F405689

General Info

Members Datasets Scaffolds Average Seq Length
320 246 640 312

Family's Representative Sequence

Representative Sequence 3300046692|Ga0495671_0014684|Ga0495671_0014684_1842_2792
Length 311
Sequence MARSTTDVWPALPFEAWRETCANLQLRTQIVGKIRLALTPWLNHSWHVTLYPAANGLTTSAIPYQGRTFRIDFDFIEHRLLIEASDGRRAALVLQDQPVADFYAAVMSALEGMDIRVSIRATPNEPFAQDREHHAYDAAAVRRFWDALSRTAVVMQRFRTAFLGKASPVHFFWGSFDLAVTRFSGRTAPSHPGGVPALPDAVAKEAYSHEVSSAGFWPGGGGYEDAAFYSYAYPEPPGFRDAPLKPAAAFYHDTLHEFVLPYEAVRKSSAPEQMLMDFLQSTYEAAAVQGKWDRTALECAVGQAGQPRQVP

Samples

Sample ID Description Type Environment
1 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
63 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
118 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
119 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
120 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
221 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
225 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
226 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
227 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
228 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
229 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
230 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
231 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
232 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
233 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
234 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
235 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
236 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
237 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
238 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
239 2904699407
240 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
241 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
242 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
243 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
244 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
245 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
246 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.79
Metatranscriptomes 0.31
Isolates 6.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5
Nodule 6.56
Rhizoplane 2.5
Rhizosphere 80.31
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495671_0014684 3300046692 Bacteria 4209
2 JGI25406J46586_10000055 3300003203 Bacteria 53491
3 JGI25404J52841_10001113 3300003659 Bacteria 4533
4 Ga0065712_10069340 3300005290 Bacteria 7500
5 Ga0065715_10089900 3300005293 Bacteria 8185
6 Ga0065715_10259333 3300005293 Bacteria 1143
7 Ga0070690_100007820 3300005330 Bacteria 6130
8 Ga0070690_100049314 3300005330 Bacteria 2683
9 Ga0070670_100067494 3300005331 Bacteria 3069
10 Ga0068869_100004646 3300005334 Bacteria 8565
11 Ga0070666_10187191 3300005335 Bacteria 1454
12 Ga0070680_100037813 3300005336 Bacteria 3901
13 Ga0070680_100059037 3300005336 Bacteria 3138
14 Ga0068868_100049735 3300005338 Bacteria 3290
15 Ga0070660_100123430 3300005339 Bacteria 2068
16 Ga0070660_100352475 3300005339 Bacteria 1212
17 Ga0070689_100002427 3300005340 Bacteria 12179
18 Ga0070689_100140935 3300005340 Bacteria 1939
19 Ga0070661_100005075 3300005344 Bacteria 9080
20 Ga0070668_100113745 3300005347 Bacteria 2156
21 Ga0070675_100000423 3300005354 Bacteria 28749
22 Ga0070671_100051826 3300005355 Bacteria 3413
23 Ga0070674_100170792 3300005356 Bacteria 1657
24 Ga0070673_100058693 3300005364 Bacteria 3043
25 Ga0070688_100069045 3300005365 Bacteria 2255
26 Ga0070709_10038010 3300005434 Bacteria 2944
27 Ga0070713_100072774 3300005436 Bacteria 2908
28 Ga0070711_100035972 3300005439 Bacteria 3315
29 Ga0070705_100116686 3300005440 Bacteria 1716
30 Ga0070700_100048232 3300005441 Bacteria 2639
31 Ga0070700_100068850 3300005441 Bacteria 2252
32 Ga0070663_100164245 3300005455 Bacteria 1711
33 Ga0070678_100090918 3300005456 Bacteria 2341
34 Ga0070678_100110745 3300005456 Bacteria 2147
35 Ga0070662_100031936 3300005457 Bacteria 3699
36 Ga0070681_10025743 3300005458 Bacteria 5915
37 Ga0068867_100062220 3300005459 Bacteria 2773
38 Ga0068867_100130691 3300005459 Bacteria 1951
39 Ga0070679_100120157 3300005530 Bacteria 2612
40 Ga0070684_100019470 3300005535 Bacteria 5614
41 Ga0070684_100066977 3300005535 Bacteria 3153
42 Ga0070672_100009388 3300005543 Bacteria 6742
43 Ga0070686_100023591 3300005544 Bacteria 3679
44 Ga0070686_100025480 3300005544 Bacteria 3559
45 Ga0068855_100070318 3300005563 Bacteria 4072
46 Ga0070664_100000362 3300005564 Bacteria 33490
47 Ga0068857_100114769 3300005577 Bacteria 2422
48 Ga0068854_100076554 3300005578 Bacteria 2459
49 Ga0068856_100427561 3300005614 Bacteria 1344
50 Ga0068859_100007378 3300005617 Bacteria 11156
51 Ga0068864_100013123 3300005618 Bacteria 6860
52 Ga0068861_100001542 3300005719 Bacteria 14614
53 Ga0068870_10004399 3300005840 Bacteria 6071
54 Ga0068863_100004812 3300005841 Bacteria 13298
55 Ga0068863_100056425 3300005841 Bacteria 3718
56 Ga0068858_100024975 3300005842 Bacteria 5562
57 Ga0068860_100002690 3300005843 Bacteria 18501
58 Ga0068862_100015731 3300005844 Bacteria 6288
59 Ga0081455_10022178 3300005937 Bacteria 5942
60 Ga0081540_1002723 3300005983 Bacteria 14384
61 Ga0081540_1006150 3300005983 Bacteria 8811
62 Ga0081540_1026322 3300005983 Bacteria 3323
63 Ga0081539_10000099 3300005985 Bacteria 201018
64 Ga0075365_10026139 3300006038 Bacteria 3703
65 Ga0075368_10006146 3300006042 Bacteria 4177
66 Ga0075364_10056787 3300006051 Bacteria 2564
67 Ga0070712_100072712 3300006175 Bacteria 2464
68 Ga0075362_10155363 3300006177 Bacteria 1099
69 Ga0097621_100087812 3300006237 Bacteria 2597
70 Ga0075370_10098004 3300006353 Bacteria 1695
71 Ga0068871_100157166 3300006358 Bacteria 1942
72 Ga0068871_100248439 3300006358 Bacteria 1549
73 Ga0075430_100000410 3300006846 Bacteria 31895
74 Ga0068865_100030678 3300006881 Bacteria 3578
75 Ga0097620_100007378 3300006931 Bacteria 11156
76 Ga0099824_1010899 3300006942 Bacteria 10492
77 Ga0099822_1000157 3300006943 Bacteria 48143
78 Ga0114129_10719252 3300009147 Bacteria 1281
79 Ga0105243_10044526 3300009148 Bacteria 3482
80 Ga0105243_10263809 3300009148 Bacteria 1543
81 Ga0105242_10123036 3300009176 Bacteria 2229
82 Ga0105248_10001512 3300009177 Bacteria 25877
83 Ga0105249_10064780 3300009553 Bacteria 3361
84 Ga0163162_10063651 3300013306 Bacteria 3732
85 Ga0157372_10114968 3300013307 Bacteria 3085
86 Ga0157375_10050997 3300013308 Bacteria 4061
87 Ga0157375_10184600 3300013308 Bacteria 2238
88 Ga0163163_10043464 3300014325 Bacteria 4405
89 Ga0163163_10047792 3300014325 Bacteria 4207
90 Ga0157377_10002582 3300014745 Bacteria 8045
91 Ga0157379_10105344 3300014968 Bacteria 2531
92 Ga0213876_10000227 3300021384 Bacteria 55523
93 Ga0213871_10005739 3300021441 Bacteria 2584
94 Ga0224712_10098387 3300022467 Bacteria 1237
95 Ga0209758_1003819 3300025297 Bacteria 13240
96 Ga0207688_10063943 3300025901 Bacteria 2076
97 Ga0207680_10114959 3300025903 Bacteria 1752
98 Ga0207643_10023254 3300025908 Bacteria 3417
99 Ga0207695_10067228 3300025913 Bacteria 3677
100 Ga0207671_10038135 3300025914 Bacteria 3561
101 Ga0207663_10044344 3300025916 Bacteria 2729
102 Ga0207660_10069596 3300025917 Bacteria 2556
103 Ga0207657_10008964 3300025919 Bacteria 10108
104 Ga0207657_10385447 3300025919 Bacteria 1103
105 Ga0207649_10018234 3300025920 Bacteria 3988
106 Ga0207652_10024891 3300025921 Bacteria 4968
107 Ga0207652_10084376 3300025921 Bacteria 2783
108 Ga0207650_10008603 3300025925 Bacteria 6969
109 Ga0207659_10062168 3300025926 Bacteria 2694
110 Ga0207700_10435043 3300025928 Bacteria 1154
111 Ga0207644_10100753 3300025931 Bacteria 2169
112 Ga0207690_10087314 3300025932 Bacteria 2194
113 Ga0207706_10050172 3300025933 Bacteria 3688
114 Ga0207709_10101501 3300025935 Bacteria 1903
115 Ga0207670_10193683 3300025936 Bacteria 1540
116 Ga0207670_10254140 3300025936 Bacteria 1359
117 Ga0207669_10041679 3300025937 Bacteria 2674
118 Ga0207691_10034178 3300025940 Bacteria 4729
119 Ga0207711_10011633 3300025941 Bacteria 7311
120 Ga0207689_10003782 3300025942 Bacteria 13789
121 Ga0207661_10002953 3300025944 Bacteria 11757
122 Ga0207679_10056643 3300025945 Bacteria 2895
123 Ga0207667_10378371 3300025949 Bacteria 1443
124 Ga0207651_10032712 3300025960 Bacteria 3344
125 Ga0207712_10007197 3300025961 Bacteria 7018
126 Ga0207640_10211466 3300025981 Bacteria 1478
127 Ga0207677_10020241 3300026023 Bacteria 4036
128 Ga0207703_10011905 3300026035 Bacteria 6774
129 Ga0207678_10087430 3300026067 Bacteria 2663
130 Ga0207708_10072250 3300026075 Bacteria 2643
131 Ga0207641_10143560 3300026088 Bacteria 2156
132 Ga0207648_10039180 3300026089 Bacteria 4167
133 Ga0207648_10152534 3300026089 Bacteria 2039
134 Ga0207676_10009030 3300026095 Bacteria 7096
135 Ga0207674_10098546 3300026116 Bacteria 2906
136 Ga0207675_100011685 3300026118 Bacteria 8210
137 Ga0207683_10004528 3300026121 Bacteria 11977
138 Ga0209589_1000005 3300027357 Bacteria 530958
139 Ga0209489_100005 3300027361 Bacteria 530958
140 Ga0209700_100006 3300027363 Bacteria 530958
141 Ga0209999_1001876 3300027543 Bacteria 3652
142 Ga0268266_10053842 3300028379 Bacteria 3458
143 Ga0268265_10037893 3300028380 Bacteria 3541
144 Ga0268264_10000042 3300028381 Bacteria 372069
145 Ga0265337_1001534 3300028556 Bacteria 11339
146 Ga0265318_10000089 3300028577 Bacteria 82410
147 Ga0265330_10020709 3300031235 Bacteria 3006
148 Ga0265325_10013363 3300031241 Bacteria 4677
149 Ga0265325_10045304 3300031241 Bacteria 2286
150 Ga0265340_10039226 3300031247 Bacteria 2338
151 Ga0265339_10076884 3300031249 Bacteria 1769
152 Ga0265316_10082098 3300031344 Bacteria 2470
153 Ga0307509_10066827 3300031507 Bacteria 3769
154 Ga0307508_10023061 3300031616 Bacteria 5654
155 Ga0265342_10093181 3300031712 Bacteria 1725
156 Ga0316578_10001746 3300031728 Bacteria 9103
157 Ga0307516_10241831 3300031730 Bacteria 1503
158 Ga0307406_10102188 3300031901 Unclassified 1955
159 Ga0307416_100127415 3300032002 Unclassified 2283
160 Ga0307507_10043220 3300033179 Bacteria 4475
161 Ga0373934_0016449 3300035086 Bacteria 2812
162 Ga0373923_0035333 3300035111 Bacteria 2034
163 Ga0373936_0062530 3300035113 Bacteria 1522
164 Ga0373943_0027192 3300035170 Bacteria 2686
165 Ga0373955_0018049 3300035172 Bacteria 3500
166 Ga0373924_0019758 3300035410 Bacteria 2612
167 Ga0373935_0266600 3300035692 Bacteria 1202
168 Ga0373933_0002165 3300035724 Bacteria 11241
169 Ga0373947_0306097 3300035725 Bacteria 1060
170 Ga0316582_0034930 3300036647 Bacteria 3100
171 Ga0373925_0158989 3300037068 Bacteria 1778
172 Ga0395898_0184602 3300037466 Bacteria 1993
173 Ga0395905_0127135 3300037471 Bacteria 2397
174 Ga0436365_0495986 3300039437 Bacteria 71581
175 Ga0436360_0627673 3300039438 Bacteria 3019
176 Ga0436360_0792401 3300039438 Bacteria 1941
177 Ga0436361_0504688 3300039447 Bacteria 1479
178 Ga0451576_0206839 3300045051 Bacteria 2049
179 Ga0495592_0064167 3300046454 Bacteria 2692
180 Ga0495651_0044266 3300046462 Bacteria 3450
181 Ga0495653_0050502 3300046463 Bacteria 3198
182 Ga0495606_0141647 3300046507 Bacteria 1419
183 Ga0495608_0050412 3300046511 Bacteria 2761
184 Ga0495587_0089517 3300046536 Bacteria 1779
185 Ga0495667_0047902 3300046559 Bacteria 2822
186 Ga0495599_0036081 3300046678 Bacteria 3103
187 Ga0495669_0000511 3300046684 Bacteria 17642
188 Ga0495669_0060326 3300046684 Bacteria 1714
189 Ga0495613_0025917 3300046689 Bacteria 4369
190 Ga0495624_0158068 3300046690 Bacteria 1385
191 Ga0495589_0139938 3300046794 Bacteria 1159
192 Ga0495676_0050991 3300047321 Bacteria 3315
193 Ga0495677_0033341 3300047445 Bacteria 1877
194 Ga0496102_0195730 3300048905 Bacteria 1905
195 Ga0496106_0022199 3300048909 Bacteria 4714
196 Ga0496109_0111497 3300048912 Bacteria 2544
197 Ga0496110_0073787 3300048913 Bacteria 3028
198 Ga0496111_0140598 3300048914 Bacteria 1789
199 Ga0496112_0157864 3300048915 Bacteria 2235
200 Ga0496114_0222339 3300048917 Bacteria 1658
201 Ga0496117_0110381 3300048920 Bacteria 1715
202 Ga0496121_0000753 3300048924 Bacteria 59517
203 Ga0496121_0151276 3300048924 Bacteria 1707
204 Ga0496122_0068260 3300048925 Bacteria 2554
205 Ga0496125_0000407 3300048928 Bacteria 80570
206 Ga0496125_0267595 3300048928 Bacteria 1067
207 Ga0501031_0001450 3300049568 Bacteria 14731
208 Ga0501031_0044555 3300049568 Bacteria 2895
209 Ga0501032_0000916 3300049569 Bacteria 23861
210 Ga0501032_0019295 3300049569 Bacteria 4771
211 Ga0501032_0020295 3300049569 Bacteria 4630
212 Ga0501033_0001463 3300049570 Bacteria 20932
213 Ga0501033_0017395 3300049570 Bacteria 5430
214 Ga0501034_0000072 3300049571 Bacteria 179824
215 Ga0501034_0020118 3300049571 Bacteria 6813
216 Ga0501034_0254688 3300049571 Bacteria 1699
217 Ga0501034_0266028 3300049571 Bacteria 1656
218 Ga0501036_0000250 3300049572 Bacteria 36419
219 Ga0501036_0007120 3300049572 Bacteria 9102
220 Ga0501036_0028593 3300049572 Bacteria 4710
221 Ga0501037_0000030 3300049573 Bacteria 136148
222 Ga0501037_0028212 3300049573 Bacteria 4146
223 Ga0501038_0000095 3300049574 Bacteria 74178
224 Ga0501038_0000826 3300049574 Bacteria 27582
225 Ga0501038_0012324 3300049574 Bacteria 7810
226 Ga0501039_0003615 3300049575 Bacteria 11596
227 Ga0501039_0018132 3300049575 Bacteria 5402
228 Ga0501039_0056474 3300049575 Bacteria 3041
229 Ga0501042_0124762 3300049578 Bacteria 1854
230 Ga0501042_0211754 3300049578 Bacteria 1398
231 Ga0501043_0003668 3300049579 Bacteria 12613
232 Ga0501043_0277786 3300049579 Bacteria 1284
233 Ga0501046_0002600 3300049580 Bacteria 16879
234 Ga0501046_0022284 3300049580 Bacteria 5218
235 Ga0501046_0058415 3300049580 Bacteria 3024
236 Ga0501046_0412152 3300049580 Bacteria 975
237 Ga0501047_0000174 3300049581 Bacteria 79021
238 Ga0501047_0025105 3300049581 Bacteria 5724
239 Ga0501047_0040566 3300049581 Bacteria 4501
240 Ga0501047_0251209 3300049581 Bacteria 1617
241 Ga0501048_0000477 3300049582 Bacteria 27978
242 Ga0501048_0002751 3300049582 Bacteria 13415
243 Ga0501048_0023939 3300049582 Bacteria 4459
244 Ga0501067_0000068 3300049583 Bacteria 59338
245 Ga0501067_0005049 3300049583 Bacteria 7330
246 Ga0501068_0001750 3300049584 Bacteria 11546
247 Ga0501068_0012510 3300049584 Bacteria 4815
248 Ga0501068_0013096 3300049584 Bacteria 4714
249 Ga0501069_0003306 3300049585 Bacteria 8273
250 Ga0501069_0050371 3300049585 Bacteria 2315
251 Ga0501070_0008646 3300049586 Bacteria 8605
252 Ga0501070_0029548 3300049586 Bacteria 4594
253 Ga0501070_0129123 3300049586 Bacteria 2088
254 Ga0501071_0020799 3300049587 Bacteria 4564
255 Ga0501071_0026210 3300049587 Bacteria 4090
256 Ga0501071_0123069 3300049587 Bacteria 1924
257 Ga0501072_0017574 3300049588 Bacteria 5498
258 Ga0501073_0000009 3300049589 Bacteria 195649
259 Ga0501073_0009266 3300049589 Bacteria 7262
260 Ga0501073_0015529 3300049589 Bacteria 5524
261 Ga0501074_0001057 3300049590 Bacteria 17986
262 Ga0501074_0044094 3300049590 Bacteria 3229
263 Ga0501074_0079135 3300049590 Bacteria 2359
264 Ga0501076_0028406 3300049592 Bacteria 4344
265 Ga0501077_0268313 3300049593 Bacteria 1086
266 Ga0501079_0000251 3300049741 Bacteria 32618
267 Ga0501079_0031511 3300049741 Bacteria 4076
268 Ga0501079_0195590 3300049741 Bacteria 1579
269 Ga0501080_0008286 3300049742 Bacteria 9417
270 Ga0501080_0013404 3300049742 Bacteria 7541
271 Ga0501080_0058701 3300049742 Bacteria 3581
272 Ga0501083_0001463 3300049744 Bacteria 16128
273 Ga0501083_0010865 3300049744 Bacteria 6404
274 Ga0501035_0000067 3300049822 Bacteria 129204
275 Ga0501035_0012854 3300049822 Bacteria 7729
276 Ga0501035_0030036 3300049822 Bacteria 4955
277 Ga0501044_0000173 3300049823 Bacteria 79909
278 Ga0501044_0007512 3300049823 Bacteria 11990
279 Ga0501044_0023139 3300049823 Bacteria 6613
280 Ga0501044_0122613 3300049823 Bacteria 2598
281 Ga0501045_0021764 3300049824 Bacteria 4590
282 Ga0501045_0109601 3300049824 Bacteria 2046
283 nmdc:mga0k408_104826_c1 3300050493 Bacteria 1669
284 nmdc:mga06z11_147006_c1 3300050494 Bacteria 1337
285 nmdc:mga04h51_33656_c1 3300050495 Bacteria 1633
286 nmdc:mga07m45_78154_c1 3300050496 Bacteria 1888
287 nmdc:mga0qj67_154_c1 3300050509 Bacteria 46027
288 Ga0495595_0031758 3300053084 Bacteria 2375
289 Ga0500583_0050500 3300053092 Bacteria 1929
290 Ga0500651_0063763 3300053093 Bacteria 2299
291 Ga0500556_0000174 3300053104 Bacteria 52844
292 Ga0500595_005151 3300053119 Bacteria 5737
293 Ga0500573_0038247 3300053140 Bacteria 2772
294 Ga0500638_073347 3300053162 Bacteria 1634
295 Ga0501084_0001174 3300054114 Bacteria 20442
296 Ga0501084_0009457 3300054114 Bacteria 8065
297 Ga0501082_0011980 3300060353 Bacteria 7456
298 2513655547 2513237096 Bacteria 8722461
299 2513916375 2513237145 Bacteria 8979722
300 2517890011 2517572143 Bacteria 9484767
301 2524534911 2524023228 Bacteria 10118060
302 2723842649 2721755755 Bacteria 8322773
303 2728749068 2728368998 Bacteria 8720350
304 2765467078 2765235802 Bacteria 5618596
305 2776267191 2775506902 Bacteria 6208009
306 2776284939 2775506904 Bacteria 5954060
307 2793068008 2791355197 Bacteria 8420563
308 2839992122 2839989709 Bacteria 3773432
309 2879111989 2879110137 Bacteria 8907982
310 2885377204 2885374607 Bacteria 8927485
311 2903754492 2903748898 Bacteria 9972761
312 2904697654 2904690495 Bacteria 9412302
313 2904710988
314 2908740234 2908739725 Bacteria 8628932
315 2908757760 2908756301 Bacteria 8864324
316 3005476248 3005474847 Bacteria 9259049
317 8006937564 8006933436 Bacteria 10410654
318 8006977593 8006973647 Bacteria 10679141
319 8006998272 8006994254 Bacteria 8309700
320 8056686050 8056681323 Bacteria 8472857
321 Ga0495671_0014684
322 JGI25406J46586_10000055
323 JGI25404J52841_10001113
324 Ga0065712_10069340
325 Ga0065715_10089900
326 Ga0065715_10259333
327 Ga0070690_100007820
328 Ga0070690_100049314
329 Ga0070670_100067494
330 Ga0068869_100004646
331 Ga0070666_10187191
332 Ga0070680_100037813
333 Ga0070680_100059037
334 Ga0068868_100049735
335 Ga0070660_100123430
336 Ga0070660_100352475
337 Ga0070689_100002427
338 Ga0070689_100140935
339 Ga0070661_100005075
340 Ga0070668_100113745
341 Ga0070675_100000423
342 Ga0070671_100051826
343 Ga0070674_100170792
344 Ga0070673_100058693
345 Ga0070688_100069045
346 Ga0070709_10038010
347 Ga0070713_100072774
348 Ga0070711_100035972
349 Ga0070705_100116686
350 Ga0070700_100048232
351 Ga0070700_100068850
352 Ga0070663_100164245
353 Ga0070678_100090918
354 Ga0070678_100110745
355 Ga0070662_100031936
356 Ga0070681_10025743
357 Ga0068867_100062220
358 Ga0068867_100130691
359 Ga0070679_100120157
360 Ga0070684_100019470
361 Ga0070684_100066977
362 Ga0070672_100009388
363 Ga0070686_100023591
364 Ga0070686_100025480
365 Ga0068855_100070318
366 Ga0070664_100000362
367 Ga0068857_100114769
368 Ga0068854_100076554
369 Ga0068856_100427561
370 Ga0068859_100007378
371 Ga0068864_100013123
372 Ga0068861_100001542
373 Ga0068870_10004399
374 Ga0068863_100004812
375 Ga0068863_100056425
376 Ga0068858_100024975
377 Ga0068860_100002690
378 Ga0068862_100015731
379 Ga0081455_10022178
380 Ga0081540_1002723
381 Ga0081540_1006150
382 Ga0081540_1026322
383 Ga0081539_10000099
384 Ga0075365_10026139
385 Ga0075368_10006146
386 Ga0075364_10056787
387 Ga0070712_100072712
388 Ga0075362_10155363
389 Ga0097621_100087812
390 Ga0075370_10098004
391 Ga0068871_100157166
392 Ga0068871_100248439
393 Ga0075430_100000410
394 Ga0068865_100030678
395 Ga0097620_100007378
396 Ga0099824_1010899
397 Ga0099822_1000157
398 Ga0114129_10719252
399 Ga0105243_10044526
400 Ga0105243_10263809
401 Ga0105242_10123036
402 Ga0105248_10001512
403 Ga0105249_10064780
404 Ga0163162_10063651
405 Ga0157372_10114968
406 Ga0157375_10050997
407 Ga0157375_10184600
408 Ga0163163_10043464
409 Ga0163163_10047792
410 Ga0157377_10002582
411 Ga0157379_10105344
412 Ga0213876_10000227
413 Ga0213871_10005739
414 Ga0224712_10098387
415 Ga0209758_1003819
416 Ga0207688_10063943
417 Ga0207680_10114959
418 Ga0207643_10023254
419 Ga0207695_10067228
420 Ga0207671_10038135
421 Ga0207663_10044344
422 Ga0207660_10069596
423 Ga0207657_10008964
424 Ga0207657_10385447
425 Ga0207649_10018234
426 Ga0207652_10024891
427 Ga0207652_10084376
428 Ga0207650_10008603
429 Ga0207659_10062168
430 Ga0207700_10435043
431 Ga0207644_10100753
432 Ga0207690_10087314
433 Ga0207706_10050172
434 Ga0207709_10101501
435 Ga0207670_10193683
436 Ga0207670_10254140
437 Ga0207669_10041679
438 Ga0207691_10034178
439 Ga0207711_10011633
440 Ga0207689_10003782
441 Ga0207661_10002953
442 Ga0207679_10056643
443 Ga0207667_10378371
444 Ga0207651_10032712
445 Ga0207712_10007197
446 Ga0207640_10211466
447 Ga0207677_10020241
448 Ga0207703_10011905
449 Ga0207678_10087430
450 Ga0207708_10072250
451 Ga0207641_10143560
452 Ga0207648_10039180
453 Ga0207648_10152534
454 Ga0207676_10009030
455 Ga0207674_10098546
456 Ga0207675_100011685
457 Ga0207683_10004528
458 Ga0209589_1000005
459 Ga0209489_100005
460 Ga0209700_100006
461 Ga0209999_1001876
462 Ga0268266_10053842
463 Ga0268265_10037893
464 Ga0268264_10000042
465 Ga0265337_1001534
466 Ga0265318_10000089
467 Ga0265330_10020709
468 Ga0265325_10013363
469 Ga0265325_10045304
470 Ga0265340_10039226
471 Ga0265339_10076884
472 Ga0265316_10082098
473 Ga0307509_10066827
474 Ga0307508_10023061
475 Ga0265342_10093181
476 Ga0316578_10001746
477 Ga0307516_10241831
478 Ga0307406_10102188
479 Ga0307416_100127415
480 Ga0307507_10043220
481 Ga0373934_0016449
482 Ga0373923_0035333
483 Ga0373936_0062530
484 Ga0373943_0027192
485 Ga0373955_0018049
486 Ga0373924_0019758
487 Ga0373935_0266600
488 Ga0373933_0002165
489 Ga0373947_0306097
490 Ga0316582_0034930
491 Ga0373925_0158989
492 Ga0395898_0184602
493 Ga0395905_0127135
494 Ga0436365_0495986
495 Ga0436360_0627673
496 Ga0436360_0792401
497 Ga0436361_0504688
498 Ga0451576_0206839
499 Ga0495592_0064167
500 Ga0495651_0044266
501 Ga0495653_0050502
502 Ga0495606_0141647
503 Ga0495608_0050412
504 Ga0495587_0089517
505 Ga0495667_0047902
506 Ga0495599_0036081
507 Ga0495669_0000511
508 Ga0495669_0060326
509 Ga0495613_0025917
510 Ga0495624_0158068
511 Ga0495589_0139938
512 Ga0495676_0050991
513 Ga0495677_0033341
514 Ga0496102_0195730
515 Ga0496106_0022199
516 Ga0496109_0111497
517 Ga0496110_0073787
518 Ga0496111_0140598
519 Ga0496112_0157864
520 Ga0496114_0222339
521 Ga0496117_0110381
522 Ga0496121_0000753
523 Ga0496121_0151276
524 Ga0496122_0068260
525 Ga0496125_0000407
526 Ga0496125_0267595
527 Ga0501031_0001450
528 Ga0501031_0044555
529 Ga0501032_0000916
530 Ga0501032_0019295
531 Ga0501032_0020295
532 Ga0501033_0001463
533 Ga0501033_0017395
534 Ga0501034_0000072
535 Ga0501034_0020118
536 Ga0501034_0254688
537 Ga0501034_0266028
538 Ga0501036_0000250
539 Ga0501036_0007120
540 Ga0501036_0028593
541 Ga0501037_0000030
542 Ga0501037_0028212
543 Ga0501038_0000095
544 Ga0501038_0000826
545 Ga0501038_0012324
546 Ga0501039_0003615
547 Ga0501039_0018132
548 Ga0501039_0056474
549 Ga0501042_0124762
550 Ga0501042_0211754
551 Ga0501043_0003668
552 Ga0501043_0277786
553 Ga0501046_0002600
554 Ga0501046_0022284
555 Ga0501046_0058415
556 Ga0501046_0412152
557 Ga0501047_0000174
558 Ga0501047_0025105
559 Ga0501047_0040566
560 Ga0501047_0251209
561 Ga0501048_0000477
562 Ga0501048_0002751
563 Ga0501048_0023939
564 Ga0501067_0000068
565 Ga0501067_0005049
566 Ga0501068_0001750
567 Ga0501068_0012510
568 Ga0501068_0013096
569 Ga0501069_0003306
570 Ga0501069_0050371
571 Ga0501070_0008646
572 Ga0501070_0029548
573 Ga0501070_0129123
574 Ga0501071_0020799
575 Ga0501071_0026210
576 Ga0501071_0123069
577 Ga0501072_0017574
578 Ga0501073_0000009
579 Ga0501073_0009266
580 Ga0501073_0015529
581 Ga0501074_0001057
582 Ga0501074_0044094
583 Ga0501074_0079135
584 Ga0501076_0028406
585 Ga0501077_0268313
586 Ga0501079_0000251
587 Ga0501079_0031511
588 Ga0501079_0195590
589 Ga0501080_0008286
590 Ga0501080_0013404
591 Ga0501080_0058701
592 Ga0501083_0001463
593 Ga0501083_0010865
594 Ga0501035_0000067
595 Ga0501035_0012854
596 Ga0501035_0030036
597 Ga0501044_0000173
598 Ga0501044_0007512
599 Ga0501044_0023139
600 Ga0501044_0122613
601 Ga0501045_0021764
602 Ga0501045_0109601
603 nmdc:mga0k408_104826_c1
604 nmdc:mga06z11_147006_c1
605 nmdc:mga04h51_33656_c1
606 nmdc:mga07m45_78154_c1
607 nmdc:mga0qj67_154_c1
608 Ga0495595_0031758
609 Ga0500583_0050500
610 Ga0500651_0063763
611 Ga0500556_0000174
612 Ga0500595_005151
613 Ga0500573_0038247
614 Ga0500638_073347
615 Ga0501084_0001174
616 Ga0501084_0009457
617 Ga0501082_0011980
618 2513655547
619 2513916375
620 2517890011
621 2524534911
622 2723842649
623 2728749068
624 2765467078
625 2776267191
626 2776284939
627 2793068008
628 2839992122
629 2879111989
630 2885377204
631 2903754492
632 2904697654
633 2904710988
634 2908740234
635 2908757760
636 3005476248
637 8006937564
638 8006977593
639 8006998272
640 8056686050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19459

DUF5996

Family of unknown function (DUF5996)

9

299

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ymz-assembly2.cif.gz_C crystal structure of chicken galectin 2 0.7202 67 93
6m5y-assembly1.cif.gz_A structure of human galectin-1 tandem-repeat mutant with lactose 0.7006 67 94
3wud-assembly1.cif.gz_A-2 x-ray crystal structure of xenopus laevis galectin-ib 0.6964 67 94
3ajy-assembly1.cif.gz_C crystal structure of ancestral congerin con-anc 0.6942 67 93
4y1z-assembly1.cif.gz_A complex of human galectin-1 and galbeta1-4(6co2)glcnac 0.6893 67 94
ID Description Score Start End Superfamily
af_I1KX48_23_256_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.8574 67 92 2.60.120.200
af_Q9W2H2_383_537_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.832 61 94 2.60.120.200
af_F1RCQ5_476_628_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7556 67 94 2.60.120.200
1a78B00 Mainly Beta;Sandwich;Jelly Rolls; 0.7511 67 94 2.60.120.200
af_F1R5H7_607_750_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.739 67 94 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A4Q5V4P6-F1-model_v4 deleted 0.9954 226 300
AF-A0A7W1HMY3-F1-model_v4 Uncharacterized protein 0.989 71 149
AF-A0A7X0R2P1-F1-model_v4 Ava_C0101 and related proteins 0.9864 5 303
AF-A0A7V9GKF5-F1-model_v4 Uncharacterized protein 0.986 212 300
AF-A0A1Q7Y3R0-F1-model_v4 Ava_C0101 and related proteins 0.9849 6 276

Map