F405602

General Info

Members Datasets Scaffolds Average Seq Length
320 168 640 198

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10198722|Ga0307407_101987221
Length 221
Sequence VAAHRRNPALAYSDLMVARHETHPGNAAAAGPAEFRAAVESMRRASLRPEVFCEEMPAPQRIAPWSSALSGDVTVDEEDLGTGRLILLHDPAGNDAWDGTFRCVAYARADIDPELGADPMLAAVGWSWLVEALDAHGAGHHAASGTVTCVTTESFGGMADEDGTAQVEIRASWTPDVDEDGGLDMTAHVEAWGELMCTAVGLPPVPEGVTAIPSRRGQRGT

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
82 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
83 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
84 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
85 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
86 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
87 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
156 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
157 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 2643221561 Nocardioides sp. Root151 Isolate Unclassified
164 2643221696 Nocardioides sp. Root140 Isolate Unclassified
165 2739367898 Nocardioides sp. CF479 Isolate Unclassified
166 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
167 2919395869 Microbacterium resistens 2980 Isolate Unclassified
168 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0.31
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0.31
Rhizoplane 7.81
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10198722 3300031903 Bacteria 1342
2 LJQas_1002553 3300000549 Bacteria 2518
3 JGI24740J21852_10003944 3300001979 Bacteria 6440
4 JGI25154J39366_1002452 3300002738 Bacteria 4795
5 Ga0070658_10476448 3300005327 Bacteria 1077
6 Ga0070683_100053498 3300005329 Bacteria 3741
7 Ga0070670_100706528 3300005331 Bacteria 907
8 Ga0068868_100439822 3300005338 Bacteria 1132
9 Ga0068868_100478965 3300005338 Bacteria 1087
10 Ga0070687_100060822 3300005343 Bacteria 1994
11 Ga0070687_100115628 3300005343 Bacteria 1526
12 Ga0070668_100078733 3300005347 Bacteria 2578
13 Ga0070675_100768051 3300005354 Bacteria 880
14 Ga0070671_100536497 3300005355 Bacteria 1008
15 Ga0070674_100049234 3300005356 Bacteria 2896
16 Ga0070678_100617274 3300005456 Bacteria 969
17 Ga0068867_100172130 3300005459 Bacteria 1716
18 Ga0070706_100665462 3300005467 Bacteria 966
19 Ga0070707_100076272 3300005468 Bacteria 3234
20 Ga0070698_100110006 3300005471 Bacteria 2721
21 Ga0068857_100408070 3300005577 Bacteria 1265
22 Ga0068856_100536212 3300005614 Bacteria 1191
23 Ga0068852_100039204 3300005616 Bacteria 3988
24 Ga0068852_100414227 3300005616 Bacteria 1328
25 Ga0068864_100554873 3300005618 Bacteria 1111
26 Ga0068864_100692257 3300005618 Bacteria 995
27 Ga0068861_100133900 3300005719 Bacteria 2014
28 Ga0068861_100408575 3300005719 Bacteria 1207
29 Ga0068870_10036571 3300005840 Bacteria 2527
30 Ga0068858_100230393 3300005842 Bacteria 1756
31 Ga0075365_10000585 3300006038 Bacteria 14182
32 Ga0075365_10088657 3300006038 Bacteria 2105
33 Ga0075364_10110887 3300006051 Bacteria 1831
34 Ga0068865_100680189 3300006881 Bacteria 877
35 Ga0105245_10166087 3300009098 Bacteria 2098
36 Ga0105245_10169299 3300009098 Bacteria 2079
37 Ga0105245_10169389 3300009098 Bacteria 2079
38 Ga0105245_10182133 3300009098 Bacteria 2008
39 Ga0114129_10697049 3300009147 Bacteria 1305
40 Ga0105243_10099598 3300009148 Bacteria 2409
41 Ga0105248_10558653 3300009177 Bacteria 1291
42 Ga0105238_10333775 3300009551 Bacteria 1503
43 Ga0105238_10798869 3300009551 Bacteria 959
44 Ga0105239_11619877 3300010375 Bacteria 749
45 Ga0105246_10350650 3300011119 Bacteria 1209
46 Ga0105246_10361514 3300011119 Bacteria 1193
47 Ga0157369_10231604 3300013105 Bacteria 1931
48 Ga0157369_10504529 3300013105 Bacteria 1252
49 Ga0157372_10214224 3300013307 Bacteria 2232
50 Ga0157375_10028754 3300013308 Bacteria 5216
51 Ga0157375_10247539 3300013308 Bacteria 1943
52 Ga0157375_10290741 3300013308 Bacteria 1797
53 Ga0163163_10060062 3300014325 Bacteria 3763
54 Ga0163163_10088742 3300014325 Bacteria 3103
55 Ga0163163_10179827 3300014325 Bacteria 2162
56 Ga0157377_10146624 3300014745 Bacteria 1455
57 Ga0157376_10300103 3300014969 Bacteria 1520
58 Ga0163161_10078290 3300017792 Bacteria 2430
59 Ga0206354_10560591 3300020081 Bacteria 848
60 Ga0207682_10113906 3300025893 Bacteria 1193
61 Ga0207643_10036816 3300025908 Bacteria 2745
62 Ga0207662_10061229 3300025918 Bacteria 2259
63 Ga0207657_10218507 3300025919 Bacteria 1528
64 Ga0207646_10175443 3300025922 Bacteria 1936
65 Ga0207650_10377329 3300025925 Bacteria 1170
66 Ga0207687_10212592 3300025927 Bacteria 1518
67 Ga0207687_10400534 3300025927 Bacteria 1129
68 Ga0207644_10357759 3300025931 Bacteria 1187
69 Ga0207690_10063189 3300025932 Bacteria 2524
70 Ga0207690_11038371 3300025932 Bacteria 682
71 Ga0207669_10466452 3300025937 Bacteria 1004
72 Ga0207669_10558327 3300025937 Bacteria 925
73 Ga0207704_10201857 3300025938 Bacteria 1456
74 Ga0207689_10189306 3300025942 Bacteria 1697
75 Ga0207661_10395690 3300025944 Bacteria 1252
76 Ga0207679_10078497 3300025945 Bacteria 2515
77 Ga0207712_10270432 3300025961 Bacteria 1382
78 Ga0207668_10649486 3300025972 Bacteria 923
79 Ga0207677_10222503 3300026023 Bacteria 1515
80 Ga0207678_10550834 3300026067 Bacteria 1009
81 Ga0207708_10226663 3300026075 Bacteria 1499
82 Ga0207708_10986747 3300026075 Bacteria 731
83 Ga0207702_10278383 3300026078 Bacteria 1581
84 Ga0207641_10604945 3300026088 Bacteria 1074
85 Ga0207648_10076121 3300026089 Bacteria 2925
86 Ga0207648_10261727 3300026089 Bacteria 1544
87 Ga0207674_10341053 3300026116 Bacteria 1449
88 Ga0207675_100510544 3300026118 Bacteria 1197
89 Ga0207683_10124411 3300026121 Bacteria 2317
90 Ga0268265_10783803 3300028380 Bacteria 928
91 Ga0316183_1068223 3300030742 Bacteria 972
92 Ga0307405_10539593 3300031731 Bacteria 942
93 Ga0307413_10184026 3300031824 Bacteria 1493
94 Ga0307410_10130193 3300031852 Bacteria 1848
95 Ga0307406_10080000 3300031901 Bacteria 2169
96 Ga0307409_100266278 3300031995 Bacteria 1576
97 Ga0307416_100214765 3300032002 Bacteria 1839
98 Ga0307414_10382082 3300032004 Bacteria 1218
99 Ga0307414_10588934 3300032004 Bacteria 996
100 Ga0307415_100031860 3300032126 Bacteria 3403
101 Ga0307415_100075360 3300032126 Bacteria 2388
102 Ga0373931_0379692 3300035691 Bacteria 891
103 Ga0436364_0857252 3300037853 Bacteria 4143
104 Ga0451791_0005626 3300041451 Bacteria 709
105 Ga0451793_0237533 3300041452 Bacteria 873
106 Ga0451800_0280938 3300041459 Bacteria 910
107 Ga0451835_0485672 3300041492 Bacteria 892
108 Ga0451837_0150336 3300041494 Bacteria 1147
109 Ga0451837_0491570 3300041494 Bacteria 1950
110 Ga0451843_0210803 3300041509 Bacteria 766
111 Ga0451853_0156145 3300041512 Bacteria 996
112 Ga0451853_1590062 3300041512 Bacteria 1702
113 Ga0451853_1871461 3300041512 Bacteria 4494
114 Ga0451853_2768049 3300041512 Bacteria 777
115 Ga0466972_0083269 3300044658 Bacteria 1522
116 Ga0466972_0132577 3300044658 Bacteria 1173
117 Ga0466965_0065147 3300044683 Bacteria 1825
118 Ga0466965_0078060 3300044683 Bacteria 1672
119 Ga0466965_0084061 3300044683 Bacteria 1612
120 Ga0466965_0374808 3300044683 Bacteria 783
121 Ga0466966_0048048 3300044684 Bacteria 2719
122 Ga0466966_0068961 3300044684 Bacteria 2219
123 Ga0466966_0124023 3300044684 Bacteria 1585
124 Ga0466961_0035478 3300044693 Bacteria 3203
125 Ga0466961_0087834 3300044693 Bacteria 1964
126 Ga0466961_0318985 3300044693 Bacteria 948
127 Ga0466963_0651427 3300044694 Bacteria 743
128 Ga0466964_0023032 3300044706 Bacteria 2419
129 Ga0466964_0049934 3300044706 Bacteria 1714
130 Ga0466971_0155392 3300044719 Bacteria 1069
131 Ga0466970_0014097 3300044765 Bacteria 4099
132 Ga0466970_0040792 3300044765 Bacteria 2465
133 Ga0466970_0091541 3300044765 Bacteria 1651
134 Ga0466970_0124544 3300044765 Bacteria 1413
135 Ga0466970_0151247 3300044765 Bacteria 1281
136 Ga0466957_0721458 3300044842 Bacteria 704
137 Ga0466960_0011152 3300044901 Bacteria 3749
138 Ga0466960_0014012 3300044901 Bacteria 3419
139 Ga0466960_0029937 3300044901 Bacteria 2502
140 Ga0466960_0150282 3300044901 Bacteria 1244
141 Ga0466958_0126998 3300045836 Bacteria 1599
142 Ga0466967_0065771 3300045976 Bacteria 3228
143 Ga0466967_0079133 3300045976 Bacteria 2963
144 Ga0466967_1084500 3300045976 Bacteria 798
145 Ga0466967_1091677 3300045976 Bacteria 795
146 Ga0495653_0117250 3300046463 Bacteria 1902
147 Ga0495664_0030739 3300046477 Bacteria 3147
148 Ga0495635_0065322 3300046663 Bacteria 2497
149 Ga0495658_0100638 3300046683 Bacteria 1725
150 Ga0495658_0284654 3300046683 Bacteria 1044
151 Ga0496100_0034824 3300048903 Bacteria 3163
152 Ga0496101_0051856 3300048904 Bacteria 2957
153 Ga0496102_0059011 3300048905 Bacteria 3507
154 Ga0496102_0589376 3300048905 Bacteria 1035
155 Ga0496102_1063063 3300048905 Bacteria 729
156 Ga0496103_0067267 3300048906 Bacteria 2237
157 Ga0496103_0231855 3300048906 Bacteria 1188
158 Ga0496104_0042693 3300048907 Bacteria 4257
159 Ga0496106_0249504 3300048909 Bacteria 1419
160 Ga0496106_0647861 3300048909 Bacteria 844
161 Ga0496107_0136634 3300048910 Bacteria 1811
162 Ga0496107_0586414 3300048910 Bacteria 824
163 Ga0496108_0132045 3300048911 Bacteria 2146
164 Ga0496108_0654250 3300048911 Bacteria 913
165 Ga0496110_0083328 3300048913 Bacteria 2852
166 Ga0496111_0121322 3300048914 Bacteria 1930
167 Ga0496111_0194786 3300048914 Bacteria 1506
168 Ga0496112_0135677 3300048915 Bacteria 2431
169 Ga0496112_0340740 3300048915 Bacteria 1443
170 Ga0496113_0088789 3300048916 Bacteria 2378
171 Ga0496114_0025522 3300048917 Bacteria 4830
172 Ga0496114_0154190 3300048917 Bacteria 1994
173 Ga0501031_0000201 3300049568 Bacteria 34044
174 Ga0501031_0022508 3300049568 Bacteria 4106
175 Ga0501031_0053746 3300049568 Bacteria 2625
176 Ga0501031_0134238 3300049568 Bacteria 1617
177 Ga0501031_0482370 3300049568 Bacteria 800
178 Ga0501032_0002612 3300049569 Bacteria 14077
179 Ga0501032_0098147 3300049569 Bacteria 1941
180 Ga0501032_0129177 3300049569 Bacteria 1668
181 Ga0501033_0000425 3300049570 Bacteria 40353
182 Ga0501033_0063680 3300049570 Bacteria 2714
183 Ga0501033_0271239 3300049570 Bacteria 1199
184 Ga0501033_0500198 3300049570 Bacteria 841
185 Ga0501034_0002197 3300049571 Bacteria 24140
186 Ga0501034_0010965 3300049571 Bacteria 9414
187 Ga0501036_0000247 3300049572 Bacteria 36544
188 Ga0501036_0010955 3300049572 Bacteria 7496
189 Ga0501036_0040490 3300049572 Bacteria 3941
190 Ga0501036_0054986 3300049572 Bacteria 3372
191 Ga0501036_0118175 3300049572 Bacteria 2239
192 Ga0501037_0001791 3300049573 Bacteria 15604
193 Ga0501037_0005898 3300049573 Bacteria 8948
194 Ga0501037_0224805 3300049573 Bacteria 1319
195 Ga0501037_0709785 3300049573 Bacteria 669
196 Ga0501038_0002504 3300049574 Bacteria 17105
197 Ga0501038_0005968 3300049574 Bacteria 11265
198 Ga0501038_0032220 3300049574 Bacteria 4626
199 Ga0501038_0201979 3300049574 Bacteria 1595
200 Ga0501039_0000234 3300049575 Bacteria 40397
201 Ga0501039_0056852 3300049575 Bacteria 3031
202 Ga0501039_0088558 3300049575 Bacteria 2411
203 Ga0501039_0109513 3300049575 Bacteria 2159
204 Ga0501039_0258236 3300049575 Bacteria 1370
205 Ga0501039_0411318 3300049575 Bacteria 1062
206 Ga0501039_0638557 3300049575 Bacteria 834
207 Ga0501040_0004216 3300049576 Bacteria 9360
208 Ga0501040_0012377 3300049576 Bacteria 5591
209 Ga0501040_0069331 3300049576 Bacteria 2433
210 Ga0501040_0076288 3300049576 Bacteria 2318
211 Ga0501041_0041787 3300049577 Bacteria 2785
212 Ga0501041_0077113 3300049577 Bacteria 2050
213 Ga0501042_0049985 3300049578 Bacteria 2983
214 Ga0501042_0076777 3300049578 Bacteria 2392
215 Ga0501042_0078897 3300049578 Bacteria 2358
216 Ga0501042_0135741 3300049578 Bacteria 1774
217 Ga0501042_0196618 3300049578 Bacteria 1454
218 Ga0501042_0281948 3300049578 Bacteria 1200
219 Ga0501043_0000375 3300049579 Bacteria 40553
220 Ga0501043_0253949 3300049579 Bacteria 1354
221 Ga0501046_0000758 3300049580 Bacteria 31166
222 Ga0501046_0018081 3300049580 Bacteria 5871
223 Ga0501046_0067214 3300049580 Bacteria 2792
224 Ga0501047_0013840 3300049581 Bacteria 7659
225 Ga0501047_0082533 3300049581 Bacteria 3089
226 Ga0501048_0000238 3300049582 Bacteria 36540
227 Ga0501048_0027999 3300049582 Bacteria 4093
228 Ga0501048_0176454 3300049582 Bacteria 1514
229 Ga0501048_0198813 3300049582 Bacteria 1421
230 Ga0501048_0221541 3300049582 Bacteria 1342
231 Ga0501048_0691687 3300049582 Bacteria 732
232 Ga0501067_0014580 3300049583 Bacteria 4351
233 Ga0501067_0071221 3300049583 Bacteria 1925
234 Ga0501068_0011657 3300049584 Bacteria 4968
235 Ga0501068_0040102 3300049584 Bacteria 2810
236 Ga0501068_0297121 3300049584 Bacteria 1033
237 Ga0501068_0489082 3300049584 Bacteria 798
238 Ga0501069_0000112 3300049585 Bacteria 36488
239 Ga0501069_0020790 3300049585 Bacteria 3559
240 Ga0501069_0264730 3300049585 Bacteria 1004
241 Ga0501070_0028926 3300049586 Bacteria 4646
242 Ga0501070_0672335 3300049586 Bacteria 821
243 Ga0501071_0041045 3300049587 Bacteria 3313
244 Ga0501071_0062879 3300049587 Bacteria 2690
245 Ga0501071_0078284 3300049587 Bacteria 2416
246 Ga0501071_0363879 3300049587 Bacteria 1102
247 Ga0501071_0396543 3300049587 Bacteria 1053
248 Ga0501072_0040244 3300049588 Bacteria 3670
249 Ga0501072_0096849 3300049588 Bacteria 2345
250 Ga0501072_0103320 3300049588 Bacteria 2265
251 Ga0501072_0944789 3300049588 Bacteria 673
252 Ga0501073_0003045 3300049589 Bacteria 12569
253 Ga0501074_0140356 3300049590 Bacteria 1728
254 Ga0501074_0190327 3300049590 Bacteria 1463
255 Ga0501074_0314164 3300049590 Bacteria 1113
256 Ga0501075_0125745 3300049591 Bacteria 1952
257 Ga0501075_0285840 3300049591 Bacteria 1256
258 Ga0501075_0354907 3300049591 Bacteria 1117
259 Ga0501075_0466730 3300049591 Bacteria 963
260 Ga0501075_0827609 3300049591 Bacteria 704
261 Ga0501076_0023755 3300049592 Bacteria 4729
262 Ga0501076_0219653 3300049592 Bacteria 1553
263 Ga0501076_0233781 3300049592 Bacteria 1503
264 Ga0501076_0245075 3300049592 Bacteria 1466
265 Ga0501076_0257809 3300049592 Bacteria 1427
266 Ga0501076_0500467 3300049592 Bacteria 1002
267 Ga0501077_0040258 3300049593 Bacteria 2978
268 Ga0501077_0370203 3300049593 Bacteria 915
269 Ga0501079_0121636 3300049741 Bacteria 2030
270 Ga0501079_0405375 3300049741 Bacteria 1069
271 Ga0501080_0000080 3300049742 Bacteria 65358
272 Ga0501080_0388734 3300049742 Bacteria 1256
273 Ga0501080_0421817 3300049742 Bacteria 1198
274 Ga0501081_0055637 3300049743 Bacteria 2734
275 Ga0501081_0064045 3300049743 Bacteria 2553
276 Ga0501081_0504952 3300049743 Bacteria 901
277 Ga0501083_0018547 3300049744 Bacteria 4848
278 Ga0501035_0003311 3300049822 Bacteria 15438
279 Ga0501035_0004801 3300049822 Bacteria 12812
280 Ga0501035_0281287 3300049822 Bacteria 1406
281 Ga0501044_0004098 3300049823 Bacteria 16346
282 Ga0501044_0041756 3300049823 Bacteria 4774
283 Ga0501044_0455280 3300049823 Bacteria 1186
284 Ga0501045_0020387 3300049824 Bacteria 4734
285 Ga0501045_0036591 3300049824 Bacteria 3565
286 Ga0501045_0068838 3300049824 Bacteria 2601
287 Ga0501045_0139485 3300049824 Bacteria 1803
288 Ga0501045_0290240 3300049824 Bacteria 1217
289 Ga0501212_031911 3300049851 Bacteria 852
290 nmdc:mga03683_415213_c1 3300050489 Bacteria 644
291 nmdc:mga03n38_484338_c1 3300050490 Bacteria 692
292 nmdc:mga06z11_103475_c1 3300050494 Bacteria 1566
293 Ga0495601_0319115 3300053077 Bacteria 1012
294 Ga0495612_0034374 3300053078 Bacteria 2053
295 Ga0500573_0003612 3300053140 Bacteria 8026
296 Ga0500620_031036 3300053155 Bacteria 1692
297 Ga0501084_0000676 3300054114 Bacteria 26008
298 Ga0501084_0124112 3300054114 Bacteria 2172
299 Ga0501084_0206526 3300054114 Bacteria 1657
300 Ga0501084_0234143 3300054114 Bacteria 1550
301 Ga0590071_083923 3300059421 Bacteria 794
302 Ga0501082_0067146 3300060353 Bacteria 3088
303 Ga0501082_0084717 3300060353 Bacteria 2733
304 Ga0501082_0300805 3300060353 Bacteria 1397
305 Ga0501082_0582099 3300060353 Bacteria 979
306 Ga0501082_0640250 3300060353 Bacteria 930
307 Ga0501082_1084826 3300060353 Bacteria 700
308 Ga0466962_0013584 3300061719 Bacteria 3921
309 Ga0466962_0113079 3300061719 Bacteria 1308
310 Ga0466962_0342067 3300061719 Bacteria 744
311 Ga0530510_0053513 3300061734 Bacteria 2917
312 Ga0530510_0081161 3300061734 Bacteria 2361
313 Ga0530510_0098421 3300061734 Bacteria 2139
314 Ga0530510_0582449 3300061734 Bacteria 851
315 2643827675 2643221561 Bacteria 4984412
316 2644534929 2643221696 Bacteria 5431823
317 2740166180 2739367898 Bacteria 4367674
318 2883824449 2883821847 Bacteria 5121194
319 2919396635 2919395869 Bacteria 3704152
320 8054610055 8054609563 Bacteria 5170090
321 Ga0307407_10198722
322 LJQas_1002553
323 JGI24740J21852_10003944
324 JGI25154J39366_1002452
325 Ga0070658_10476448
326 Ga0070683_100053498
327 Ga0070670_100706528
328 Ga0068868_100439822
329 Ga0068868_100478965
330 Ga0070687_100060822
331 Ga0070687_100115628
332 Ga0070668_100078733
333 Ga0070675_100768051
334 Ga0070671_100536497
335 Ga0070674_100049234
336 Ga0070678_100617274
337 Ga0068867_100172130
338 Ga0070706_100665462
339 Ga0070707_100076272
340 Ga0070698_100110006
341 Ga0068857_100408070
342 Ga0068856_100536212
343 Ga0068852_100039204
344 Ga0068852_100414227
345 Ga0068864_100554873
346 Ga0068864_100692257
347 Ga0068861_100133900
348 Ga0068861_100408575
349 Ga0068870_10036571
350 Ga0068858_100230393
351 Ga0075365_10000585
352 Ga0075365_10088657
353 Ga0075364_10110887
354 Ga0068865_100680189
355 Ga0105245_10166087
356 Ga0105245_10169299
357 Ga0105245_10169389
358 Ga0105245_10182133
359 Ga0114129_10697049
360 Ga0105243_10099598
361 Ga0105248_10558653
362 Ga0105238_10333775
363 Ga0105238_10798869
364 Ga0105239_11619877
365 Ga0105246_10350650
366 Ga0105246_10361514
367 Ga0157369_10231604
368 Ga0157369_10504529
369 Ga0157372_10214224
370 Ga0157375_10028754
371 Ga0157375_10247539
372 Ga0157375_10290741
373 Ga0163163_10060062
374 Ga0163163_10088742
375 Ga0163163_10179827
376 Ga0157377_10146624
377 Ga0157376_10300103
378 Ga0163161_10078290
379 Ga0206354_10560591
380 Ga0207682_10113906
381 Ga0207643_10036816
382 Ga0207662_10061229
383 Ga0207657_10218507
384 Ga0207646_10175443
385 Ga0207650_10377329
386 Ga0207687_10212592
387 Ga0207687_10400534
388 Ga0207644_10357759
389 Ga0207690_10063189
390 Ga0207690_11038371
391 Ga0207669_10466452
392 Ga0207669_10558327
393 Ga0207704_10201857
394 Ga0207689_10189306
395 Ga0207661_10395690
396 Ga0207679_10078497
397 Ga0207712_10270432
398 Ga0207668_10649486
399 Ga0207677_10222503
400 Ga0207678_10550834
401 Ga0207708_10226663
402 Ga0207708_10986747
403 Ga0207702_10278383
404 Ga0207641_10604945
405 Ga0207648_10076121
406 Ga0207648_10261727
407 Ga0207674_10341053
408 Ga0207675_100510544
409 Ga0207683_10124411
410 Ga0268265_10783803
411 Ga0316183_1068223
412 Ga0307405_10539593
413 Ga0307413_10184026
414 Ga0307410_10130193
415 Ga0307406_10080000
416 Ga0307409_100266278
417 Ga0307416_100214765
418 Ga0307414_10382082
419 Ga0307414_10588934
420 Ga0307415_100031860
421 Ga0307415_100075360
422 Ga0373931_0379692
423 Ga0436364_0857252
424 Ga0451791_0005626
425 Ga0451793_0237533
426 Ga0451800_0280938
427 Ga0451835_0485672
428 Ga0451837_0150336
429 Ga0451837_0491570
430 Ga0451843_0210803
431 Ga0451853_0156145
432 Ga0451853_1590062
433 Ga0451853_1871461
434 Ga0451853_2768049
435 Ga0466972_0083269
436 Ga0466972_0132577
437 Ga0466965_0065147
438 Ga0466965_0078060
439 Ga0466965_0084061
440 Ga0466965_0374808
441 Ga0466966_0048048
442 Ga0466966_0068961
443 Ga0466966_0124023
444 Ga0466961_0035478
445 Ga0466961_0087834
446 Ga0466961_0318985
447 Ga0466963_0651427
448 Ga0466964_0023032
449 Ga0466964_0049934
450 Ga0466971_0155392
451 Ga0466970_0014097
452 Ga0466970_0040792
453 Ga0466970_0091541
454 Ga0466970_0124544
455 Ga0466970_0151247
456 Ga0466957_0721458
457 Ga0466960_0011152
458 Ga0466960_0014012
459 Ga0466960_0029937
460 Ga0466960_0150282
461 Ga0466958_0126998
462 Ga0466967_0065771
463 Ga0466967_0079133
464 Ga0466967_1084500
465 Ga0466967_1091677
466 Ga0495653_0117250
467 Ga0495664_0030739
468 Ga0495635_0065322
469 Ga0495658_0100638
470 Ga0495658_0284654
471 Ga0496100_0034824
472 Ga0496101_0051856
473 Ga0496102_0059011
474 Ga0496102_0589376
475 Ga0496102_1063063
476 Ga0496103_0067267
477 Ga0496103_0231855
478 Ga0496104_0042693
479 Ga0496106_0249504
480 Ga0496106_0647861
481 Ga0496107_0136634
482 Ga0496107_0586414
483 Ga0496108_0132045
484 Ga0496108_0654250
485 Ga0496110_0083328
486 Ga0496111_0121322
487 Ga0496111_0194786
488 Ga0496112_0135677
489 Ga0496112_0340740
490 Ga0496113_0088789
491 Ga0496114_0025522
492 Ga0496114_0154190
493 Ga0501031_0000201
494 Ga0501031_0022508
495 Ga0501031_0053746
496 Ga0501031_0134238
497 Ga0501031_0482370
498 Ga0501032_0002612
499 Ga0501032_0098147
500 Ga0501032_0129177
501 Ga0501033_0000425
502 Ga0501033_0063680
503 Ga0501033_0271239
504 Ga0501033_0500198
505 Ga0501034_0002197
506 Ga0501034_0010965
507 Ga0501036_0000247
508 Ga0501036_0010955
509 Ga0501036_0040490
510 Ga0501036_0054986
511 Ga0501036_0118175
512 Ga0501037_0001791
513 Ga0501037_0005898
514 Ga0501037_0224805
515 Ga0501037_0709785
516 Ga0501038_0002504
517 Ga0501038_0005968
518 Ga0501038_0032220
519 Ga0501038_0201979
520 Ga0501039_0000234
521 Ga0501039_0056852
522 Ga0501039_0088558
523 Ga0501039_0109513
524 Ga0501039_0258236
525 Ga0501039_0411318
526 Ga0501039_0638557
527 Ga0501040_0004216
528 Ga0501040_0012377
529 Ga0501040_0069331
530 Ga0501040_0076288
531 Ga0501041_0041787
532 Ga0501041_0077113
533 Ga0501042_0049985
534 Ga0501042_0076777
535 Ga0501042_0078897
536 Ga0501042_0135741
537 Ga0501042_0196618
538 Ga0501042_0281948
539 Ga0501043_0000375
540 Ga0501043_0253949
541 Ga0501046_0000758
542 Ga0501046_0018081
543 Ga0501046_0067214
544 Ga0501047_0013840
545 Ga0501047_0082533
546 Ga0501048_0000238
547 Ga0501048_0027999
548 Ga0501048_0176454
549 Ga0501048_0198813
550 Ga0501048_0221541
551 Ga0501048_0691687
552 Ga0501067_0014580
553 Ga0501067_0071221
554 Ga0501068_0011657
555 Ga0501068_0040102
556 Ga0501068_0297121
557 Ga0501068_0489082
558 Ga0501069_0000112
559 Ga0501069_0020790
560 Ga0501069_0264730
561 Ga0501070_0028926
562 Ga0501070_0672335
563 Ga0501071_0041045
564 Ga0501071_0062879
565 Ga0501071_0078284
566 Ga0501071_0363879
567 Ga0501071_0396543
568 Ga0501072_0040244
569 Ga0501072_0096849
570 Ga0501072_0103320
571 Ga0501072_0944789
572 Ga0501073_0003045
573 Ga0501074_0140356
574 Ga0501074_0190327
575 Ga0501074_0314164
576 Ga0501075_0125745
577 Ga0501075_0285840
578 Ga0501075_0354907
579 Ga0501075_0466730
580 Ga0501075_0827609
581 Ga0501076_0023755
582 Ga0501076_0219653
583 Ga0501076_0233781
584 Ga0501076_0245075
585 Ga0501076_0257809
586 Ga0501076_0500467
587 Ga0501077_0040258
588 Ga0501077_0370203
589 Ga0501079_0121636
590 Ga0501079_0405375
591 Ga0501080_0000080
592 Ga0501080_0388734
593 Ga0501080_0421817
594 Ga0501081_0055637
595 Ga0501081_0064045
596 Ga0501081_0504952
597 Ga0501083_0018547
598 Ga0501035_0003311
599 Ga0501035_0004801
600 Ga0501035_0281287
601 Ga0501044_0004098
602 Ga0501044_0041756
603 Ga0501044_0455280
604 Ga0501045_0020387
605 Ga0501045_0036591
606 Ga0501045_0068838
607 Ga0501045_0139485
608 Ga0501045_0290240
609 Ga0501212_031911
610 nmdc:mga03683_415213_c1
611 nmdc:mga03n38_484338_c1
612 nmdc:mga06z11_103475_c1
613 Ga0495601_0319115
614 Ga0495612_0034374
615 Ga0500573_0003612
616 Ga0500620_031036
617 Ga0501084_0000676
618 Ga0501084_0124112
619 Ga0501084_0206526
620 Ga0501084_0234143
621 Ga0590071_083923
622 Ga0501082_0067146
623 Ga0501082_0084717
624 Ga0501082_0300805
625 Ga0501082_0582099
626 Ga0501082_0640250
627 Ga0501082_1084826
628 Ga0466962_0013584
629 Ga0466962_0113079
630 Ga0466962_0342067
631 Ga0530510_0053513
632 Ga0530510_0081161
633 Ga0530510_0098421
634 Ga0530510_0582449
635 2643827675
636 2644534929
637 2740166180
638 2883824449
639 2919396635
640 8054610055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11452

DUF3000

Protein of unknown function (DUF3000)

31

210

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tqd-assembly1.cif.gz_B structure of enterobacter cloacae cap2-cdnd02 2:1 complex 0.5252 22 91
5nqx-assembly3.cif.gz_B structure of a fhbp(v1.1):pora(p1.16) chimera. fusion at fhbp position 294. 0.5128 38 96
7brs-assembly3.cif.gz_C e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 0.4909 24 99
3fzb-assembly1.cif.gz_H crystal structure of the tail terminator protein from phage lambda (gpu-wt) 0.4686 86 162
7pnw-assembly1.cif.gz_H mouse mitochondrial ribosome small subunit lacking m5u modification 0.4534 87 187
ID Description Score Start End Superfamily
af_O86317_22_202_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.8659 17 198 3.30.1460.10
af_O86317_22_202_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.8567 17 198 3.30.1460.10
af_Q54MN2_4_160_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7541 53 76 3.40.630.30
af_K7LC61_429_544_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.6062 59 187 3.30.70.60
af_K7LC61_429_544_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.5546 59 187 3.30.70.60
ID Description Score Start End GO Terms
AF-A0A3N9Y730-F1-model_v4 DUF3000 domain-containing protein 0.9636 11 186
AF-A0A7K0VWQ8-F1-model_v4 DUF3000 family protein 0.9491 14 133
AF-A0A3N9Y730-F1-model_v4 DUF3000 domain-containing protein 0.947 11 186
AF-A0A853BH64-F1-model_v4 Enoyl-CoA hydratase 0.9467 32 193
AF-A0A841FCC4-F1-model_v4 DUF3000 domain-containing protein 0.9408 12 200

Map