F405582

General Info

Members Datasets Scaffolds Average Seq Length
320 161 640 98

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1044258|Ga0265337_10442583
Length 104
Sequence MTATATPTVTKRNYRASFVLDNRGKEDSIDQIIDGVKAEIAAVHGEVTGIENLGKKDFIRVTDRKFTSGTYVQIAFSGPPQAPAQLKDRLRLNSSVYRTFIQSA

Samples

Sample ID Description Type Environment
1 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
66 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
67 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
98 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
101 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
119 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
149 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
150 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
158 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
159 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.81
Metatranscriptomes 6.88
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 0
Rhizosphere 95.94
Stem 0
Stem Tuber 0
Unclassified 6.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265337_1044258 3300028556 Bacteria 1271
2 rootH2_10032700 3300003320 Bacteria 7906
3 rootL2_10063193 3300003322 Bacteria 1235
4 rootH1_10136318 3300003323 Bacteria 1787
5 rootH1_10154814 3300003323 Bacteria 3600
6 Ga0070683_100008083 3300005329 Bacteria 8934
7 Ga0070683_100572802 3300005329 Bacteria 1080
8 Ga0070690_100246415 3300005330 Bacteria 1262
9 Ga0070670_100559054 3300005331 Bacteria 1021
10 Ga0068869_100000041 3300005334 Bacteria 52640
11 Ga0070682_100488004 3300005337 Bacteria 952
12 Ga0070682_100952255 3300005337 Bacteria 709
13 Ga0068868_100016897 3300005338 Bacteria 5429
14 Ga0068868_100842274 3300005338 Bacteria 830
15 Ga0070689_100126947 3300005340 Bacteria 2042
16 Ga0070687_100255318 3300005343 Bacteria 1091
17 Ga0070673_100532053 3300005364 Bacteria 1066
18 Ga0070714_101755048 3300005435 Bacteria 606
19 Ga0070713_100008587 3300005436 Bacteria 7254
20 Ga0070700_101749279 3300005441 Bacteria 534
21 Ga0068867_100004042 3300005459 Bacteria 10321
22 Ga0068867_101873977 3300005459 Unclassified 565
23 Ga0070679_100012554 3300005530 Bacteria 8102
24 Ga0070684_101039276 3300005535 Bacteria 769
25 Ga0068853_100112715 3300005539 Bacteria 2417
26 Ga0070672_101486397 3300005543 Bacteria 607
27 Ga0070693_100420348 3300005547 Bacteria 931
28 Ga0070693_101171620 3300005547 Bacteria 589
29 Ga0068855_102449159 3300005563 Bacteria 520
30 Ga0068857_100360144 3300005577 Bacteria 1348
31 Ga0068856_100006783 3300005614 Bacteria 11205
32 Ga0068856_100079682 3300005614 Bacteria 3248
33 Ga0068866_10233242 3300005718 Bacteria 1117
34 Ga0070717_10000012 3300006028 Bacteria 230311
35 Ga0070717_10896228 3300006028 Unclassified 807
36 Ga0097621_100004159 3300006237 Bacteria 10038
37 Ga0068871_100012882 3300006358 Bacteria 6193
38 Ga0068871_100097646 3300006358 Bacteria 2456
39 Ga0075429_100709759 3300006880 Unclassified 881
40 Ga0068865_100003523 3300006881 Bacteria 9385
41 Ga0105244_10331426 3300009036 Bacteria 702
42 Ga0105240_10363385 3300009093 Unclassified 1639
43 Ga0105245_11090069 3300009098 Bacteria 845
44 Ga0105238_11194353 3300009551 Bacteria 785
45 Ga0157370_11491040 3300013104 Bacteria 608
46 Ga0157374_10263940 3300013296 Bacteria 1697
47 Ga0157374_10650524 3300013296 Bacteria 1066
48 Ga0157374_12869718 3300013296 Bacteria 509
49 Ga0157378_11043829 3300013297 Bacteria 853
50 Ga0157372_10916009 3300013307 Bacteria 1017
51 Ga0163163_11022342 3300014325 Bacteria 890
52 Ga0157380_11738177 3300014326 Unclassified 682
53 Ga0157376_11671691 3300014969 Bacteria 672
54 Ga0157376_11743220 3300014969 Bacteria 658
55 Ga0206356_11141392 3300020070 Bacteria 1999
56 Ga0207642_10269274 3300025899 Bacteria 975
57 Ga0207662_10258140 3300025918 Bacteria 1146
58 Ga0207652_10056947 3300025921 Bacteria 3366
59 Ga0207652_10824662 3300025921 Bacteria 823
60 Ga0207650_10448813 3300025925 Bacteria 1073
61 Ga0207700_10019999 3300025928 Bacteria 4536
62 Ga0207670_10298534 3300025936 Unclassified 1261
63 Ga0207704_10004161 3300025938 Bacteria 6598
64 Ga0207689_10001434 3300025942 Bacteria 22778
65 Ga0207661_10005444 3300025944 Bacteria 8972
66 Ga0207661_10162316 3300025944 Bacteria 1940
67 Ga0207661_10256000 3300025944 Bacteria 1558
68 Ga0207667_11961004 3300025949 Bacteria 546
69 Ga0207677_10019649 3300026023 Bacteria 4085
70 Ga0207639_10389716 3300026041 Bacteria 1253
71 Ga0207702_10001846 3300026078 Bacteria 20857
72 Ga0207702_10290904 3300026078 Bacteria 1548
73 Ga0207648_10029056 3300026089 Bacteria 4902
74 Ga0207648_10995423 3300026089 Bacteria 785
75 Ga0207674_10709959 3300026116 Bacteria 971
76 Ga0207683_10073555 3300026121 Bacteria 3023
77 Ga0207428_10853022 3300027907 Bacteria 645
78 Ga0265337_1006244 3300028556 Bacteria 4622
79 Ga0265337_1010848 3300028556 Bacteria 3169
80 Ga0265337_1027156 3300028556 Bacteria 1728
81 Ga0265337_1090405 3300028556 Bacteria 835
82 Ga0265326_10095384 3300028558 Bacteria 843
83 Ga0265326_10107190 3300028558 Bacteria 793
84 Ga0265319_1002141 3300028563 Bacteria 11043
85 Ga0265319_1006861 3300028563 Bacteria 5204
86 Ga0265319_1013898 3300028563 Bacteria 3180
87 Ga0265319_1066843 3300028563 Bacteria 1157
88 Ga0265319_1081946 3300028563 Bacteria 1024
89 Ga0265319_1091095 3300028563 Bacteria 962
90 Ga0265319_1134369 3300028563 Bacteria 768
91 Ga0265319_1170863 3300028563 Bacteria 670
92 Ga0265334_10003196 3300028573 Bacteria 7480
93 Ga0265334_10020318 3300028573 Bacteria 2721
94 Ga0265334_10071908 3300028573 Bacteria 1287
95 Ga0265318_10000120 3300028577 Bacteria 72409
96 Ga0265318_10000701 3300028577 Bacteria 22512
97 Ga0265318_10004565 3300028577 Bacteria 6685
98 Ga0265318_10021634 3300028577 Bacteria 2580
99 Ga0265318_10029757 3300028577 Bacteria 2128
100 Ga0265318_10101372 3300028577 Unclassified 1059
101 Ga0265318_10201710 3300028577 Bacteria 727
102 Ga0265318_10374527 3300028577 Bacteria 520
103 Ga0265323_10007002 3300028653 Bacteria 4711
104 Ga0265323_10073416 3300028653 Unclassified 1165
105 Ga0265322_10001320 3300028654 Bacteria 8306
106 Ga0265322_10039546 3300028654 Bacteria 1342
107 Ga0265322_10170790 3300028654 Bacteria 622
108 Ga0265336_10000725 3300028666 Bacteria 17456
109 Ga0265336_10041897 3300028666 Bacteria 1398
110 Ga0265336_10048065 3300028666 Bacteria 1294
111 Ga0265338_10000299 3300028800 Bacteria 89317
112 Ga0265338_10003094 3300028800 Bacteria 23867
113 Ga0265338_10442729 3300028800 Bacteria 921
114 Ga0265338_11025285 3300028800 Bacteria 558
115 Ga0265324_10000227 3300029957 Bacteria 42589
116 Ga0265324_10014839 3300029957 Bacteria 2871
117 Ga0265324_10109676 3300029957 Bacteria 937
118 Ga0265324_10185109 3300029957 Unclassified 707
119 Ga0265760_10361890 3300031090 Bacteria 520
120 Ga0265330_10024433 3300031235 Bacteria 2741
121 Ga0265330_10366854 3300031235 Bacteria 608
122 Ga0265330_10389986 3300031235 Bacteria 589
123 Ga0265332_10054854 3300031238 Bacteria 1709
124 Ga0265332_10059190 3300031238 Bacteria 1640
125 Ga0265332_10239044 3300031238 Bacteria 752
126 Ga0265328_10019383 3300031239 Bacteria 2614
127 Ga0265328_10030134 3300031239 Bacteria 2022
128 Ga0265328_10055553 3300031239 Bacteria 1453
129 Ga0265320_10000847 3300031240 Bacteria 23118
130 Ga0265320_10001962 3300031240 Bacteria 14526
131 Ga0265320_10002205 3300031240 Bacteria 13687
132 Ga0265320_10002726 3300031240 Bacteria 12213
133 Ga0265320_10004645 3300031240 Bacteria 8967
134 Ga0265320_10008472 3300031240 Bacteria 6292
135 Ga0265320_10029909 3300031240 Bacteria 2815
136 Ga0265320_10041356 3300031240 Bacteria 2292
137 Ga0265320_10088841 3300031240 Bacteria 1433
138 Ga0265320_10104333 3300031240 Bacteria 1303
139 Ga0265320_10110661 3300031240 Bacteria 1258
140 Ga0265320_10112549 3300031240 Bacteria 1246
141 Ga0265320_10173414 3300031240 Bacteria 968
142 Ga0265320_10291567 3300031240 Bacteria 722
143 Ga0265325_10048744 3300031241 Bacteria 2188
144 Ga0265325_10452818 3300031241 Bacteria 559
145 Ga0265325_10491543 3300031241 Bacteria 532
146 Ga0265329_10122103 3300031242 Bacteria 836
147 Ga0265329_10303881 3300031242 Unclassified 540
148 Ga0265340_10022508 3300031247 Bacteria 3221
149 Ga0265339_10089870 3300031249 Bacteria 1611
150 Ga0265339_10136791 3300031249 Bacteria 1249
151 Ga0265339_10316654 3300031249 Bacteria 741
152 Ga0265339_10427034 3300031249 Bacteria 617
153 Ga0265331_10007944 3300031250 Bacteria 6076
154 Ga0265331_10046612 3300031250 Bacteria 2088
155 Ga0265327_10001402 3300031251 Bacteria 30708
156 Ga0265327_10004137 3300031251 Bacteria 13087
157 Ga0265327_10016185 3300031251 Bacteria 4757
158 Ga0265327_10127110 3300031251 Bacteria 1202
159 Ga0265316_10003128 3300031344 Bacteria 16859
160 Ga0265316_10072401 3300031344 Unclassified 2655
161 Ga0265316_10160768 3300031344 Bacteria 1679
162 Ga0265316_10203440 3300031344 Bacteria 1467
163 Ga0265316_10338780 3300031344 Bacteria 1090
164 Ga0265316_10362689 3300031344 Bacteria 1047
165 Ga0265316_10371319 3300031344 Bacteria 1033
166 Ga0265316_10971607 3300031344 Bacteria 592
167 Ga0265316_11187693 3300031344 Bacteria 528
168 Ga0307509_10386397 3300031507 Bacteria 1111
169 Ga0307408_100000062 3300031548 Bacteria 127855
170 Ga0265313_10001660 3300031595 Bacteria 20605
171 Ga0265313_10003361 3300031595 Bacteria 13037
172 Ga0265313_10007627 3300031595 Bacteria 7339
173 Ga0265313_10016594 3300031595 Bacteria 4226
174 Ga0265313_10018415 3300031595 Bacteria 3921
175 Ga0265313_10021577 3300031595 Bacteria 3519
176 Ga0265313_10036384 3300031595 Bacteria 2471
177 Ga0265313_10076945 3300031595 Bacteria 1524
178 Ga0265313_10167761 3300031595 Bacteria 929
179 Ga0307508_10000551 3300031616 Bacteria 44445
180 Ga0307508_10611914 3300031616 Bacteria 692
181 Ga0265314_10000619 3300031711 Bacteria 43744
182 Ga0265314_10005317 3300031711 Bacteria 11650
183 Ga0265314_10079976 3300031711 Bacteria 2159
184 Ga0265314_10082056 3300031711 Bacteria 2122
185 Ga0265314_10131982 3300031711 Bacteria 1557
186 Ga0265314_10164169 3300031711 Unclassified 1348
187 Ga0265314_10245059 3300031711 Bacteria 1032
188 Ga0265314_10381783 3300031711 Bacteria 766
189 Ga0265314_10397563 3300031711 Bacteria 746
190 Ga0265314_10401529 3300031711 Bacteria 741
191 Ga0265314_10424349 3300031711 Bacteria 714
192 Ga0265342_10019596 3300031712 Bacteria 4357
193 Ga0265342_10037733 3300031712 Bacteria 2945
194 Ga0265342_10062461 3300031712 Bacteria 2192
195 Ga0265342_10088612 3300031712 Bacteria 1777
196 Ga0265342_10104012 3300031712 Bacteria 1614
197 Ga0265342_10219938 3300031712 Bacteria 1023
198 Ga0265342_10367756 3300031712 Bacteria 746
199 Ga0307413_10345023 3300031824 Bacteria 1147
200 Ga0307413_11309952 3300031824 Bacteria 634
201 Ga0307410_10000023 3300031852 Bacteria 60803
202 Ga0307407_10010788 3300031903 Bacteria 4322
203 Ga0307412_10335354 3300031911 Bacteria 1208
204 Ga0307412_12203687 3300031911 Unclassified 513
205 Ga0307409_100000017 3300031995 Bacteria 57407
206 Ga0307416_100000012 3300032002 Bacteria 296814
207 Ga0307416_101428824 3300032002 Bacteria 798
208 Ga0307414_11354125 3300032004 Bacteria 661
209 Ga0307411_10654622 3300032005 Bacteria 910
210 Ga0307411_10942111 3300032005 Bacteria 770
211 Ga0395905_0000250 3300037471 Bacteria 80488
212 Ga0439461_0124653 3300041410 Bacteria 647
213 Ga0451843_0283055 3300041509 Bacteria 576
214 Ga0451853_1956401 3300041512 Bacteria 1068
215 Ga0439445_0018720 3300042004 Bacteria 1721
216 Ga0439446_0015285 3300042156 Bacteria 2128
217 Ga0439446_0080292 3300042156 Bacteria 1009
218 Ga0451577_0000025 3300042876 Bacteria 403632
219 Ga0451577_0306795 3300042876 Bacteria 1438
220 Ga0451577_0805704 3300042876 Bacteria 848
221 Ga0451577_0865584 3300042876 Bacteria 815
222 Ga0453683_0000103 3300044673 Bacteria 126669
223 Ga0453683_0514151 3300044673 Bacteria 778
224 Ga0466966_0356757 3300044684 Bacteria 878
225 Ga0466961_0586234 3300044693 Bacteria 671
226 Ga0453684_0028722 3300044712 Bacteria 7922
227 Ga0453684_0301695 3300044712 Bacteria 1820
228 Ga0453684_0702931 3300044712 Bacteria 1098
229 Ga0453684_0873111 3300044712 Bacteria 965
230 Ga0453684_1239666 3300044712 Unclassified 781
231 Ga0466957_1013676 3300044842 Bacteria 597
232 Ga0451576_0000534 3300045051 Bacteria 81922
233 Ga0451576_0012945 3300045051 Bacteria 9348
234 Ga0451576_0013113 3300045051 Bacteria 9280
235 Ga0451576_0089865 3300045051 Bacteria 3194
236 Ga0451576_0259149 3300045051 Bacteria 1817
237 Ga0451576_0684834 3300045051 Bacteria 1077
238 Ga0451576_0811489 3300045051 Bacteria 982
239 Ga0451576_1242158 3300045051 Bacteria 777
240 Ga0451576_1792934 3300045051 Bacteria 634
241 Ga0466967_0038041 3300045976 Bacteria 4123
242 Ga0495651_0267856 3300046462 Bacteria 1160
243 Ga0495585_0359051 3300046492 Bacteria 707
244 Ga0495586_0829413 3300046535 Bacteria 533
245 Ga0495667_0574740 3300046559 Bacteria 703
246 Ga0495635_0806625 3300046663 Bacteria 605
247 Ga0495674_0828588 3300047319 Bacteria 718
248 Ga0495680_0378011 3300047322 Bacteria 982
249 Ga0495684_0433507 3300047471 Bacteria 917
250 Ga0495614_0172170 3300048089 Bacteria 972
251 Ga0501306_010685 3300049127 Bacteria 1159
252 Ga0501306_040923 3300049127 Unclassified 719
253 Ga0501308_005729 3300049128 Bacteria 1250
254 Ga0501309_015416 3300049129 Bacteria 1034
255 Ga0501304_003172 3300049160 Bacteria 1190
256 Ga0501305_000697 3300049161 Bacteria 2899
257 Ga0501305_024179 3300049161 Bacteria 914
258 Ga0501305_053901 3300049161 Bacteria 680
259 Ga0501307_001536 3300049162 Bacteria 1973
260 Ga0501312_002248 3300049528 Bacteria 2060
261 Ga0501312_021810 3300049528 Bacteria 956
262 Ga0501314_005916 3300049530 Bacteria 1054
263 Ga0501314_005985 3300049530 Bacteria 1049
264 Ga0501314_027989 3300049530 Bacteria 616
265 Ga0501315_061250 3300049531 Bacteria 609
266 Ga0501317_029877 3300049533 Bacteria 786
267 Ga0501320_004810 3300049536 Bacteria 1205
268 Ga0501322_007413 3300049538 Bacteria 798
269 Ga0501031_0117779 3300049568 Bacteria 1735
270 Ga0501032_0000896 3300049569 Bacteria 24141
271 Ga0501032_0853637 3300049569 Bacteria 574
272 Ga0501033_0001187 3300049570 Bacteria 23521
273 Ga0501033_0029788 3300049570 Bacteria 4102
274 Ga0501034_0137111 3300049571 Bacteria 2428
275 Ga0501034_0470037 3300049571 Bacteria 1173
276 Ga0501037_0009288 3300049573 Bacteria 7212
277 Ga0501038_0004142 3300049574 Bacteria 13493
278 Ga0501038_0155814 3300049574 Bacteria 1860
279 Ga0501039_0094664 3300049575 Bacteria 2328
280 Ga0501041_0841536 3300049577 Unclassified 589
281 Ga0501042_0093750 3300049578 Bacteria 2156
282 Ga0501043_0372301 3300049579 Bacteria 1082
283 Ga0501043_0976122 3300049579 Bacteria 604
284 Ga0501043_1332037 3300049579 Bacteria 500
285 Ga0501046_0000681 3300049580 Bacteria 33000
286 Ga0501046_0061004 3300049580 Bacteria 2950
287 Ga0501046_0183097 3300049580 Bacteria 1565
288 Ga0501047_0019534 3300049581 Bacteria 6500
289 Ga0501047_0026146 3300049581 Bacteria 5615
290 Ga0501047_0206236 3300049581 Bacteria 1825
291 Ga0501047_0692765 3300049581 Bacteria 836
292 Ga0501048_0169655 3300049582 Bacteria 1545
293 Ga0501068_0212672 3300049584 Bacteria 1228
294 Ga0501070_0085243 3300049586 Bacteria 2616
295 Ga0501070_0109821 3300049586 Bacteria 2279
296 Ga0501071_1159266 3300049587 Bacteria 597
297 Ga0501073_0686671 3300049589 Bacteria 706
298 Ga0501227_132576 3300049665 Bacteria 679
299 Ga0501243_140038 3300049675 Bacteria 510
300 Ga0501245_156672 3300049708 Unclassified 507
301 Ga0501080_0188487 3300049742 Bacteria 1896
302 Ga0501080_0347031 3300049742 Bacteria 1341
303 Ga0501083_0006273 3300049744 Bacteria 8438
304 Ga0501083_0123816 3300049744 Unclassified 1695
305 Ga0501035_0003445 3300049822 Bacteria 15140
306 Ga0501035_0010153 3300049822 Bacteria 8739
307 Ga0501035_0164260 3300049822 Bacteria 1921
308 Ga0501035_0525077 3300049822 Bacteria 972
309 Ga0501035_1528002 3300049822 Bacteria 508
310 Ga0501044_0006393 3300049823 Bacteria 13021
311 Ga0501044_0022811 3300049823 Bacteria 6666
312 Ga0501044_0175406 3300049823 Bacteria 2113
313 Ga0501044_0180578 3300049823 Bacteria 2077
314 Ga0501045_0131374 3300049824 Bacteria 1861
315 Ga0500651_0577904 3300053093 Bacteria 612
316 Ga0500628_100902 3300053129 Bacteria 764
317 Ga0500588_0054593 3300053146 Bacteria 1259
318 Ga0587109_087985 3300059624 Unclassified 697
319 Ga0587115_109929 3300059626 Unclassified 520
320 2788432878 2786546940 Bacteria 6396474
321 Ga0265337_1044258
322 rootH2_10032700
323 rootL2_10063193
324 rootH1_10136318
325 rootH1_10154814
326 Ga0070683_100008083
327 Ga0070683_100572802
328 Ga0070690_100246415
329 Ga0070670_100559054
330 Ga0068869_100000041
331 Ga0070682_100488004
332 Ga0070682_100952255
333 Ga0068868_100016897
334 Ga0068868_100842274
335 Ga0070689_100126947
336 Ga0070687_100255318
337 Ga0070673_100532053
338 Ga0070714_101755048
339 Ga0070713_100008587
340 Ga0070700_101749279
341 Ga0068867_100004042
342 Ga0068867_101873977
343 Ga0070679_100012554
344 Ga0070684_101039276
345 Ga0068853_100112715
346 Ga0070672_101486397
347 Ga0070693_100420348
348 Ga0070693_101171620
349 Ga0068855_102449159
350 Ga0068857_100360144
351 Ga0068856_100006783
352 Ga0068856_100079682
353 Ga0068866_10233242
354 Ga0070717_10000012
355 Ga0070717_10896228
356 Ga0097621_100004159
357 Ga0068871_100012882
358 Ga0068871_100097646
359 Ga0075429_100709759
360 Ga0068865_100003523
361 Ga0105244_10331426
362 Ga0105240_10363385
363 Ga0105245_11090069
364 Ga0105238_11194353
365 Ga0157370_11491040
366 Ga0157374_10263940
367 Ga0157374_10650524
368 Ga0157374_12869718
369 Ga0157378_11043829
370 Ga0157372_10916009
371 Ga0163163_11022342
372 Ga0157380_11738177
373 Ga0157376_11671691
374 Ga0157376_11743220
375 Ga0206356_11141392
376 Ga0207642_10269274
377 Ga0207662_10258140
378 Ga0207652_10056947
379 Ga0207652_10824662
380 Ga0207650_10448813
381 Ga0207700_10019999
382 Ga0207670_10298534
383 Ga0207704_10004161
384 Ga0207689_10001434
385 Ga0207661_10005444
386 Ga0207661_10162316
387 Ga0207661_10256000
388 Ga0207667_11961004
389 Ga0207677_10019649
390 Ga0207639_10389716
391 Ga0207702_10001846
392 Ga0207702_10290904
393 Ga0207648_10029056
394 Ga0207648_10995423
395 Ga0207674_10709959
396 Ga0207683_10073555
397 Ga0207428_10853022
398 Ga0265337_1006244
399 Ga0265337_1010848
400 Ga0265337_1027156
401 Ga0265337_1090405
402 Ga0265326_10095384
403 Ga0265326_10107190
404 Ga0265319_1002141
405 Ga0265319_1006861
406 Ga0265319_1013898
407 Ga0265319_1066843
408 Ga0265319_1081946
409 Ga0265319_1091095
410 Ga0265319_1134369
411 Ga0265319_1170863
412 Ga0265334_10003196
413 Ga0265334_10020318
414 Ga0265334_10071908
415 Ga0265318_10000120
416 Ga0265318_10000701
417 Ga0265318_10004565
418 Ga0265318_10021634
419 Ga0265318_10029757
420 Ga0265318_10101372
421 Ga0265318_10201710
422 Ga0265318_10374527
423 Ga0265323_10007002
424 Ga0265323_10073416
425 Ga0265322_10001320
426 Ga0265322_10039546
427 Ga0265322_10170790
428 Ga0265336_10000725
429 Ga0265336_10041897
430 Ga0265336_10048065
431 Ga0265338_10000299
432 Ga0265338_10003094
433 Ga0265338_10442729
434 Ga0265338_11025285
435 Ga0265324_10000227
436 Ga0265324_10014839
437 Ga0265324_10109676
438 Ga0265324_10185109
439 Ga0265760_10361890
440 Ga0265330_10024433
441 Ga0265330_10366854
442 Ga0265330_10389986
443 Ga0265332_10054854
444 Ga0265332_10059190
445 Ga0265332_10239044
446 Ga0265328_10019383
447 Ga0265328_10030134
448 Ga0265328_10055553
449 Ga0265320_10000847
450 Ga0265320_10001962
451 Ga0265320_10002205
452 Ga0265320_10002726
453 Ga0265320_10004645
454 Ga0265320_10008472
455 Ga0265320_10029909
456 Ga0265320_10041356
457 Ga0265320_10088841
458 Ga0265320_10104333
459 Ga0265320_10110661
460 Ga0265320_10112549
461 Ga0265320_10173414
462 Ga0265320_10291567
463 Ga0265325_10048744
464 Ga0265325_10452818
465 Ga0265325_10491543
466 Ga0265329_10122103
467 Ga0265329_10303881
468 Ga0265340_10022508
469 Ga0265339_10089870
470 Ga0265339_10136791
471 Ga0265339_10316654
472 Ga0265339_10427034
473 Ga0265331_10007944
474 Ga0265331_10046612
475 Ga0265327_10001402
476 Ga0265327_10004137
477 Ga0265327_10016185
478 Ga0265327_10127110
479 Ga0265316_10003128
480 Ga0265316_10072401
481 Ga0265316_10160768
482 Ga0265316_10203440
483 Ga0265316_10338780
484 Ga0265316_10362689
485 Ga0265316_10371319
486 Ga0265316_10971607
487 Ga0265316_11187693
488 Ga0307509_10386397
489 Ga0307408_100000062
490 Ga0265313_10001660
491 Ga0265313_10003361
492 Ga0265313_10007627
493 Ga0265313_10016594
494 Ga0265313_10018415
495 Ga0265313_10021577
496 Ga0265313_10036384
497 Ga0265313_10076945
498 Ga0265313_10167761
499 Ga0307508_10000551
500 Ga0307508_10611914
501 Ga0265314_10000619
502 Ga0265314_10005317
503 Ga0265314_10079976
504 Ga0265314_10082056
505 Ga0265314_10131982
506 Ga0265314_10164169
507 Ga0265314_10245059
508 Ga0265314_10381783
509 Ga0265314_10397563
510 Ga0265314_10401529
511 Ga0265314_10424349
512 Ga0265342_10019596
513 Ga0265342_10037733
514 Ga0265342_10062461
515 Ga0265342_10088612
516 Ga0265342_10104012
517 Ga0265342_10219938
518 Ga0265342_10367756
519 Ga0307413_10345023
520 Ga0307413_11309952
521 Ga0307410_10000023
522 Ga0307407_10010788
523 Ga0307412_10335354
524 Ga0307412_12203687
525 Ga0307409_100000017
526 Ga0307416_100000012
527 Ga0307416_101428824
528 Ga0307414_11354125
529 Ga0307411_10654622
530 Ga0307411_10942111
531 Ga0395905_0000250
532 Ga0439461_0124653
533 Ga0451843_0283055
534 Ga0451853_1956401
535 Ga0439445_0018720
536 Ga0439446_0015285
537 Ga0439446_0080292
538 Ga0451577_0000025
539 Ga0451577_0306795
540 Ga0451577_0805704
541 Ga0451577_0865584
542 Ga0453683_0000103
543 Ga0453683_0514151
544 Ga0466966_0356757
545 Ga0466961_0586234
546 Ga0453684_0028722
547 Ga0453684_0301695
548 Ga0453684_0702931
549 Ga0453684_0873111
550 Ga0453684_1239666
551 Ga0466957_1013676
552 Ga0451576_0000534
553 Ga0451576_0012945
554 Ga0451576_0013113
555 Ga0451576_0089865
556 Ga0451576_0259149
557 Ga0451576_0684834
558 Ga0451576_0811489
559 Ga0451576_1242158
560 Ga0451576_1792934
561 Ga0466967_0038041
562 Ga0495651_0267856
563 Ga0495585_0359051
564 Ga0495586_0829413
565 Ga0495667_0574740
566 Ga0495635_0806625
567 Ga0495674_0828588
568 Ga0495680_0378011
569 Ga0495684_0433507
570 Ga0495614_0172170
571 Ga0501306_010685
572 Ga0501306_040923
573 Ga0501308_005729
574 Ga0501309_015416
575 Ga0501304_003172
576 Ga0501305_000697
577 Ga0501305_024179
578 Ga0501305_053901
579 Ga0501307_001536
580 Ga0501312_002248
581 Ga0501312_021810
582 Ga0501314_005916
583 Ga0501314_005985
584 Ga0501314_027989
585 Ga0501315_061250
586 Ga0501317_029877
587 Ga0501320_004810
588 Ga0501322_007413
589 Ga0501031_0117779
590 Ga0501032_0000896
591 Ga0501032_0853637
592 Ga0501033_0001187
593 Ga0501033_0029788
594 Ga0501034_0137111
595 Ga0501034_0470037
596 Ga0501037_0009288
597 Ga0501038_0004142
598 Ga0501038_0155814
599 Ga0501039_0094664
600 Ga0501041_0841536
601 Ga0501042_0093750
602 Ga0501043_0372301
603 Ga0501043_0976122
604 Ga0501043_1332037
605 Ga0501046_0000681
606 Ga0501046_0061004
607 Ga0501046_0183097
608 Ga0501047_0019534
609 Ga0501047_0026146
610 Ga0501047_0206236
611 Ga0501047_0692765
612 Ga0501048_0169655
613 Ga0501068_0212672
614 Ga0501070_0085243
615 Ga0501070_0109821
616 Ga0501071_1159266
617 Ga0501073_0686671
618 Ga0501227_132576
619 Ga0501243_140038
620 Ga0501245_156672
621 Ga0501080_0188487
622 Ga0501080_0347031
623 Ga0501083_0006273
624 Ga0501083_0123816
625 Ga0501035_0003445
626 Ga0501035_0010153
627 Ga0501035_0164260
628 Ga0501035_0525077
629 Ga0501035_1528002
630 Ga0501044_0006393
631 Ga0501044_0022811
632 Ga0501044_0175406
633 Ga0501044_0180578
634 Ga0501045_0131374
635 Ga0500651_0577904
636 Ga0500628_100902
637 Ga0500588_0054593
638 Ga0587109_087985
639 Ga0587115_109929
640 2788432878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01250

Ribosomal_S6

Ribosomal protein S6

13

102

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v4w-assembly1.cif.gz_AF structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 0.8844 6 98
3t1h-assembly1.cif.gz_F structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin 0.8831 6 98
7l08-assembly1.cif.gz_AE cryo-em structure of the human 55s mitoribosome-rrfmt complex. 0.8727 7 98
1vmb-assembly1.cif.gz_A crystal structure of 30s ribosomal protein s6 (tm0603) from thermotoga maritima at 1.70 a resolution 0.868 5 98
5a9z-assembly1.cif.gz_BJ complex of thermous thermophilus ribosome bound to bipa-gdpcp 0.8666 6 98
ID Description Score Start End Superfamily
2wrnF00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8753 6 98 3.30.70.60
af_I1MGC0_138_240_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.872 1 98 3.30.70.60
1vmbA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.868 5 98 3.30.70.60
2j5aA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8593 1 98 3.30.70.60
af_Q9VZD5_1_134_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8584 6 98 3.30.70.60
ID Description Score Start End GO Terms
AF-I6APS4-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9859 1 98 GO:0003735
GO:0005840
GO:0006412
GO:0019843
AF-W0J615-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9817 1 98 GO:0003735
GO:0005840
GO:0006412
GO:0019843
AF-A0A1J4XFB6-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9811 6 98 GO:0003735
GO:0005840
GO:0006412
GO:0019843
AF-A0A2V2DA36-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9799 6 98 GO:0003735
GO:0005840
GO:0006412
GO:0019843
AF-A0A3D4HHC2-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9793 6 98 GO:0003735
GO:0005840
GO:0006412
GO:0019843

Map