F405619

General Info

Members Datasets Scaffolds Average Seq Length
320 186 640 368

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0462571|Ga0373937_0462571_19_1125
Length 351
Sequence MTSIWDLANAQLRDLAVYEPGKPIEETARELGIDPAEIVKLASNENPLGPSPKAIQAMHAALENAHLYPDGSGFHLCNAIAAKLGLQPENVILGNGSNEIIEFLGHAFLNPGDDVITCQYAFIVYKLLATAFGVHTIETPSPDYQQNLDATLEAITPKTRLIFIPNPNNPTGTLVFQSAIDDFMSQVPDSILVRYIGERRNVVVLRTFSKIHGLAGLRIGYAVAPSEIIEVLHKTRQPFNVNSIALAGALAALDDEGHLRETKRVVDEGRAYLQQQFAEMRIRFVPAVANFVMVNVGDGGAVFEKLLKRKIIVRPLKGYGLPDWVRISVGTMEENRKLIAALREVRALRID

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 4.69
Rhizosphere 94.69
Stem 0
Stem Tuber 0
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0462571 3300036401 Bacteria 1205
2 CNXas_1000096 3300000545 Bacteria 16119
3 JGI24738J21930_10012830 3300002075 Unclassified 1824
4 JGI24035J26624_1000472 3300002126 Bacteria 3774
5 JGI24033J26618_1000010 3300002155 Bacteria 35433
6 JGI25405J52794_10000358 3300003911 Bacteria 6419
7 Ga0065712_10008005 3300005290 Bacteria 2303
8 Ga0065715_10098807 3300005293 Bacteria 3489
9 Ga0065715_10103049 3300005293 Bacteria 3060
10 Ga0070676_10000102 3300005328 Bacteria 30448
11 Ga0070676_10088802 3300005328 Bacteria 1889
12 Ga0070683_100006421 3300005329 Bacteria 9859
13 Ga0070690_100021580 3300005330 Bacteria 3933
14 Ga0070670_100033459 3300005331 Bacteria 4427
15 Ga0070670_100047279 3300005331 Bacteria 3702
16 Ga0070670_100134771 3300005331 Bacteria 2134
17 Ga0070670_100141896 3300005331 Bacteria 2077
18 Ga0068869_100014586 3300005334 Bacteria 5254
19 Ga0070666_10032054 3300005335 Bacteria 3471
20 Ga0070666_10036703 3300005335 Bacteria 3254
21 Ga0070682_100019968 3300005337 Bacteria 3937
22 Ga0068868_100073818 3300005338 Bacteria 2724
23 Ga0068868_100136269 3300005338 Bacteria 2013
24 Ga0070660_100025860 3300005339 Bacteria 4366
25 Ga0070689_100003232 3300005340 Bacteria 10801
26 Ga0070689_100007470 3300005340 Bacteria 7645
27 Ga0070687_100000123 3300005343 Bacteria 26561
28 Ga0070661_100009572 3300005344 Bacteria 6712
29 Ga0070661_100132910 3300005344 Bacteria 1870
30 Ga0070668_100004418 3300005347 Bacteria 10435
31 Ga0070668_100005768 3300005347 Bacteria 9185
32 Ga0070668_100158896 3300005347 Bacteria 1833
33 Ga0070669_100005613 3300005353 Bacteria 9068
34 Ga0070675_100001509 3300005354 Bacteria 17186
35 Ga0070675_100001676 3300005354 Bacteria 16335
36 Ga0070675_100010370 3300005354 Bacteria 7278
37 Ga0070675_100025161 3300005354 Bacteria 4771
38 Ga0070675_100033760 3300005354 Bacteria 4149
39 Ga0070675_100103203 3300005354 Bacteria 2404
40 Ga0070671_100003452 3300005355 Bacteria 12336
41 Ga0070671_100033347 3300005355 Bacteria 4257
42 Ga0070671_100101368 3300005355 Unclassified 2415
43 Ga0070674_100025103 3300005356 Bacteria 3875
44 Ga0070674_100081973 3300005356 Bacteria 2306
45 Ga0070674_100088738 3300005356 Unclassified 2226
46 Ga0070673_100016905 3300005364 Bacteria 5173
47 Ga0070688_100013500 3300005365 Bacteria 4608
48 Ga0070688_100021665 3300005365 Bacteria 3756
49 Ga0070688_100106061 3300005365 Bacteria 1861
50 Ga0070659_100015726 3300005366 Bacteria 5669
51 Ga0070667_100004078 3300005367 Bacteria 12355
52 Ga0070667_100006719 3300005367 Bacteria 9558
53 Ga0070667_100045831 3300005367 Bacteria 3678
54 Ga0070667_100097645 3300005367 Bacteria 2534
55 Ga0070703_10006267 3300005406 Unclassified 3332
56 Ga0070714_100168490 3300005435 Bacteria 1986
57 Ga0070713_100220898 3300005436 Unclassified 1719
58 Ga0070701_10096792 3300005438 Bacteria 1628
59 Ga0070711_100030348 3300005439 Bacteria 3577
60 Ga0070705_100034150 3300005440 Bacteria 2841
61 Ga0070708_100017401 3300005445 Bacteria 5994
62 Ga0070708_100021891 3300005445 Bacteria 5415
63 Ga0070708_100068949 3300005445 Bacteria 3180
64 Ga0070708_100111274 3300005445 Bacteria 2517
65 Ga0070708_100159705 3300005445 Bacteria 2100
66 Ga0070678_100025170 3300005456 Bacteria 3999
67 Ga0070662_100000862 3300005457 Bacteria 18581
68 Ga0070662_100035072 3300005457 Bacteria 3541
69 Ga0070681_10012373 3300005458 Bacteria 8462
70 Ga0068867_100010897 3300005459 Bacteria 6411
71 Ga0070685_10025995 3300005466 Bacteria 3225
72 Ga0070706_100032229 3300005467 Bacteria 4834
73 Ga0070706_100053765 3300005467 Bacteria 3717
74 Ga0070706_100073398 3300005467 Bacteria 3167
75 Ga0070707_100020816 3300005468 Bacteria 6192
76 Ga0070707_100021564 3300005468 Bacteria 6090
77 Ga0070707_100042147 3300005468 Bacteria 4369
78 Ga0070707_100062172 3300005468 Bacteria 3582
79 Ga0070707_100423241 3300005468 Bacteria 1292
80 Ga0070698_100028154 3300005471 Bacteria 5839
81 Ga0070698_100092698 3300005471 Bacteria 3001
82 Ga0070699_100196610 3300005518 Bacteria 1793
83 Ga0070679_100113461 3300005530 Bacteria 2695
84 Ga0070684_100001900 3300005535 Bacteria 15309
85 Ga0070684_100054963 3300005535 Bacteria 3469
86 Ga0070684_100130214 3300005535 Bacteria 2269
87 Ga0070697_100000699 3300005536 Bacteria 25148
88 Ga0070697_100002455 3300005536 Bacteria 14267
89 Ga0070697_100055891 3300005536 Bacteria 3210
90 Ga0070697_100119358 3300005536 Unclassified 2204
91 Ga0070697_100268695 3300005536 Bacteria 1461
92 Ga0068853_100000013 3300005539 Bacteria 227585
93 Ga0070672_100044495 3300005543 Bacteria 3429
94 Ga0070672_100138263 3300005543 Bacteria 2007
95 Ga0070672_100162298 3300005543 Bacteria 1855
96 Ga0070696_100145640 3300005546 Bacteria 1735
97 Ga0070665_100016404 3300005548 Bacteria 7429
98 Ga0070665_100062235 3300005548 Bacteria 3742
99 Ga0070665_100068176 3300005548 Bacteria 3567
100 Ga0070665_100070652 3300005548 Bacteria 3498
101 Ga0070704_100004809 3300005549 Bacteria 7824
102 Ga0070664_100038240 3300005564 Bacteria 4039
103 Ga0070664_100047580 3300005564 Bacteria 3623
104 Ga0070664_100123490 3300005564 Bacteria 2269
105 Ga0068859_100054800 3300005617 Bacteria 4012
106 Ga0068861_100091867 3300005719 Bacteria 2397
107 Ga0068863_100005228 3300005841 Bacteria 12808
108 Ga0068858_100042147 3300005842 Bacteria 4232
109 Ga0068860_100008656 3300005843 Bacteria 10139
110 Ga0068860_100024922 3300005843 Bacteria 5775
111 Ga0068860_100225345 3300005843 Bacteria 1821
112 Ga0068862_100001334 3300005844 Bacteria 22915
113 Ga0081455_10002369 3300005937 Bacteria 22508
114 Ga0081455_10006973 3300005937 Bacteria 12007
115 Ga0081455_10026403 3300005937 Bacteria 5342
116 Ga0081540_1046166 3300005983 Bacteria 2202
117 Ga0081539_10016396 3300005985 Bacteria 5295
118 Ga0070717_10017380 3300006028 Bacteria 5598
119 Ga0070717_10028783 3300006028 Bacteria 4451
120 Ga0070717_10238431 3300006028 Bacteria 1603
121 Ga0070716_100017364 3300006173 Bacteria 3730
122 Ga0070712_100014965 3300006175 Bacteria 4987
123 Ga0070712_100021445 3300006175 Bacteria 4243
124 Ga0070712_100199834 3300006175 Bacteria 1570
125 Ga0097621_100057067 3300006237 Bacteria 3192
126 Ga0097621_100114623 3300006237 Bacteria 2280
127 Ga0068871_100018219 3300006358 Bacteria 5332
128 Ga0068871_100100238 3300006358 Bacteria 2426
129 Ga0068871_100106275 3300006358 Bacteria 2356
130 Ga0068871_100202359 3300006358 Bacteria 1715
131 Ga0097620_100054800 3300006931 Bacteria 4012
132 Ga0105240_10000022 3300009093 Bacteria 387911
133 Ga0105245_10029524 3300009098 Bacteria 4845
134 Ga0105245_10330668 3300009098 Bacteria 1504
135 Ga0105247_10094455 3300009101 Bacteria 1903
136 Ga0114129_10458293 3300009147 Bacteria 1671
137 Ga0105242_10051090 3300009176 Bacteria 3368
138 Ga0105249_10001415 3300009553 Bacteria 20985
139 Ga0105249_10023453 3300009553 Bacteria 5537
140 Ga0099796_10034577 3300010159 Unclassified 1670
141 Ga0105239_10033502 3300010375 Bacteria 5641
142 Ga0105239_10060497 3300010375 Bacteria 4157
143 Ga0105239_10487750 3300010375 Bacteria 1400
144 Ga0157369_10065847 3300013105 Bacteria 3899
145 Ga0157374_10012708 3300013296 Bacteria 7334
146 Ga0157374_10015170 3300013296 Bacteria 6758
147 Ga0157374_10145503 3300013296 Unclassified 2302
148 Ga0157374_10192325 3300013296 Bacteria 1996
149 Ga0157374_10243527 3300013296 Bacteria 1769
150 Ga0157374_10250168 3300013296 Bacteria 1744
151 Ga0157378_10034506 3300013297 Bacteria 4474
152 Ga0157378_10178379 3300013297 Bacteria 1997
153 Ga0163162_10000891 3300013306 Bacteria 27780
154 Ga0163162_10042339 3300013306 Bacteria 4558
155 Ga0163162_10052152 3300013306 Bacteria 4108
156 Ga0163162_10114087 3300013306 Bacteria 2801
157 Ga0163162_10402212 3300013306 Unclassified 1502
158 Ga0157372_10049386 3300013307 Bacteria 4678
159 Ga0157375_10002826 3300013308 Bacteria 15025
160 Ga0157375_10007777 3300013308 Bacteria 9376
161 Ga0157375_10012066 3300013308 Bacteria 7653
162 Ga0157375_10021393 3300013308 Bacteria 5929
163 Ga0157375_10082236 3300013308 Bacteria 3262
164 Ga0157375_10134129 3300013308 Bacteria 2598
165 Ga0157375_10235122 3300013308 Bacteria 1992
166 Ga0163163_10257126 3300014325 Bacteria 1797
167 Ga0182008_10085127 3300014497 Bacteria 1557
168 Ga0157379_10045407 3300014968 Bacteria 3921
169 Ga0157376_10005777 3300014969 Bacteria 8668
170 Ga0157376_10265863 3300014969 Bacteria 1609
171 Ga0207666_1001650 3300025271 Bacteria 2649
172 Ga0207673_1000745 3300025290 Bacteria 3501
173 Ga0207697_10000140 3300025315 Bacteria 34959
174 Ga0207697_10002317 3300025315 Bacteria 9916
175 Ga0207697_10003605 3300025315 Bacteria 7590
176 Ga0207697_10003930 3300025315 Bacteria 7231
177 Ga0207697_10014354 3300025315 Unclassified 3286
178 Ga0207697_10015338 3300025315 Bacteria 3167
179 Ga0207692_10052317 3300025898 Bacteria 2075
180 Ga0207688_10017345 3300025901 Bacteria 3912
181 Ga0207688_10041968 3300025901 Bacteria 2546
182 Ga0207680_10012003 3300025903 Bacteria 4400
183 Ga0207647_10006697 3300025904 Bacteria 8372
184 Ga0207647_10039697 3300025904 Bacteria 2968
185 Ga0207645_10000302 3300025907 Bacteria 41340
186 Ga0207645_10094683 3300025907 Bacteria 1923
187 Ga0207684_10002263 3300025910 Bacteria 19612
188 Ga0207684_10021438 3300025910 Bacteria 5517
189 Ga0207684_10069823 3300025910 Unclassified 2985
190 Ga0207684_10084447 3300025910 Unclassified 2704
191 Ga0207684_10143067 3300025910 Bacteria 2057
192 Ga0207707_10092280 3300025912 Bacteria 2646
193 Ga0207695_10000022 3300025913 Bacteria 659090
194 Ga0207693_10008644 3300025915 Bacteria 8332
195 Ga0207693_10008910 3300025915 Bacteria 8194
196 Ga0207693_10023047 3300025915 Bacteria 4945
197 Ga0207693_10103558 3300025915 Bacteria 2232
198 Ga0207693_10226614 3300025915 Bacteria 1468
199 Ga0207660_10039603 3300025917 Bacteria 3295
200 Ga0207662_10000172 3300025918 Bacteria 30802
201 Ga0207657_10029626 3300025919 Bacteria 4980
202 Ga0207657_10038768 3300025919 Bacteria 4238
203 Ga0207657_10069028 3300025919 Bacteria 3001
204 Ga0207649_10014242 3300025920 Bacteria 4451
205 Ga0207646_10009561 3300025922 Bacteria 9569
206 Ga0207646_10037232 3300025922 Bacteria 4387
207 Ga0207646_10043076 3300025922 Bacteria 4054
208 Ga0207646_10079356 3300025922 Bacteria 2934
209 Ga0207646_10104100 3300025922 Bacteria 2545
210 Ga0207681_10003493 3300025923 Bacteria 9788
211 Ga0207681_10088788 3300025923 Unclassified 2202
212 Ga0207681_10091336 3300025923 Bacteria 2175
213 Ga0207650_10071014 3300025925 Bacteria 2618
214 Ga0207659_10004133 3300025926 Bacteria 8762
215 Ga0207659_10011962 3300025926 Bacteria 5499
216 Ga0207659_10042998 3300025926 Bacteria 3170
217 Ga0207687_10007733 3300025927 Bacteria 7050
218 Ga0207644_10018630 3300025931 Bacteria 4699
219 Ga0207644_10126761 3300025931 Bacteria 1949
220 Ga0207690_10088475 3300025932 Unclassified 2182
221 Ga0207706_10000429 3300025933 Bacteria 45047
222 Ga0207670_10002990 3300025936 Bacteria 8921
223 Ga0207670_10027388 3300025936 Bacteria 3602
224 Ga0207704_10100795 3300025938 Bacteria 1924
225 Ga0207665_10045845 3300025939 Bacteria 2928
226 Ga0207665_10103372 3300025939 Bacteria 1993
227 Ga0207665_10109770 3300025939 Unclassified 1937
228 Ga0207665_10116504 3300025939 Bacteria 1883
229 Ga0207691_10002835 3300025940 Bacteria 16888
230 Ga0207691_10069869 3300025940 Bacteria 3172
231 Ga0207689_10007482 3300025942 Bacteria 9571
232 Ga0207661_10112518 3300025944 Bacteria 2305
233 Ga0207679_10046134 3300025945 Bacteria 3157
234 Ga0207679_10059469 3300025945 Bacteria 2836
235 Ga0207651_10240350 3300025960 Bacteria 1475
236 Ga0207712_10027624 3300025961 Bacteria 3790
237 Ga0207668_10017508 3300025972 Bacteria 4489
238 Ga0207658_10021711 3300025986 Bacteria 4460
239 Ga0207658_10033606 3300025986 Bacteria 3660
240 Ga0207658_10068890 3300025986 Bacteria 2671
241 Ga0207677_10053722 3300026023 Bacteria 2744
242 Ga0207677_10061332 3300026023 Bacteria 2604
243 Ga0207677_10105686 3300026023 Bacteria 2084
244 Ga0207677_10350351 3300026023 Bacteria 1237
245 Ga0207703_10091984 3300026035 Bacteria 2552
246 Ga0207639_10000004 3300026041 Bacteria 698784
247 Ga0207678_10049818 3300026067 Bacteria 3620
248 Ga0207708_10013495 3300026075 Bacteria 6108
249 Ga0207702_10032300 3300026078 Bacteria 4368
250 Ga0207641_10190347 3300026088 Unclassified 1885
251 Ga0207648_10004467 3300026089 Bacteria 14350
252 Ga0207683_10013963 3300026121 Bacteria 6849
253 Ga0207683_10246850 3300026121 Bacteria 1629
254 Ga0268266_10014767 3300028379 Bacteria 6708
255 Ga0268266_10074485 3300028379 Bacteria 2948
256 Ga0268265_10101926 3300028380 Bacteria 2320
257 Ga0268264_10015614 3300028381 Bacteria 6223
258 Ga0268264_10033391 3300028381 Bacteria 4226
259 Ga0265327_10012078 3300031251 Bacteria 5865
260 Ga0373925_0074228 3300037068 Unclassified 2576
261 Ga0395900_0000828 3300037418 Bacteria 40820
262 Ga0395900_0128694 3300037418 Unclassified 2596
263 Ga0395905_0005117 3300037471 Bacteria 13475
264 Ga0395901_0001283 3300038443 Bacteria 26643
265 Ga0395901_0085077 3300038443 Bacteria 3306
266 Ga0436361_1098437 3300039447 Bacteria 2854
267 Ga0439448_0032570 3300042005 Bacteria 1659
268 Ga0439455_0002584 3300042012 Bacteria 3319
269 Ga0439458_0003659 3300042157 Bacteria 3575
270 Ga0466971_0000011 3300044719 Bacteria 101185
271 Ga0466957_0041784 3300044842 Bacteria 2772
272 Ga0451576_0004907 3300045051 Bacteria 17068
273 Ga0495651_0258068 3300046462 Bacteria 1187
274 Ga0495639_0021913 3300046475 Bacteria 2800
275 Ga0495664_0162961 3300046477 Bacteria 1353
276 Ga0495618_0115429 3300046514 Bacteria 1719
277 Ga0495630_0107838 3300046517 Bacteria 2109
278 Ga0495630_0279070 3300046517 Bacteria 1276
279 Ga0495643_0000331 3300046522 Bacteria 64586
280 Ga0495652_0132423 3300046529 Unclassified 1972
281 Ga0495652_0147448 3300046529 Bacteria 1842
282 Ga0495586_0037092 3300046535 Bacteria 2616
283 Ga0495634_0058304 3300046642 Bacteria 2574
284 Ga0495635_0063466 3300046663 Bacteria 2537
285 Ga0495658_0015146 3300046683 Bacteria 3953
286 Ga0495604_0163966 3300047317 Bacteria 1568
287 Ga0495674_0284675 3300047319 Unclassified 1353
288 Ga0495684_0030742 3300047471 Bacteria 4123
289 Ga0496101_0057552 3300048904 Bacteria 2812
290 Ga0496102_0017388 3300048905 Bacteria 6299
291 Ga0496104_0108649 3300048907 Bacteria 2659
292 Ga0496104_0203326 3300048907 Unclassified 1892
293 Ga0496105_0074518 3300048908 Bacteria 2804
294 Ga0496107_0105339 3300048910 Bacteria 2070
295 Ga0496108_0077187 3300048911 Bacteria 2817
296 Ga0496108_0139064 3300048911 Bacteria 2092
297 Ga0496109_0008880 3300048912 Bacteria 8559
298 Ga0496112_0184541 3300048915 Bacteria 2050
299 Ga0496113_0207640 3300048916 Bacteria 1558
300 Ga0496115_0030297 3300048918 Bacteria 4256
301 Ga0496115_0064878 3300048918 Bacteria 2949
302 Ga0496115_0125690 3300048918 Bacteria 2112
303 Ga0496115_0182688 3300048918 Bacteria 1733
304 Ga0496125_0000017 3300048928 Bacteria 508217
305 Ga0501032_0017516 3300049569 Bacteria 5029
306 Ga0501033_0000046 3300049570 Bacteria 124370
307 Ga0501038_0007098 3300049574 Bacteria 10346
308 Ga0501039_0004519 3300049575 Bacteria 10507
309 Ga0501043_0001934 3300049579 Bacteria 17735
310 Ga0501047_0039012 3300049581 Bacteria 4594
311 Ga0501067_0007999 3300049583 Bacteria 5872
312 Ga0501068_0100311 3300049584 Bacteria 1794
313 Ga0501070_0084424 3300049586 Bacteria 2629
314 Ga0501074_0261013 3300049590 Bacteria 1232
315 Ga0501035_0000018 3300049822 Bacteria 241543
316 nmdc:mga05p37_4122_c1 3300050507 Bacteria 16992
317 nmdc:mga05p37_66946_c1 3300050507 Bacteria 4418
318 nmdc:mga0rr50_290679_c1 3300050513 Bacteria 1365
319 Ga0500616_0003931 3300053153 Bacteria 10912
320 Ga0466962_0000019 3300061719 Bacteria 94988
321 Ga0373937_0462571
322 CNXas_1000096
323 JGI24738J21930_10012830
324 JGI24035J26624_1000472
325 JGI24033J26618_1000010
326 JGI25405J52794_10000358
327 Ga0065712_10008005
328 Ga0065715_10098807
329 Ga0065715_10103049
330 Ga0070676_10000102
331 Ga0070676_10088802
332 Ga0070683_100006421
333 Ga0070690_100021580
334 Ga0070670_100033459
335 Ga0070670_100047279
336 Ga0070670_100134771
337 Ga0070670_100141896
338 Ga0068869_100014586
339 Ga0070666_10032054
340 Ga0070666_10036703
341 Ga0070682_100019968
342 Ga0068868_100073818
343 Ga0068868_100136269
344 Ga0070660_100025860
345 Ga0070689_100003232
346 Ga0070689_100007470
347 Ga0070687_100000123
348 Ga0070661_100009572
349 Ga0070661_100132910
350 Ga0070668_100004418
351 Ga0070668_100005768
352 Ga0070668_100158896
353 Ga0070669_100005613
354 Ga0070675_100001509
355 Ga0070675_100001676
356 Ga0070675_100010370
357 Ga0070675_100025161
358 Ga0070675_100033760
359 Ga0070675_100103203
360 Ga0070671_100003452
361 Ga0070671_100033347
362 Ga0070671_100101368
363 Ga0070674_100025103
364 Ga0070674_100081973
365 Ga0070674_100088738
366 Ga0070673_100016905
367 Ga0070688_100013500
368 Ga0070688_100021665
369 Ga0070688_100106061
370 Ga0070659_100015726
371 Ga0070667_100004078
372 Ga0070667_100006719
373 Ga0070667_100045831
374 Ga0070667_100097645
375 Ga0070703_10006267
376 Ga0070714_100168490
377 Ga0070713_100220898
378 Ga0070701_10096792
379 Ga0070711_100030348
380 Ga0070705_100034150
381 Ga0070708_100017401
382 Ga0070708_100021891
383 Ga0070708_100068949
384 Ga0070708_100111274
385 Ga0070708_100159705
386 Ga0070678_100025170
387 Ga0070662_100000862
388 Ga0070662_100035072
389 Ga0070681_10012373
390 Ga0068867_100010897
391 Ga0070685_10025995
392 Ga0070706_100032229
393 Ga0070706_100053765
394 Ga0070706_100073398
395 Ga0070707_100020816
396 Ga0070707_100021564
397 Ga0070707_100042147
398 Ga0070707_100062172
399 Ga0070707_100423241
400 Ga0070698_100028154
401 Ga0070698_100092698
402 Ga0070699_100196610
403 Ga0070679_100113461
404 Ga0070684_100001900
405 Ga0070684_100054963
406 Ga0070684_100130214
407 Ga0070697_100000699
408 Ga0070697_100002455
409 Ga0070697_100055891
410 Ga0070697_100119358
411 Ga0070697_100268695
412 Ga0068853_100000013
413 Ga0070672_100044495
414 Ga0070672_100138263
415 Ga0070672_100162298
416 Ga0070696_100145640
417 Ga0070665_100016404
418 Ga0070665_100062235
419 Ga0070665_100068176
420 Ga0070665_100070652
421 Ga0070704_100004809
422 Ga0070664_100038240
423 Ga0070664_100047580
424 Ga0070664_100123490
425 Ga0068859_100054800
426 Ga0068861_100091867
427 Ga0068863_100005228
428 Ga0068858_100042147
429 Ga0068860_100008656
430 Ga0068860_100024922
431 Ga0068860_100225345
432 Ga0068862_100001334
433 Ga0081455_10002369
434 Ga0081455_10006973
435 Ga0081455_10026403
436 Ga0081540_1046166
437 Ga0081539_10016396
438 Ga0070717_10017380
439 Ga0070717_10028783
440 Ga0070717_10238431
441 Ga0070716_100017364
442 Ga0070712_100014965
443 Ga0070712_100021445
444 Ga0070712_100199834
445 Ga0097621_100057067
446 Ga0097621_100114623
447 Ga0068871_100018219
448 Ga0068871_100100238
449 Ga0068871_100106275
450 Ga0068871_100202359
451 Ga0097620_100054800
452 Ga0105240_10000022
453 Ga0105245_10029524
454 Ga0105245_10330668
455 Ga0105247_10094455
456 Ga0114129_10458293
457 Ga0105242_10051090
458 Ga0105249_10001415
459 Ga0105249_10023453
460 Ga0099796_10034577
461 Ga0105239_10033502
462 Ga0105239_10060497
463 Ga0105239_10487750
464 Ga0157369_10065847
465 Ga0157374_10012708
466 Ga0157374_10015170
467 Ga0157374_10145503
468 Ga0157374_10192325
469 Ga0157374_10243527
470 Ga0157374_10250168
471 Ga0157378_10034506
472 Ga0157378_10178379
473 Ga0163162_10000891
474 Ga0163162_10042339
475 Ga0163162_10052152
476 Ga0163162_10114087
477 Ga0163162_10402212
478 Ga0157372_10049386
479 Ga0157375_10002826
480 Ga0157375_10007777
481 Ga0157375_10012066
482 Ga0157375_10021393
483 Ga0157375_10082236
484 Ga0157375_10134129
485 Ga0157375_10235122
486 Ga0163163_10257126
487 Ga0182008_10085127
488 Ga0157379_10045407
489 Ga0157376_10005777
490 Ga0157376_10265863
491 Ga0207666_1001650
492 Ga0207673_1000745
493 Ga0207697_10000140
494 Ga0207697_10002317
495 Ga0207697_10003605
496 Ga0207697_10003930
497 Ga0207697_10014354
498 Ga0207697_10015338
499 Ga0207692_10052317
500 Ga0207688_10017345
501 Ga0207688_10041968
502 Ga0207680_10012003
503 Ga0207647_10006697
504 Ga0207647_10039697
505 Ga0207645_10000302
506 Ga0207645_10094683
507 Ga0207684_10002263
508 Ga0207684_10021438
509 Ga0207684_10069823
510 Ga0207684_10084447
511 Ga0207684_10143067
512 Ga0207707_10092280
513 Ga0207695_10000022
514 Ga0207693_10008644
515 Ga0207693_10008910
516 Ga0207693_10023047
517 Ga0207693_10103558
518 Ga0207693_10226614
519 Ga0207660_10039603
520 Ga0207662_10000172
521 Ga0207657_10029626
522 Ga0207657_10038768
523 Ga0207657_10069028
524 Ga0207649_10014242
525 Ga0207646_10009561
526 Ga0207646_10037232
527 Ga0207646_10043076
528 Ga0207646_10079356
529 Ga0207646_10104100
530 Ga0207681_10003493
531 Ga0207681_10088788
532 Ga0207681_10091336
533 Ga0207650_10071014
534 Ga0207659_10004133
535 Ga0207659_10011962
536 Ga0207659_10042998
537 Ga0207687_10007733
538 Ga0207644_10018630
539 Ga0207644_10126761
540 Ga0207690_10088475
541 Ga0207706_10000429
542 Ga0207670_10002990
543 Ga0207670_10027388
544 Ga0207704_10100795
545 Ga0207665_10045845
546 Ga0207665_10103372
547 Ga0207665_10109770
548 Ga0207665_10116504
549 Ga0207691_10002835
550 Ga0207691_10069869
551 Ga0207689_10007482
552 Ga0207661_10112518
553 Ga0207679_10046134
554 Ga0207679_10059469
555 Ga0207651_10240350
556 Ga0207712_10027624
557 Ga0207668_10017508
558 Ga0207658_10021711
559 Ga0207658_10033606
560 Ga0207658_10068890
561 Ga0207677_10053722
562 Ga0207677_10061332
563 Ga0207677_10105686
564 Ga0207677_10350351
565 Ga0207703_10091984
566 Ga0207639_10000004
567 Ga0207678_10049818
568 Ga0207708_10013495
569 Ga0207702_10032300
570 Ga0207641_10190347
571 Ga0207648_10004467
572 Ga0207683_10013963
573 Ga0207683_10246850
574 Ga0268266_10014767
575 Ga0268266_10074485
576 Ga0268265_10101926
577 Ga0268264_10015614
578 Ga0268264_10033391
579 Ga0265327_10012078
580 Ga0373925_0074228
581 Ga0395900_0000828
582 Ga0395900_0128694
583 Ga0395905_0005117
584 Ga0395901_0001283
585 Ga0395901_0085077
586 Ga0436361_1098437
587 Ga0439448_0032570
588 Ga0439455_0002584
589 Ga0439458_0003659
590 Ga0466971_0000011
591 Ga0466957_0041784
592 Ga0451576_0004907
593 Ga0495651_0258068
594 Ga0495639_0021913
595 Ga0495664_0162961
596 Ga0495618_0115429
597 Ga0495630_0107838
598 Ga0495630_0279070
599 Ga0495643_0000331
600 Ga0495652_0132423
601 Ga0495652_0147448
602 Ga0495586_0037092
603 Ga0495634_0058304
604 Ga0495635_0063466
605 Ga0495658_0015146
606 Ga0495604_0163966
607 Ga0495674_0284675
608 Ga0495684_0030742
609 Ga0496101_0057552
610 Ga0496102_0017388
611 Ga0496104_0108649
612 Ga0496104_0203326
613 Ga0496105_0074518
614 Ga0496107_0105339
615 Ga0496108_0077187
616 Ga0496108_0139064
617 Ga0496109_0008880
618 Ga0496112_0184541
619 Ga0496113_0207640
620 Ga0496115_0030297
621 Ga0496115_0064878
622 Ga0496115_0125690
623 Ga0496115_0182688
624 Ga0496125_0000017
625 Ga0501032_0017516
626 Ga0501033_0000046
627 Ga0501038_0007098
628 Ga0501039_0004519
629 Ga0501043_0001934
630 Ga0501047_0039012
631 Ga0501067_0007999
632 Ga0501068_0100311
633 Ga0501070_0084424
634 Ga0501074_0261013
635 Ga0501035_0000018
636 nmdc:mga05p37_4122_c1
637 nmdc:mga05p37_66946_c1
638 nmdc:mga0rr50_290679_c1
639 Ga0500616_0003931
640 Ga0466962_0000019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

36

193

0.94

PF00155

Aminotran_1_2

Aminotransferase class I and II

174

342

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ly1-assembly1.cif.gz_B crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution 0.9378 36 361
3ffh-assembly1.cif.gz_A the crystal structure of histidinol-phosphate aminotransferase from listeria innocua clip11262. 0.9365 9 362
3get-assembly1.cif.gz_A crystal structure of putative histidinol-phosphate aminotransferase (np_281508.1) from campylobacter jejuni at 2.01 a resolution 0.9345 8 364
4r5z-assembly2.cif.gz_D crystal structure of rv3772 encoded aminotransferase 0.9342 8 363
3ffh-assembly1.cif.gz_B the crystal structure of histidinol-phosphate aminotransferase from listeria innocua clip11262. 0.9332 9 362
ID Description Score Start End Superfamily
af_Q2G087_68_261_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9782 77 266 3.40.640.10
4r5zC02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9624 50 270 3.40.640.10
af_Q2G087_68_261_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9535 77 266 3.40.640.10
af_P9WML5_24_353_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9494 39 363 3.50.50.60
af_Q58365_68_273_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9418 66 267 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A2V6DZ21-F1-model_v4 Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) 0.9824 2 364 GO:0000105
GO:0004400
GO:0030170
AF-A0A2V7HR31-F1-model_v4 Histidinol-phosphate transaminase (EC 2.6.1.9) 0.9809 72 360 GO:0004400
GO:0009058
GO:0030170
AF-A0A661T615-F1-model_v4 Histidinol-phosphate transaminase (EC 2.6.1.9) 0.9807 66 362 GO:0000105
GO:0004400
GO:0030170
AF-A0A1C7HD83-F1-model_v4 deleted 0.979 1 362
AF-A0A6M0K5Q0-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9784 38 363 GO:0008483
GO:0009058
GO:0030170

Map