1155_1538 116
231 3300039437 Ga0436365_1459901 Ga0436365_1459901_387_737 116
232 3300041486 Ga0451807_1846012 Ga0451807_1846012_2002_2388 116
233 3300044842 Ga0466957_0113909 Ga0466957_0113909_185_538 116
234 3300045051 Ga0451576_1326035 Ga0451576_1326035_49_405 116
235 3300045976 Ga0466967_0430394 Ga0466967_0430394_676_1110 116
236 3300046462 Ga0495651_0612435 Ga0495651_0612435_77_427 116
237 3300046507 Ga0495606_0000960 Ga0495606_0000960_6427_6777 116
238 3300046507 Ga0495606_0081428 Ga0495606_0081428_260_610 116
239 3300046516 Ga0495628_0816181 Ga0495628_0816181_204_554 116
240 3300046524 Ga0495648_0002325 Ga0495648_0002325_16815_17237 116
241 3300046539 Ga0495621_0123875 Ga0495621_0123875_570_926 116
242 3300046683 Ga0495658_0874425 Ga0495658_0874425_182_532 116
243 3300048091 Ga0495626_0128393 Ga0495626_0128393_94_516 116
244 3300048906 Ga0496103_0288339 Ga0496103_0288339_519_905 116
245 3300048907 Ga0496104_0167010 Ga0496104_0167010_1126_1476 116
246 3300048908 Ga0496105_0362834 Ga0496105_0362834_724_1074 116
247 3300048911 Ga0496108_0293216 Ga0496108_0293216_853_1203 116
248 3300048912 Ga0496109_0089738 Ga0496109_0089738_1101_1451 116
249 3300048913 Ga0496110_0181270 Ga0496110_0181270_412_762 116
250 3300048914 Ga0496111_0164748 Ga0496111_0164748_179_529 116
251 3300048914 Ga0496111_0167330 Ga0496111_0167330_227_616 116
252 3300048915 Ga0496112_0000037 Ga0496112_0000037_6193_6543 116
253 3300048915 Ga0496112_0271667 Ga0496112_0271667_868_1218 116
254 3300048916 Ga0496113_0124216 Ga0496113_0124216_770_1120 116
255 3300048917 Ga0496114_1169482 Ga0496114_1169482_50_400 116
256 3300048921 Ga0496118_0476172 Ga0496118_0476172_112_498 116
257 3300048924 Ga0496121_0038715 Ga0496121_0038715_1801_2151 116
258 3300048929 Ga0496126_0037056 Ga0496126_0037056_1999_2349 116
259 3300048929 Ga0496126_0845801 Ga0496126_0845801_278_631 116
260 3300049570 Ga0501033_0076627 Ga0501033_0076627_1041_1499 116
261 3300049572 Ga0501036_0098819 Ga0501036_0098819_1857_2315 116
262 3300049573 Ga0501037_0188049 Ga0501037_0188049_418_876 116
263 3300049575 Ga0501039_0726366 Ga0501039_0726366_234_644 116
264 3300049575 Ga0501039_0899847 Ga0501039_0899847_221_625 116
265 3300049576 Ga0501040_0425280 Ga0501040_0425280_489_896 116
266 3300049577 Ga0501041_0013774 Ga0501041_0013774_3203_3661 116
267 3300049577 Ga0501041_1019645 Ga0501041_1019645_57_467 116
268 3300049578 Ga0501042_0250578 Ga0501042_0250578_169_573 116
269 3300049579 Ga0501043_0123236 Ga0501043_0123236_511_969 116
270 3300049580 Ga0501046_0089830 Ga0501046_0089830_917_1375 116
271 3300049580 Ga0501046_0242117 Ga0501046_0242117_776_1186 116
272 3300049580 Ga0501046_1225757 Ga0501046_1225757_100_462 116
273 3300049582 Ga0501048_0059371 Ga0501048_0059371_1885_2343 116
274 3300049584 Ga0501068_0277942 Ga0501068_0277942_30_488 116
275 3300049584 Ga0501068_0612573 Ga0501068_0612573_135_539 116
276 3300049586 Ga0501070_0441550 Ga0501070_0441550_501_959 116
277 3300049586 Ga0501070_1384397 Ga0501070_1384397_109_519 116
278 3300049587 Ga0501071_0176540 Ga0501071_0176540_43_501 116
279 3300049587 Ga0501071_0551257 Ga0501071_0551257_285_695 116
280 3300049587 Ga0501071_0924689 Ga0501071_0924689_145_546 116
281 3300049588 Ga0501072_0058903 Ga0501072_0058903_436_894 116
282 3300049588 Ga0501072_0362448 Ga0501072_0362448_734_1138 116
283 3300049588 Ga0501072_1093636 Ga0501072_1093636_46_480 116
284 3300049589 Ga0501073_0334918 Ga0501073_0334918_192_650 116
285 3300049590 Ga0501074_0036991 Ga0501074_0036991_3038_3496 116
286 3300049590 Ga0501074_0340221 Ga0501074_0340221_604_1014 116
287 3300049591 Ga0501075_0084122 Ga0501075_0084122_1304_1714 116
288 3300049591 Ga0501075_0253465 Ga0501075_0253465_106_564 116
289 3300049592 Ga0501076_0099051 Ga0501076_0099051_880_1338 116
290 3300049592 Ga0501076_0169513 Ga0501076_0169513_97_507 116
291 3300049593 Ga0501077_0141602 Ga0501077_0141602_132_590 116
292 3300049593 Ga0501077_0414262 Ga0501077_0414262_347_757 116
293 3300049741 Ga0501079_0096205 Ga0501079_0096205_1502_1912 116
294 3300049741 Ga0501079_0163264 Ga0501079_0163264_369_827 116
295 3300049741 Ga0501079_0225614 Ga0501079_0225614_667_1068 116
296 3300049742 Ga0501080_1303431 Ga0501080_1303431_139_540 116
297 3300049743 Ga0501081_0033169 Ga0501081_0033169_2547_3005 116
298 3300049743 Ga0501081_0727442 Ga0501081_0727442_52_462 116
299 3300049743 Ga0501081_1105722 Ga0501081_1105722_172_579 116
300 3300049822 Ga0501035_0259705 Ga0501035_0259705_43_501 116
301 3300049824 Ga0501045_0006929 Ga0501045_0006929_5863_6321 116
302 3300050492 nmdc:mga0yw44_666859_c1 nmdc:mga0yw44_666859_c1_36_386 116
303 3300050494 nmdc:mga06z11_997210_c1 nmdc:mga06z11_997210_c1_91_441 116
304 3300050511 nmdc:mga08y16_227781_c1 nmdc:mga08y16_227781_c1_1051_1401 116
305 3300050513 nmdc:mga0rr50_1321793_c1 nmdc:mga0rr50_1321793_c1_77_433 116
306 3300053136 Ga0500559_0551453 Ga0500559_0551453_153_503 116
307 3300053148 Ga0500590_262068 Ga0500590_262068_100_450 116
308 3300053155 Ga0500620_261846 Ga0500620_261846_13_363 116
309 3300053156 Ga0500622_0007226 Ga0500622_0007226_3230_3580 116
310 3300053177 Ga0500636_0089963 Ga0500636_0089963_514_864 116
311 3300053177 Ga0500636_0420224 Ga0500636_0420224_71_421 116
312 3300054114 Ga0501084_0180796 Ga0501084_0180796_817_1275 116
313 3300054114 Ga0501084_0647666 Ga0501084_0647666_327_737 116
314 3300060353 Ga0501082_0105553 Ga0501082_0105553_917_1375 116
315 3300060353 Ga0501082_0146076 Ga0501082_0146076_745_1155 116
316 3300060353 Ga0501082_1365556 Ga0501082_1365556_127_483 116
317 3300061734 Ga0530510_0025722 Ga0530510_0025722_724_1125 116
318 3300061734 Ga0530510_0276641 Ga0530510_0276641_142_600 116
319 3300061734 Ga0530510_0501175 Ga0530510_0501175_313_717 116
320 3300061734 Ga0530510_0936883 Ga0530510_0936883_27_434 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

12

129

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9474 1 116
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9396 1 116
1mli-assembly1.cif.gz_A crystal structure of muconolactone isomerase at 3.3 angstroms resolution 0.7767 1 115
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.759 1 115
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7508 1 115
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9474 1 116 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9396 1 116 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.806 1 115 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7539 1 115 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7444 1 115 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A401ZSA9-F1-model_v4 YCII-related domain-containing protein 0.9972 1 116
AF-A0A841PAK0-F1-model_v4 YCII-related domain-containing protein 0.9963 1 114
AF-A0A402BG81-F1-model_v4 YCII-related domain-containing protein 0.9943 1 116
AF-A0A1F4IF75-F1-model_v4 YCII-related domain-containing protein 0.9943 1 115
AF-A0A1B9YG81-F1-model_v4 YCII-related domain-containing protein 0.9938 1 116

Feature Viewer

pLDDT pTM Quality
95.31 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map