F405676

General Info

Members Datasets Scaffolds Average Seq Length
320 213 640 131

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0031601|Ga0495628_0031601_3475_3870
Length 122
Sequence MSTYAVKRIDEMEAVFGGAFKRARAELGVESFGMQIIDMPPNYDNYPVHDHEQDGQEEVYVTLGGERFPLDADHVVRVGPGVTRKVWPGDAGIRILVLGGKAGEAYDAPDITKLGEPDPMAA

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
112 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
113 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
114 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 10
Rhizosphere 82.5
Stem 0
Stem Tuber 0
Unclassified 10.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0031601 3300046516 Bacteria 4282
2 LJNas_1033456 3300000546 Bacteria 554
3 rootH2_10016517 3300003320 Bacteria 2239
4 Ga0070683_100162066 3300005329 Bacteria 2122
5 Ga0070680_100523822 3300005336 Bacteria 1015
6 Ga0070682_100000032 3300005337 Bacteria 155141
7 Ga0068868_100000568 3300005338 Bacteria 24761
8 Ga0070691_10000100 3300005341 Bacteria 25275
9 Ga0070661_100000255 3300005344 Bacteria 43552
10 Ga0070671_100751935 3300005355 Bacteria 847
11 Ga0070674_100000001 3300005356 Bacteria 277173
12 Ga0070688_100000747 3300005365 Bacteria 16013
13 Ga0070688_101085685 3300005365 Unclassified 639
14 Ga0070659_100063676 3300005366 Bacteria 2918
15 Ga0070667_100074070 3300005367 Bacteria 2904
16 Ga0070710_10388890 3300005437 Bacteria 932
17 Ga0070711_100023085 3300005439 Bacteria 4041
18 Ga0070711_100454902 3300005439 Bacteria 1049
19 Ga0070705_100130845 3300005440 Bacteria 1637
20 Ga0070694_100485795 3300005444 Bacteria 981
21 Ga0070663_100001196 3300005455 Bacteria 14269
22 Ga0070663_101667486 3300005455 Bacteria 569
23 Ga0070681_10327644 3300005458 Bacteria 1441
24 Ga0068867_100803657 3300005459 Unclassified 839
25 Ga0070685_10001568 3300005466 Bacteria 12047
26 Ga0070679_100001834 3300005530 Bacteria 19119
27 Ga0068853_101809412 3300005539 Bacteria 592
28 Ga0070686_100576001 3300005544 Bacteria 884
29 Ga0070695_100146776 3300005545 Bacteria 1642
30 Ga0070696_100110983 3300005546 Bacteria 1975
31 Ga0070665_100190441 3300005548 Bacteria 2052
32 Ga0070704_100182557 3300005549 Unclassified 1679
33 Ga0068854_100000267 3300005578 Bacteria 35526
34 Ga0068856_100001040 3300005614 Bacteria 29492
35 Ga0068856_100042225 3300005614 Bacteria 4485
36 Ga0070702_100143410 3300005615 Bacteria 1524
37 Ga0068866_10000140 3300005718 Bacteria 32464
38 Ga0068866_10310984 3300005718 Bacteria 987
39 Ga0068851_10000258 3300005834 Bacteria 25137
40 Ga0068863_100000050 3300005841 Bacteria 130200
41 Ga0068860_101421078 3300005843 Bacteria 715
42 Ga0081455_10024963 3300005937 Bacteria 5523
43 Ga0070715_10027378 3300006163 Bacteria 2277
44 Ga0070716_100056239 3300006173 Bacteria 2255
45 Ga0105240_10483408 3300009093 Bacteria 1380
46 Ga0105245_10004472 3300009098 Bacteria 12358
47 Ga0105245_10102937 3300009098 Bacteria 2645
48 Ga0105243_10465026 3300009148 Bacteria 1190
49 Ga0105241_10319644 3300009174 Bacteria 1338
50 Ga0105242_10001159 3300009176 Bacteria 20774
51 Ga0105242_10022159 3300009176 Bacteria 4992
52 Ga0105242_10202272 3300009176 Bacteria 1765
53 Ga0105238_10000016 3300009551 Bacteria 236218
54 Ga0105239_10239865 3300010375 Bacteria 2035
55 Ga0105239_12552404 3300010375 Unclassified 596
56 Ga0105246_12195940 3300011119 Bacteria 537
57 Ga0157370_10002517 3300013104 Bacteria 22034
58 Ga0157370_10974034 3300013104 Archaea 768
59 Ga0157374_10426968 3300013296 Unclassified 1325
60 Ga0163162_10776722 3300013306 Bacteria 1076
61 Ga0157375_10001744 3300013308 Bacteria 18673
62 Ga0157375_10002471 3300013308 Bacteria 15996
63 Ga0157375_10162600 3300013308 Bacteria 2375
64 Ga0157375_10981276 3300013308 Bacteria 985
65 Ga0157375_11016756 3300013308 Bacteria 968
66 Ga0163163_10379483 3300014325 Bacteria 1471
67 Ga0163163_10806215 3300014325 Unclassified 1002
68 Ga0157380_12910350 3300014326 Bacteria 545
69 Ga0157379_10605495 3300014968 Bacteria 1023
70 Ga0157376_10364185 3300014969 Bacteria 1387
71 Ga0163161_10000103 3300017792 Bacteria 81496
72 Ga0206356_10052778 3300020070 Unclassified 707
73 Ga0207656_10001236 3300025321 Bacteria 8446
74 Ga0207692_10293842 3300025898 Bacteria 987
75 Ga0207642_10000066 3300025899 Bacteria 28858
76 Ga0207642_10008240 3300025899 Bacteria 3564
77 Ga0207642_10176559 3300025899 Bacteria 1160
78 Ga0207680_10022098 3300025903 Bacteria 3455
79 Ga0207685_10044252 3300025905 Bacteria 1682
80 Ga0207654_10193600 3300025911 Bacteria 1334
81 Ga0207695_10155010 3300025913 Unclassified 2226
82 Ga0207663_10002757 3300025916 Bacteria 8472
83 Ga0207663_10057704 3300025916 Bacteria 2447
84 Ga0207649_10000015 3300025920 Bacteria 245662
85 Ga0207652_10000513 3300025921 Bacteria 39231
86 Ga0207652_11114722 3300025921 Bacteria 690
87 Ga0207694_10000012 3300025924 Bacteria 411218
88 Ga0207694_10811120 3300025924 Unclassified 791
89 Ga0207650_11237305 3300025925 Bacteria 636
90 Ga0207687_10001665 3300025927 Bacteria 15338
91 Ga0207687_10406632 3300025927 Bacteria 1121
92 Ga0207690_10045821 3300025932 Bacteria 2892
93 Ga0207706_10270736 3300025933 Bacteria 1482
94 Ga0207686_10000035 3300025934 Bacteria 130483
95 Ga0207686_10013833 3300025934 Bacteria 4476
96 Ga0207686_10089563 3300025934 Bacteria 2028
97 Ga0207709_10032288 3300025935 Bacteria 3064
98 Ga0207709_10571611 3300025935 Bacteria 892
99 Ga0207709_10651175 3300025935 Bacteria 839
100 Ga0207669_10000002 3300025937 Bacteria 377651
101 Ga0207665_10087244 3300025939 Bacteria 2157
102 Ga0207665_10164847 3300025939 Bacteria 1597
103 Ga0207661_10115082 3300025944 Bacteria 2281
104 Ga0207651_10282881 3300025960 Bacteria 1372
105 Ga0207712_10630159 3300025961 Bacteria 930
106 Ga0207640_10000669 3300025981 Bacteria 19997
107 Ga0207658_10010576 3300025986 Bacteria 6270
108 Ga0207677_10001061 3300026023 Bacteria 15064
109 Ga0207677_12030578 3300026023 Bacteria 535
110 Ga0207639_10402197 3300026041 Bacteria 1234
111 Ga0207678_10002590 3300026067 Bacteria 16479
112 Ga0207678_11004222 3300026067 Bacteria 738
113 Ga0207702_10000349 3300026078 Bacteria 52941
114 Ga0207641_10000295 3300026088 Bacteria 62363
115 Ga0207641_10002521 3300026088 Bacteria 16875
116 Ga0207648_10837551 3300026089 Unclassified 857
117 Ga0268266_10000369 3300028379 Bacteria 69354
118 Ga0268266_10240101 3300028379 Bacteria 1672
119 Ga0268264_10675838 3300028381 Unclassified 1024
120 Ga0265337_1002592 3300028556 Bacteria 8185
121 Ga0265326_10000056 3300028558 Bacteria 64840
122 Ga0265326_10021122 3300028558 Bacteria 1867
123 Ga0265319_1000037 3300028563 Bacteria 115642
124 Ga0265322_10000017 3300028654 Bacteria 114833
125 Ga0265338_10000051 3300028800 Bacteria 211202
126 Ga0265324_10001639 3300029957 Bacteria 12385
127 Ga0265332_10025178 3300031238 Bacteria 2615
128 Ga0265328_10000258 3300031239 Bacteria 24453
129 Ga0265320_10000068 3300031240 Bacteria 91884
130 Ga0265325_10009857 3300031241 Bacteria 5562
131 Ga0265329_10007182 3300031242 Bacteria 4333
132 Ga0265339_10054877 3300031249 Bacteria 2163
133 Ga0265331_10005995 3300031250 Bacteria 7252
134 Ga0265327_10000317 3300031251 Bacteria 92215
135 Ga0265316_10247311 3300031344 Bacteria 1310
136 Ga0265313_10397392 3300031595 Bacteria 541
137 Ga0265314_10000973 3300031711 Bacteria 33669
138 Ga0265342_10132537 3300031712 Bacteria 1395
139 Ga0373935_1261429 3300035692 Bacteria 551
140 Ga0373947_0314641 3300035725 Bacteria 1046
141 Ga0373937_1159080 3300036401 Bacteria 721
142 Ga0451800_1239691 3300041459 Bacteria 1056
143 Ga0451807_1102958 3300041486 Bacteria 1165
144 Ga0451837_0068871 3300041494 Unclassified 840
145 Ga0451839_0214419 3300041496 Bacteria 544
146 Ga0451853_3625586 3300041512 Bacteria 1494
147 Ga0495592_0133213 3300046454 Bacteria 1736
148 Ga0495592_0149611 3300046454 Unclassified 1616
149 Ga0495592_0321645 3300046454 Bacteria 1000
150 Ga0495603_0000085 3300046455 Bacteria 41686
151 Ga0495603_0002488 3300046455 Bacteria 10843
152 Ga0495629_0021272 3300046459 Bacteria 4629
153 Ga0495638_0032677 3300046460 Bacteria 3333
154 Ga0495641_0175638 3300046461 Unclassified 958
155 Ga0495651_0072853 3300046462 Bacteria 2608
156 Ga0495653_0015845 3300046463 Bacteria 6144
157 Ga0495653_0202919 3300046463 Bacteria 1344
158 Ga0495662_0000162 3300046476 Bacteria 26288
159 Ga0495608_0000042 3300046511 Bacteria 115906
160 Ga0495608_0002177 3300046511 Bacteria 14130
161 Ga0495628_0000548 3300046516 Bacteria 34470
162 Ga0495628_0085301 3300046516 Bacteria 2450
163 Ga0495644_0010007 3300046523 Bacteria 3654
164 Ga0495652_0007230 3300046529 Bacteria 10249
165 Ga0495640_0004849 3300046533 Bacteria 10709
166 Ga0495640_0008071 3300046533 Bacteria 8268
167 Ga0495640_0854791 3300046533 Bacteria 540
168 Ga0495586_0001779 3300046535 Bacteria 11781
169 Ga0495587_0723163 3300046536 Bacteria 545
170 Ga0495645_0005133 3300046543 Bacteria 8968
171 Ga0495645_0029697 3300046543 Bacteria 3977
172 Ga0495645_0277455 3300046543 Bacteria 1104
173 Ga0495633_0008184 3300046558 Bacteria 5921
174 Ga0495667_0000019 3300046559 Bacteria 181645
175 Ga0495667_0029763 3300046559 Bacteria 3674
176 Ga0495634_0000050 3300046642 Bacteria 94546
177 Ga0495635_0000017 3300046663 Bacteria 195506
178 Ga0495635_0323092 3300046663 Unclassified 1032
179 Ga0495657_0000040 3300046675 Bacteria 115899
180 Ga0495657_0013724 3300046675 Bacteria 5966
181 Ga0495623_0169208 3300046679 Bacteria 1278
182 Ga0495646_0368912 3300046680 Bacteria 750
183 Ga0495647_0128336 3300046681 Bacteria 1072
184 Ga0495669_0123271 3300046684 Bacteria 1216
185 Ga0495669_0357185 3300046684 Unclassified 706
186 Ga0495613_0000067 3300046689 Bacteria 101960
187 Ga0495613_0282568 3300046689 Bacteria 1152
188 Ga0495613_0331419 3300046689 Bacteria 1049
189 Ga0495670_0034498 3300046691 Unclassified 2520
190 Ga0495671_0371028 3300046692 Bacteria 686
191 Ga0495600_0000376 3300046809 Bacteria 23258
192 Ga0495581_0126894 3300047315 Unclassified 1486
193 Ga0495674_0000024 3300047319 Bacteria 141746
194 Ga0495672_0267025 3300047320 Unclassified 823
195 Ga0495676_0000928 3300047321 Bacteria 24577
196 Ga0495676_0004042 3300047321 Bacteria 13356
197 Ga0495676_0756675 3300047321 Unclassified 627
198 Ga0495680_0001106 3300047322 Bacteria 29781
199 Ga0495680_0213008 3300047322 Bacteria 1382
200 Ga0495675_0000036 3300047444 Bacteria 91842
201 Ga0495675_0050692 3300047444 Bacteria 2638
202 Ga0495684_0037579 3300047471 Bacteria 3714
203 Ga0495686_0037368 3300047472 Bacteria 3111
204 Ga0495602_0018543 3300048088 Bacteria 6945
205 Ga0495602_0044758 3300048088 Bacteria 4011
206 Ga0496100_0000019 3300048903 Bacteria 149995
207 Ga0496100_0347873 3300048903 Bacteria 1119
208 Ga0496101_0000005 3300048904 Bacteria 331455
209 Ga0496102_0000021 3300048905 Bacteria 246920
210 Ga0496102_0025778 3300048905 Bacteria 5236
211 Ga0496102_0272015 3300048905 Bacteria 1597
212 Ga0496102_0340675 3300048905 Unclassified 1412
213 Ga0496103_0000001 3300048906 Bacteria 643471
214 Ga0496103_0047447 3300048906 Bacteria 2654
215 Ga0496104_0037124 3300048907 Bacteria 4556
216 Ga0496104_0918592 3300048907 Bacteria 780
217 Ga0496105_0015739 3300048908 Bacteria 6035
218 Ga0496106_0000033 3300048909 Bacteria 131412
219 Ga0496106_0000107 3300048909 Bacteria 64689
220 Ga0496107_0000004 3300048910 Bacteria 297680
221 Ga0496107_0025196 3300048910 Bacteria 4209
222 Ga0496107_0202823 3300048910 Bacteria 1474
223 Ga0496108_0000133 3300048911 Bacteria 72253
224 Ga0496109_0000021 3300048912 Bacteria 189945
225 Ga0496111_0686194 3300048914 Bacteria 746
226 Ga0496112_0000641 3300048915 Bacteria 24272
227 Ga0496113_0000002 3300048916 Bacteria 220193
228 Ga0496113_0550783 3300048916 Bacteria 925
229 Ga0496113_1136917 3300048916 Bacteria 611
230 Ga0496114_0000003 3300048917 Bacteria 630981
231 Ga0496114_0680558 3300048917 Bacteria 903
232 Ga0496115_0000022 3300048918 Bacteria 164224
233 Ga0496115_0000027 3300048918 Bacteria 145505
234 Ga0496115_0028973 3300048918 Bacteria 4345
235 Ga0496115_0166967 3300048918 Bacteria 1820
236 Ga0496116_0000138 3300048919 Bacteria 151606
237 Ga0496117_0002715 3300048920 Bacteria 21760
238 Ga0496118_0005655 3300048921 Bacteria 14094
239 Ga0496118_0095630 3300048921 Bacteria 2027
240 Ga0496118_0218301 3300048921 Bacteria 1112
241 Ga0496119_0004108 3300048922 Bacteria 14674
242 Ga0496119_0079226 3300048922 Bacteria 1898
243 Ga0496120_0001479 3300048923 Bacteria 27945
244 Ga0496121_0065605 3300048924 Bacteria 2953
245 Ga0496121_0081139 3300048924 Bacteria 2568
246 Ga0496121_0234202 3300048924 Bacteria 1284
247 Ga0496124_0260962 3300048927 Bacteria 1275
248 Ga0496124_0429758 3300048927 Bacteria 907
249 Ga0496126_0006956 3300048929 Bacteria 12515
250 Ga0496126_0007385 3300048929 Bacteria 12053
251 Ga0496126_0089751 3300048929 Bacteria 2705
252 Ga0501031_0000140 3300049568 Bacteria 40630
253 Ga0501032_0000313 3300049569 Bacteria 40757
254 Ga0501033_0000417 3300049570 Bacteria 40747
255 Ga0501034_0160597 3300049571 Bacteria 2218
256 Ga0501034_0692063 3300049571 Bacteria 918
257 Ga0501034_0723995 3300049571 Unclassified 892
258 Ga0501036_0000063 3300049572 Bacteria 69495
259 Ga0501037_0026921 3300049573 Bacteria 4247
260 Ga0501038_0000333 3300049574 Bacteria 40732
261 Ga0501039_0339283 3300049575 Bacteria 1181
262 Ga0501040_0051450 3300049576 Bacteria 2818
263 Ga0501042_0032598 3300049578 Bacteria 3690
264 Ga0501042_0045762 3300049578 Bacteria 3119
265 Ga0501043_0000499 3300049579 Bacteria 35234
266 Ga0501046_0000603 3300049580 Bacteria 35274
267 Ga0501047_0000686 3300049581 Bacteria 35325
268 Ga0501047_0002300 3300049581 Bacteria 18279
269 Ga0501047_0249314 3300049581 Bacteria 1624
270 Ga0501047_0279716 3300049581 Unclassified 1513
271 Ga0501047_0388910 3300049581 Bacteria 1228
272 Ga0501048_0000259 3300049582 Bacteria 35312
273 Ga0501068_0008747 3300049584 Bacteria 5648
274 Ga0501069_0107101 3300049585 Bacteria 1589
275 Ga0501069_0298767 3300049585 Bacteria 944
276 Ga0501070_0000408 3300049586 Bacteria 39113
277 Ga0501070_0068718 3300049586 Bacteria 2933
278 Ga0501070_0118191 3300049586 Unclassified 2190
279 Ga0501070_0351820 3300049586 Bacteria 1195
280 Ga0501071_0095976 3300049587 Unclassified 2182
281 Ga0501071_0164426 3300049587 Bacteria 1660
282 Ga0501072_0386100 3300049588 Bacteria 1111
283 Ga0501072_0911374 3300049588 Bacteria 686
284 Ga0501073_0019228 3300049589 Bacteria 4934
285 Ga0501074_0028746 3300049590 Bacteria 4027
286 Ga0501074_0328012 3300049590 Bacteria 1087
287 Ga0501074_0601606 3300049590 Unclassified 777
288 Ga0501075_0536791 3300049591 Bacteria 893
289 Ga0501076_0221783 3300049592 Bacteria 1545
290 Ga0501079_0004866 3300049741 Bacteria 9951
291 Ga0501079_0299378 3300049741 Bacteria 1258
292 Ga0501079_0320474 3300049741 Unclassified 1213
293 Ga0501080_0001807 3300049742 Bacteria 18341
294 Ga0501080_0237053 3300049742 Unclassified 1666
295 Ga0501081_0251041 3300049743 Bacteria 1292
296 Ga0501081_1543490 3300049743 Unclassified 505
297 Ga0501083_0006427 3300049744 Bacteria 8334
298 Ga0501035_0000555 3300049822 Bacteria 41488
299 Ga0501035_0066415 3300049822 Bacteria 3201
300 Ga0501035_0373141 3300049822 Bacteria 1191
301 Ga0501044_0000817 3300049823 Bacteria 37447
302 Ga0501044_0097108 3300049823 Bacteria 2968
303 Ga0501044_1140704 3300049823 Unclassified 648
304 Ga0501045_0396378 3300049824 Bacteria 1027
305 Ga0495601_0021535 3300053077 Bacteria 3949
306 Ga0495601_0044289 3300053077 Bacteria 2797
307 Ga0495601_0177225 3300053077 Unclassified 1394
308 Ga0495601_0643229 3300053077 Unclassified 679
309 Ga0495655_0000008 3300053083 Bacteria 153535
310 Ga0495595_0000009 3300053084 Bacteria 193039
311 Ga0495595_0000831 3300053084 Bacteria 11810
312 Ga0495595_0146108 3300053084 Unclassified 1162
313 Ga0495619_0000022 3300053085 Bacteria 184144
314 Ga0495619_0000032 3300053085 Bacteria 139067
315 Ga0495619_0000057 3300053085 Bacteria 93948
316 Ga0500566_0045766 3300053094 Bacteria 2517
317 Ga0500566_0502934 3300053094 Bacteria 521
318 Ga0500641_0009985 3300053096 Bacteria 3422
319 Ga0500628_000023 3300053129 Bacteria 77818
320 Ga0501082_0003663 3300060353 Bacteria 13419
321 Ga0495628_0031601
322 LJNas_1033456
323 rootH2_10016517
324 Ga0070683_100162066
325 Ga0070680_100523822
326 Ga0070682_100000032
327 Ga0068868_100000568
328 Ga0070691_10000100
329 Ga0070661_100000255
330 Ga0070671_100751935
331 Ga0070674_100000001
332 Ga0070688_100000747
333 Ga0070688_101085685
334 Ga0070659_100063676
335 Ga0070667_100074070
336 Ga0070710_10388890
337 Ga0070711_100023085
338 Ga0070711_100454902
339 Ga0070705_100130845
340 Ga0070694_100485795
341 Ga0070663_100001196
342 Ga0070663_101667486
343 Ga0070681_10327644
344 Ga0068867_100803657
345 Ga0070685_10001568
346 Ga0070679_100001834
347 Ga0068853_101809412
348 Ga0070686_100576001
349 Ga0070695_100146776
350 Ga0070696_100110983
351 Ga0070665_100190441
352 Ga0070704_100182557
353 Ga0068854_100000267
354 Ga0068856_100001040
355 Ga0068856_100042225
356 Ga0070702_100143410
357 Ga0068866_10000140
358 Ga0068866_10310984
359 Ga0068851_10000258
360 Ga0068863_100000050
361 Ga0068860_101421078
362 Ga0081455_10024963
363 Ga0070715_10027378
364 Ga0070716_100056239
365 Ga0105240_10483408
366 Ga0105245_10004472
367 Ga0105245_10102937
368 Ga0105243_10465026
369 Ga0105241_10319644
370 Ga0105242_10001159
371 Ga0105242_10022159
372 Ga0105242_10202272
373 Ga0105238_10000016
374 Ga0105239_10239865
375 Ga0105239_12552404
376 Ga0105246_12195940
377 Ga0157370_10002517
378 Ga0157370_10974034
379 Ga0157374_10426968
380 Ga0163162_10776722
381 Ga0157375_10001744
382 Ga0157375_10002471
383 Ga0157375_10162600
384 Ga0157375_10981276
385 Ga0157375_11016756
386 Ga0163163_10379483
387 Ga0163163_10806215
388 Ga0157380_12910350
389 Ga0157379_10605495
390 Ga0157376_10364185
391 Ga0163161_10000103
392 Ga0206356_10052778
393 Ga0207656_10001236
394 Ga0207692_10293842
395 Ga0207642_10000066
396 Ga0207642_10008240
397 Ga0207642_10176559
398 Ga0207680_10022098
399 Ga0207685_10044252
400 Ga0207654_10193600
401 Ga0207695_10155010
402 Ga0207663_10002757
403 Ga0207663_10057704
404 Ga0207649_10000015
405 Ga0207652_10000513
406 Ga0207652_11114722
407 Ga0207694_10000012
408 Ga0207694_10811120
409 Ga0207650_11237305
410 Ga0207687_10001665
411 Ga0207687_10406632
412 Ga0207690_10045821
413 Ga0207706_10270736
414 Ga0207686_10000035
415 Ga0207686_10013833
416 Ga0207686_10089563
417 Ga0207709_10032288
418 Ga0207709_10571611
419 Ga0207709_10651175
420 Ga0207669_10000002
421 Ga0207665_10087244
422 Ga0207665_10164847
423 Ga0207661_10115082
424 Ga0207651_10282881
425 Ga0207712_10630159
426 Ga0207640_10000669
427 Ga0207658_10010576
428 Ga0207677_10001061
429 Ga0207677_12030578
430 Ga0207639_10402197
431 Ga0207678_10002590
432 Ga0207678_11004222
433 Ga0207702_10000349
434 Ga0207641_10000295
435 Ga0207641_10002521
436 Ga0207648_10837551
437 Ga0268266_10000369
438 Ga0268266_10240101
439 Ga0268264_10675838
440 Ga0265337_1002592
441 Ga0265326_10000056
442 Ga0265326_10021122
443 Ga0265319_1000037
444 Ga0265322_10000017
445 Ga0265338_10000051
446 Ga0265324_10001639
447 Ga0265332_10025178
448 Ga0265328_10000258
449 Ga0265320_10000068
450 Ga0265325_10009857
451 Ga0265329_10007182
452 Ga0265339_10054877
453 Ga0265331_10005995
454 Ga0265327_10000317
455 Ga0265316_10247311
456 Ga0265313_10397392
457 Ga0265314_10000973
458 Ga0265342_10132537
459 Ga0373935_1261429
460 Ga0373947_0314641
461 Ga0373937_1159080
462 Ga0451800_1239691
463 Ga0451807_1102958
464 Ga0451837_0068871
465 Ga0451839_0214419
466 Ga0451853_3625586
467 Ga0495592_0133213
468 Ga0495592_0149611
469 Ga0495592_0321645
470 Ga0495603_0000085
471 Ga0495603_0002488
472 Ga0495629_0021272
473 Ga0495638_0032677
474 Ga0495641_0175638
475 Ga0495651_0072853
476 Ga0495653_0015845
477 Ga0495653_0202919
478 Ga0495662_0000162
479 Ga0495608_0000042
480 Ga0495608_0002177
481 Ga0495628_0000548
482 Ga0495628_0085301
483 Ga0495644_0010007
484 Ga0495652_0007230
485 Ga0495640_0004849
486 Ga0495640_0008071
487 Ga0495640_0854791
488 Ga0495586_0001779
489 Ga0495587_0723163
490 Ga0495645_0005133
491 Ga0495645_0029697
492 Ga0495645_0277455
493 Ga0495633_0008184
494 Ga0495667_0000019
495 Ga0495667_0029763
496 Ga0495634_0000050
497 Ga0495635_0000017
498 Ga0495635_0323092
499 Ga0495657_0000040
500 Ga0495657_0013724
501 Ga0495623_0169208
502 Ga0495646_0368912
503 Ga0495647_0128336
504 Ga0495669_0123271
505 Ga0495669_0357185
506 Ga0495613_0000067
507 Ga0495613_0282568
508 Ga0495613_0331419
509 Ga0495670_0034498
510 Ga0495671_0371028
511 Ga0495600_0000376
512 Ga0495581_0126894
513 Ga0495674_0000024
514 Ga0495672_0267025
515 Ga0495676_0000928
516 Ga0495676_0004042
517 Ga0495676_0756675
518 Ga0495680_0001106
519 Ga0495680_0213008
520 Ga0495675_0000036
521 Ga0495675_0050692
522 Ga0495684_0037579
523 Ga0495686_0037368
524 Ga0495602_0018543
525 Ga0495602_0044758
526 Ga0496100_0000019
527 Ga0496100_0347873
528 Ga0496101_0000005
529 Ga0496102_0000021
530 Ga0496102_0025778
531 Ga0496102_0272015
532 Ga0496102_0340675
533 Ga0496103_0000001
534 Ga0496103_0047447
535 Ga0496104_0037124
536 Ga0496104_0918592
537 Ga0496105_0015739
538 Ga0496106_0000033
539 Ga0496106_0000107
540 Ga0496107_0000004
541 Ga0496107_0025196
542 Ga0496107_0202823
543 Ga0496108_0000133
544 Ga0496109_0000021
545 Ga0496111_0686194
546 Ga0496112_0000641
547 Ga0496113_0000002
548 Ga0496113_0550783
549 Ga0496113_1136917
550 Ga0496114_0000003
551 Ga0496114_0680558
552 Ga0496115_0000022
553 Ga0496115_0000027
554 Ga0496115_0028973
555 Ga0496115_0166967
556 Ga0496116_0000138
557 Ga0496117_0002715
558 Ga0496118_0005655
559 Ga0496118_0095630
560 Ga0496118_0218301
561 Ga0496119_0004108
562 Ga0496119_0079226
563 Ga0496120_0001479
564 Ga0496121_0065605
565 Ga0496121_0081139
566 Ga0496121_0234202
567 Ga0496124_0260962
568 Ga0496124_0429758
569 Ga0496126_0006956
570 Ga0496126_0007385
571 Ga0496126_0089751
572 Ga0501031_0000140
573 Ga0501032_0000313
574 Ga0501033_0000417
575 Ga0501034_0160597
576 Ga0501034_0692063
577 Ga0501034_0723995
578 Ga0501036_0000063
579 Ga0501037_0026921
580 Ga0501038_0000333
581 Ga0501039_0339283
582 Ga0501040_0051450
583 Ga0501042_0032598
584 Ga0501042_0045762
585 Ga0501043_0000499
586 Ga0501046_0000603
587 Ga0501047_0000686
588 Ga0501047_0002300
589 Ga0501047_0249314
590 Ga0501047_0279716
591 Ga0501047_0388910
592 Ga0501048_0000259
593 Ga0501068_0008747
594 Ga0501069_0107101
595 Ga0501069_0298767
596 Ga0501070_0000408
597 Ga0501070_0068718
598 Ga0501070_0118191
599 Ga0501070_0351820
600 Ga0501071_0095976
601 Ga0501071_0164426
602 Ga0501072_0386100
603 Ga0501072_0911374
604 Ga0501073_0019228
605 Ga0501074_0028746
606 Ga0501074_0328012
607 Ga0501074_0601606
608 Ga0501075_0536791
609 Ga0501076_0221783
610 Ga0501079_0004866
611 Ga0501079_0299378
612 Ga0501079_0320474
613 Ga0501080_0001807
614 Ga0501080_0237053
615 Ga0501081_0251041
616 Ga0501081_1543490
617 Ga0501083_0006427
618 Ga0501035_0000555
619 Ga0501035_0066415
620 Ga0501035_0373141
621 Ga0501044_0000817
622 Ga0501044_0097108
623 Ga0501044_1140704
624 Ga0501045_0396378
625 Ga0495601_0021535
626 Ga0495601_0044289
627 Ga0495601_0177225
628 Ga0495601_0643229
629 Ga0495655_0000008
630 Ga0495595_0000009
631 Ga0495595_0000831
632 Ga0495595_0146108
633 Ga0495619_0000022
634 Ga0495619_0000032
635 Ga0495619_0000057
636 Ga0500566_0045766
637 Ga0500566_0502934
638 Ga0500641_0009985
639 Ga0500628_000023
640 Ga0501082_0003663

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2phd-assembly1.cif.gz_B crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.902 31 107
4fbf-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant 0.8939 31 107
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.8935 31 106
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.892 30 110
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.8917 31 111
ID Description Score Start End Superfamily
5jspB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8911 31 111 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8909 29 107 2.60.120.10
3rnsA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8896 31 107 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8873 31 107 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8853 29 110 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538D490-F1-model_v4 Cupin domain-containing protein 0.9377 1 109
AF-A0A538A090-F1-model_v4 Cupin domain-containing protein 0.9357 1 130
AF-A0A838V4N6-F1-model_v4 Cupin domain-containing protein 0.9339 1 131
AF-A0A537W3R4-F1-model_v4 Cupin domain-containing protein 0.9317 1 123
AF-A0A7C6Z1M3-F1-model_v4 Cupin domain-containing protein 0.9293 32 108

Map