F405494

General Info

Members Datasets Scaffolds Average Seq Length
320 191 640 196

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10223086|Ga0105244_102230862
Length 221
Sequence VSYEPLPDGELAAVVTYLEMREPPAGPVPASPLSLQRLDPQPERYRELFRLVGAPWLWFSRLVMDDPALVAIIQHPEVDLYAVVDGSGADAGLLELDFREPGQCELAFIGLVPELSGKGHGKWLLAEAVRLAWRDGVTRVHVHTCSLDHPAALAAYRRAGFMPYKRALERFPDPRLSGFLPKDCAPQVPCWVQAPFVPKAECRSARASRRTFRSPPRSRRP

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
183 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
186 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
189 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
190 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
191 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0.62
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.06
Nodule 0
Rhizoplane 4.69
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10223086 3300009036 Bacteria 883
2 JGI24737J22298_10018083 3300001990 Bacteria 2265
3 JGI25165J46597_1000041 3300003214 Bacteria 272566
4 rootH1_10063523 3300003323 Bacteria 1813
5 Ga0070658_10039075 3300005327 Bacteria 3827
6 Ga0070676_10187607 3300005328 Bacteria 1348
7 Ga0070690_100035334 3300005330 Bacteria 3136
8 Ga0068869_100092955 3300005334 Bacteria 2271
9 Ga0070666_10036707 3300005335 Bacteria 3254
10 Ga0070680_100036312 3300005336 Bacteria 3981
11 Ga0068868_100046783 3300005338 Bacteria 3386
12 Ga0068868_100076537 3300005338 Bacteria 2675
13 Ga0070660_100027325 3300005339 Bacteria 4257
14 Ga0070660_100194210 3300005339 Bacteria 1645
15 Ga0070687_100076360 3300005343 Bacteria 1814
16 Ga0070661_100026359 3300005344 Bacteria 4180
17 Ga0070661_100138288 3300005344 Bacteria 1834
18 Ga0070661_100689160 3300005344 Bacteria 832
19 Ga0070692_10081090 3300005345 Bacteria 1747
20 Ga0070692_10368315 3300005345 Bacteria 898
21 Ga0070668_100039998 3300005347 Bacteria 3587
22 Ga0070669_100024764 3300005353 Bacteria 4306
23 Ga0070669_100435006 3300005353 Bacteria 1079
24 Ga0070669_100440719 3300005353 Bacteria 1072
25 Ga0070675_100001144 3300005354 Bacteria 19142
26 Ga0070675_100270115 3300005354 Bacteria 1492
27 Ga0070671_100064386 3300005355 Bacteria 3053
28 Ga0070671_100122305 3300005355 Bacteria 2190
29 Ga0070673_100049082 3300005364 Bacteria 3294
30 Ga0070659_100086940 3300005366 Bacteria 2502
31 Ga0070659_100092736 3300005366 Bacteria 2422
32 Ga0070659_100853870 3300005366 Bacteria 794
33 Ga0070667_100080436 3300005367 Bacteria 2787
34 Ga0070714_100763081 3300005435 Bacteria 935
35 Ga0070694_100043879 3300005444 Bacteria 2991
36 Ga0070663_100013903 3300005455 Bacteria 5149
37 Ga0070678_100362633 3300005456 Bacteria 1249
38 Ga0070662_100023904 3300005457 Bacteria 4204
39 Ga0070662_100089716 3300005457 Bacteria 2306
40 Ga0068867_100045563 3300005459 Bacteria 3217
41 Ga0068867_100062836 3300005459 Bacteria 2760
42 Ga0070679_100076554 3300005530 Bacteria 3335
43 Ga0070679_100660647 3300005530 Bacteria 988
44 Ga0068853_100464234 3300005539 Bacteria 1192
45 Ga0070672_100372199 3300005543 Bacteria 1221
46 Ga0070672_101172948 3300005543 Bacteria 684
47 Ga0070695_100083571 3300005545 Bacteria 2116
48 Ga0070665_100012206 3300005548 Bacteria 8662
49 Ga0070665_100080843 3300005548 Bacteria 3255
50 Ga0068855_100038908 3300005563 Bacteria 5648
51 Ga0068855_100140520 3300005563 Bacteria 2753
52 Ga0070664_100016968 3300005564 Bacteria 5976
53 Ga0070664_100214475 3300005564 Bacteria 1721
54 Ga0068857_100021643 3300005577 Bacteria 5658
55 Ga0068854_100370988 3300005578 Bacteria 1177
56 Ga0068854_100500950 3300005578 Bacteria 1023
57 Ga0068856_100024625 3300005614 Bacteria 5860
58 Ga0068856_100081505 3300005614 Bacteria 3210
59 Ga0068856_100121894 3300005614 Bacteria 2609
60 Ga0068852_100015528 3300005616 Bacteria 5911
61 Ga0068852_100021880 3300005616 Bacteria 5116
62 Ga0068859_100023976 3300005617 Bacteria 6124
63 Ga0068859_100025047 3300005617 Bacteria 5989
64 Ga0068859_100089745 3300005617 Bacteria 3124
65 Ga0068859_100113394 3300005617 Bacteria 2774
66 Ga0068859_100411410 3300005617 Bacteria 1449
67 Ga0068859_101108836 3300005617 Bacteria 870
68 Ga0068866_10079018 3300005718 Bacteria 1761
69 Ga0068866_10084250 3300005718 Bacteria 1715
70 Ga0068861_100000061 3300005719 Bacteria 51630
71 Ga0068851_10039950 3300005834 Bacteria 2357
72 Ga0068851_10074498 3300005834 Bacteria 1762
73 Ga0068851_10096778 3300005834 Bacteria 1561
74 Ga0068863_100043752 3300005841 Bacteria 4251
75 Ga0068863_100044954 3300005841 Bacteria 4191
76 Ga0068863_100149071 3300005841 Bacteria 2238
77 Ga0068858_100000716 3300005842 Bacteria 34541
78 Ga0068858_100032406 3300005842 Bacteria 4853
79 Ga0068858_100069905 3300005842 Bacteria 3254
80 Ga0068860_100019943 3300005843 Bacteria 6501
81 Ga0068860_100051603 3300005843 Bacteria 3913
82 Ga0068860_100063180 3300005843 Bacteria 3518
83 Ga0068862_100022631 3300005844 Bacteria 5258
84 Ga0068862_100073990 3300005844 Bacteria 2945
85 Ga0068862_100239700 3300005844 Bacteria 1648
86 Ga0081539_10021209 3300005985 Bacteria 4351
87 Ga0081539_10022936 3300005985 Bacteria 4106
88 Ga0070717_10025314 3300006028 Bacteria 4717
89 Ga0070712_100026912 3300006175 Bacteria 3837
90 Ga0097621_100010636 3300006237 Bacteria 6742
91 Ga0097621_100034602 3300006237 Bacteria 4031
92 Ga0068871_100077216 3300006358 Bacteria 2752
93 Ga0075433_10112041 3300006852 Bacteria 2420
94 Ga0068865_100034001 3300006881 Bacteria 3417
95 Ga0097620_100023976 3300006931 Bacteria 6124
96 Ga0097620_100025046 3300006931 Bacteria 5989
97 Ga0097620_100089744 3300006931 Bacteria 3124
98 Ga0097620_100113397 3300006931 Bacteria 2774
99 Ga0097620_100411384 3300006931 Bacteria 1449
100 Ga0097620_101108884 3300006931 Bacteria 870
101 Ga0075435_100090681 3300007076 Bacteria 2521
102 Ga0075435_101102906 3300007076 Bacteria 694
103 Ga0105240_10032545 3300009093 Bacteria 6751
104 Ga0105240_10263760 3300009093 Bacteria 1986
105 Ga0105245_10000239 3300009098 Bacteria 52406
106 Ga0105245_10217819 3300009098 Bacteria 1840
107 Ga0105247_10063532 3300009101 Bacteria 2291
108 Ga0105243_10041581 3300009148 Bacteria 3595
109 Ga0105243_10107828 3300009148 Bacteria 2324
110 Ga0105243_10220832 3300009148 Bacteria 1675
111 Ga0105242_10067138 3300009176 Bacteria 2964
112 Ga0105242_10089219 3300009176 Bacteria 2591
113 Ga0105242_10215300 3300009176 Bacteria 1714
114 Ga0105248_10000297 3300009177 Bacteria 59111
115 Ga0105248_10019717 3300009177 Bacteria 7466
116 Ga0105237_10530081 3300009545 Bacteria 1184
117 Ga0105238_10098007 3300009551 Bacteria 2916
118 Ga0105238_10639090 3300009551 Bacteria 1074
119 Ga0105238_10731075 3300009551 Bacteria 1003
120 Ga0105238_11405434 3300009551 Bacteria 725
121 Ga0105249_10122546 3300009553 Bacteria 2473
122 Ga0105249_10129873 3300009553 Bacteria 2404
123 Ga0105239_10058018 3300010375 Bacteria 4247
124 Ga0105246_10018503 3300011119 Bacteria 4442
125 Ga0157373_10060695 3300013100 Bacteria 2678
126 Ga0157371_10049760 3300013102 Bacteria 2977
127 Ga0157371_10108171 3300013102 Bacteria 1973
128 Ga0157371_10193582 3300013102 Bacteria 1456
129 Ga0157370_10474826 3300013104 Bacteria 1149
130 Ga0157374_10157127 3300013296 Bacteria 2214
131 Ga0157374_10377026 3300013296 Bacteria 1413
132 Ga0157374_11287835 3300013296 Bacteria 753
133 Ga0157378_10016448 3300013297 Bacteria 6478
134 Ga0157378_10144456 3300013297 Bacteria 2212
135 Ga0157378_10558170 3300013297 Bacteria 1151
136 Ga0163162_10105971 3300013306 Bacteria 2906
137 Ga0163162_10198594 3300013306 Bacteria 2134
138 Ga0163162_10382472 3300013306 Bacteria 1541
139 Ga0157372_10345405 3300013307 Bacteria 1734
140 Ga0157375_10103195 3300013308 Bacteria 2938
141 Ga0157375_10136265 3300013308 Bacteria 2579
142 Ga0163163_10033655 3300014325 Bacteria 4959
143 Ga0163163_10091148 3300014325 Bacteria 3062
144 Ga0157377_10076147 3300014745 Bacteria 1951
145 Ga0157377_10217440 3300014745 Bacteria 1221
146 Ga0157379_10128313 3300014968 Bacteria 2282
147 Ga0157379_10159081 3300014968 Bacteria 2038
148 Ga0157376_10031224 3300014969 Bacteria 4263
149 Ga0183363_1002 3300015690 Bacteria 425040
150 Ga0206356_11442520 3300020070 Bacteria 2250
151 Ga0206353_11985358 3300020082 Bacteria 1457
152 Ga0209233_1000104 3300025261 Bacteria 272675
153 Ga0209257_1012325 3300025304 Bacteria 3974
154 Ga0207656_10046365 3300025321 Bacteria 1864
155 Ga0207642_10056013 3300025899 Bacteria 1806
156 Ga0207710_10183704 3300025900 Bacteria 1027
157 Ga0207688_10016578 3300025901 Bacteria 3997
158 Ga0207688_10415630 3300025901 Bacteria 835
159 Ga0207688_10662509 3300025901 Bacteria 659
160 Ga0207647_10090551 3300025904 Bacteria 1824
161 Ga0207647_10097073 3300025904 Bacteria 1753
162 Ga0207645_10337522 3300025907 Bacteria 1007
163 Ga0207643_10185292 3300025908 Bacteria 1261
164 Ga0207705_10060920 3300025909 Bacteria 2726
165 Ga0207695_10031334 3300025913 Bacteria 5834
166 Ga0207693_10298471 3300025915 Bacteria 1262
167 Ga0207660_10009217 3300025917 Bacteria 6385
168 Ga0207649_10009202 3300025920 Bacteria 5402
169 Ga0207649_10548584 3300025920 Bacteria 884
170 Ga0207652_10361401 3300025921 Bacteria 1310
171 Ga0207681_10034400 3300025923 Bacteria 3331
172 Ga0207681_10395620 3300025923 Bacteria 1115
173 Ga0207659_10011906 3300025926 Bacteria 5510
174 Ga0207659_10217875 3300025926 Bacteria 1533
175 Ga0207687_10000981 3300025927 Bacteria 19376
176 Ga0207687_10060076 3300025927 Bacteria 2680
177 Ga0207700_10139042 3300025928 Bacteria 1993
178 Ga0207664_10033038 3300025929 Bacteria 3972
179 Ga0207644_10048112 3300025931 Bacteria 3046
180 Ga0207690_10459031 3300025932 Bacteria 1025
181 Ga0207706_10025321 3300025933 Bacteria 5317
182 Ga0207686_10135780 3300025934 Bacteria 1693
183 Ga0207709_10034690 3300025935 Bacteria 2976
184 Ga0207709_10074585 3300025935 Bacteria 2165
185 Ga0207709_10400646 3300025935 Bacteria 1049
186 Ga0207669_10020494 3300025937 Bacteria 3469
187 Ga0207669_10032385 3300025937 Bacteria 2935
188 Ga0207704_10093009 3300025938 Bacteria 1986
189 Ga0207704_10250825 3300025938 Bacteria 1328
190 Ga0207704_10405637 3300025938 Bacteria 1077
191 Ga0207691_10072521 3300025940 Bacteria 3106
192 Ga0207691_10115136 3300025940 Bacteria 2388
193 Ga0207711_10005036 3300025941 Bacteria 11206
194 Ga0207711_10006244 3300025941 Bacteria 10055
195 Ga0207689_10018033 3300025942 Bacteria 5961
196 Ga0207679_10136166 3300025945 Bacteria 1978
197 Ga0207679_10145948 3300025945 Bacteria 1919
198 Ga0207667_10191377 3300025949 Bacteria 2099
199 Ga0207667_10266123 3300025949 Bacteria 1753
200 Ga0207667_10352402 3300025949 Bacteria 1501
201 Ga0207651_10035814 3300025960 Bacteria 3232
202 Ga0207651_10892027 3300025960 Bacteria 792
203 Ga0207712_10008457 3300025961 Bacteria 6505
204 Ga0207668_10015191 3300025972 Bacteria 4779
205 Ga0207640_10023109 3300025981 Bacteria 3733
206 Ga0207640_10159258 3300025981 Bacteria 1668
207 Ga0207640_10171596 3300025981 Bacteria 1617
208 Ga0207640_10541762 3300025981 Bacteria 976
209 Ga0207658_10022638 3300025986 Bacteria 4377
210 Ga0207658_10024573 3300025986 Bacteria 4216
211 Ga0207658_10528357 3300025986 Bacteria 1053
212 Ga0207658_11346063 3300025986 Bacteria 653
213 Ga0207677_10076465 3300026023 Bacteria 2383
214 Ga0207677_10079510 3300026023 Bacteria 2345
215 Ga0207703_10003295 3300026035 Bacteria 13547
216 Ga0207703_10009294 3300026035 Bacteria 7726
217 Ga0207703_10105822 3300026035 Bacteria 2392
218 Ga0207639_10181474 3300026041 Bacteria 1791
219 Ga0207639_10409474 3300026041 Bacteria 1223
220 Ga0207678_10001321 3300026067 Bacteria 22898
221 Ga0207678_10127830 3300026067 Bacteria 2168
222 Ga0207678_10769701 3300026067 Bacteria 849
223 Ga0207702_10064979 3300026078 Bacteria 3124
224 Ga0207641_10022458 3300026088 Bacteria 5194
225 Ga0207641_10042272 3300026088 Bacteria 3823
226 Ga0207641_10048781 3300026088 Bacteria 3575
227 Ga0207641_10082202 3300026088 Bacteria 2798
228 Ga0207641_10217339 3300026088 Bacteria 1770
229 Ga0207648_10070509 3300026089 Bacteria 3047
230 Ga0207676_10557676 3300026095 Bacteria 1095
231 Ga0207674_10000626 3300026116 Bacteria 46240
232 Ga0207674_10781396 3300026116 Bacteria 922
233 Ga0207675_100000011 3300026118 Bacteria 143162
234 Ga0207683_10009098 3300026121 Bacteria 8465
235 Ga0207698_10003206 3300026142 Bacteria 9824
236 Ga0207698_10435973 3300026142 Bacteria 1261
237 Ga0209974_10156613 3300027876 Bacteria 824
238 Ga0268265_10004883 3300028380 Bacteria 9240
239 Ga0268265_10015518 3300028380 Bacteria 5215
240 Ga0268265_10080953 3300028380 Bacteria 2563
241 Ga0268265_10459513 3300028380 Bacteria 1191
242 Ga0268264_10002314 3300028381 Bacteria 16854
243 Ga0268264_10673613 3300028381 Bacteria 1025
244 Ga0307408_100033351 3300031548 Bacteria 3597
245 Ga0307408_100039950 3300031548 Bacteria 3320
246 Ga0307508_10000198 3300031616 Bacteria 72864
247 Ga0307405_10131046 3300031731 Bacteria 1732
248 Ga0307410_10421869 3300031852 Bacteria 1082
249 Ga0307412_10411532 3300031911 Bacteria 1104
250 Ga0307409_100004214 3300031995 Bacteria 8018
251 Ga0307409_100068459 3300031995 Bacteria 2808
252 Ga0307409_100073511 3300031995 Bacteria 2727
253 Ga0307409_100291720 3300031995 Bacteria 1513
254 Ga0307416_100292674 3300032002 Bacteria 1613
255 Ga0307416_101735375 3300032002 Bacteria 729
256 Ga0307411_10106838 3300032005 Bacteria 1993
257 Ga0307411_10156662 3300032005 Bacteria 1700
258 Ga0307411_10237029 3300032005 Bacteria 1426
259 Ga0373946_0031484 3300035171 Bacteria 2125
260 Ga0373935_0013673 3300035692 Bacteria 4899
261 Ga0373927_0630690 3300035695 Bacteria 708
262 Ga0395900_0006312 3300037418 Bacteria 12363
263 Ga0395900_0132445 3300037418 Bacteria 2554
264 Ga0395905_0121605 3300037471 Bacteria 2454
265 Ga0395905_0309297 3300037471 Bacteria 1468
266 Ga0395905_0877643 3300037471 Bacteria 800
267 Ga0395901_0000372 3300038443 Bacteria 53814
268 Ga0395901_0048314 3300038443 Bacteria 4419
269 Ga0395901_0193583 3300038443 Bacteria 2132
270 Ga0436363_0671966 3300039450 Bacteria 815
271 Ga0466966_0052815 3300044684 Bacteria 2580
272 Ga0495617_044806 3300046452 Bacteria 1476
273 Ga0495627_000273 3300046453 Bacteria 52157
274 Ga0495638_0000350 3300046460 Bacteria 57915
275 Ga0495610_0000311 3300046512 Bacteria 51569
276 Ga0495652_0340896 3300046529 Bacteria 1077
277 Ga0495654_0003556 3300046530 Bacteria 9496
278 Ga0495668_0236887 3300046616 Bacteria 999
279 Ga0495625_0001297 3300046660 Bacteria 31374
280 Ga0495669_0031355 3300046684 Bacteria 2334
281 Ga0495670_0216363 3300046691 Bacteria 1017
282 Ga0495649_0257349 3300046694 Bacteria 895
283 Ga0495589_0095380 3300046794 Bacteria 1443
284 Ga0495681_0000059 3300047470 Bacteria 102400
285 Ga0495686_0011665 3300047472 Bacteria 6187
286 Ga0495686_0020518 3300047472 Bacteria 4405
287 Ga0496101_0017963 3300048904 Bacteria 4801
288 Ga0496101_0037819 3300048904 Bacteria 3426
289 Ga0496103_0027404 3300048906 Bacteria 3453
290 Ga0496104_0071686 3300048907 Bacteria 3294
291 Ga0496105_0084189 3300048908 Bacteria 2627
292 Ga0496106_0039569 3300048909 Bacteria 3531
293 Ga0496108_0006028 3300048911 Bacteria 9810
294 Ga0496108_0543752 3300048911 Bacteria 1013
295 Ga0496110_0024073 3300048913 Bacteria 5188
296 Ga0496111_0068823 3300048914 Bacteria 2573
297 Ga0496111_0093226 3300048914 Bacteria 2207
298 Ga0496112_0071405 3300048915 Bacteria 3431
299 Ga0496112_0151817 3300048915 Bacteria 2283
300 Ga0496113_0063209 3300048916 Bacteria 2797
301 Ga0496121_0046332 3300048924 Bacteria 3723
302 Ga0496123_0140259 3300048926 Bacteria 1323
303 Ga0495678_119745 3300049459 Bacteria 886
304 Ga0501241_029521 3300049758 Bacteria 1033
305 nmdc:mga0n895_1139512_c1 3300050512 Bacteria 756
306 nmdc:mga0n895_332113_c1 3300050512 Bacteria 1540
307 nmdc:mga0rr50_153685_c1 3300050513 Bacteria 1862
308 nmdc:mga0a205_146234_c1 3300050515 Bacteria 2264
309 Ga0500643_002158 3300053087 Bacteria 10421
310 Ga0500643_030175 3300053087 Bacteria 1662
311 Ga0500643_048692 3300053087 Bacteria 1217
312 Ga0500562_044300 3300053108 Bacteria 1185
313 Ga0500595_007855 3300053119 Bacteria 4394
314 Ga0500658_0010415 3300053134 Bacteria 3428
315 Ga0500559_0100786 3300053136 Bacteria 1331
316 Ga0500568_0030928 3300053139 Bacteria 2214
317 Ga0500604_0002414 3300053151 Bacteria 5102
318 Ga0500627_0000538 3300053158 Bacteria 10235
319 2600201567 2599185354 Bacteria 4398675
320 8057102918 8057101203 Bacteria 5034064
321 Ga0105244_10223086
322 JGI24737J22298_10018083
323 JGI25165J46597_1000041
324 rootH1_10063523
325 Ga0070658_10039075
326 Ga0070676_10187607
327 Ga0070690_100035334
328 Ga0068869_100092955
329 Ga0070666_10036707
330 Ga0070680_100036312
331 Ga0068868_100046783
332 Ga0068868_100076537
333 Ga0070660_100027325
334 Ga0070660_100194210
335 Ga0070687_100076360
336 Ga0070661_100026359
337 Ga0070661_100138288
338 Ga0070661_100689160
339 Ga0070692_10081090
340 Ga0070692_10368315
341 Ga0070668_100039998
342 Ga0070669_100024764
343 Ga0070669_100435006
344 Ga0070669_100440719
345 Ga0070675_100001144
346 Ga0070675_100270115
347 Ga0070671_100064386
348 Ga0070671_100122305
349 Ga0070673_100049082
350 Ga0070659_100086940
351 Ga0070659_100092736
352 Ga0070659_100853870
353 Ga0070667_100080436
354 Ga0070714_100763081
355 Ga0070694_100043879
356 Ga0070663_100013903
357 Ga0070678_100362633
358 Ga0070662_100023904
359 Ga0070662_100089716
360 Ga0068867_100045563
361 Ga0068867_100062836
362 Ga0070679_100076554
363 Ga0070679_100660647
364 Ga0068853_100464234
365 Ga0070672_100372199
366 Ga0070672_101172948
367 Ga0070695_100083571
368 Ga0070665_100012206
369 Ga0070665_100080843
370 Ga0068855_100038908
371 Ga0068855_100140520
372 Ga0070664_100016968
373 Ga0070664_100214475
374 Ga0068857_100021643
375 Ga0068854_100370988
376 Ga0068854_100500950
377 Ga0068856_100024625
378 Ga0068856_100081505
379 Ga0068856_100121894
380 Ga0068852_100015528
381 Ga0068852_100021880
382 Ga0068859_100023976
383 Ga0068859_100025047
384 Ga0068859_100089745
385 Ga0068859_100113394
386 Ga0068859_100411410
387 Ga0068859_101108836
388 Ga0068866_10079018
389 Ga0068866_10084250
390 Ga0068861_100000061
391 Ga0068851_10039950
392 Ga0068851_10074498
393 Ga0068851_10096778
394 Ga0068863_100043752
395 Ga0068863_100044954
396 Ga0068863_100149071
397 Ga0068858_100000716
398 Ga0068858_100032406
399 Ga0068858_100069905
400 Ga0068860_100019943
401 Ga0068860_100051603
402 Ga0068860_100063180
403 Ga0068862_100022631
404 Ga0068862_100073990
405 Ga0068862_100239700
406 Ga0081539_10021209
407 Ga0081539_10022936
408 Ga0070717_10025314
409 Ga0070712_100026912
410 Ga0097621_100010636
411 Ga0097621_100034602
412 Ga0068871_100077216
413 Ga0075433_10112041
414 Ga0068865_100034001
415 Ga0097620_100023976
416 Ga0097620_100025046
417 Ga0097620_100089744
418 Ga0097620_100113397
419 Ga0097620_100411384
420 Ga0097620_101108884
421 Ga0075435_100090681
422 Ga0075435_101102906
423 Ga0105240_10032545
424 Ga0105240_10263760
425 Ga0105245_10000239
426 Ga0105245_10217819
427 Ga0105247_10063532
428 Ga0105243_10041581
429 Ga0105243_10107828
430 Ga0105243_10220832
431 Ga0105242_10067138
432 Ga0105242_10089219
433 Ga0105242_10215300
434 Ga0105248_10000297
435 Ga0105248_10019717
436 Ga0105237_10530081
437 Ga0105238_10098007
438 Ga0105238_10639090
439 Ga0105238_10731075
440 Ga0105238_11405434
441 Ga0105249_10122546
442 Ga0105249_10129873
443 Ga0105239_10058018
444 Ga0105246_10018503
445 Ga0157373_10060695
446 Ga0157371_10049760
447 Ga0157371_10108171
448 Ga0157371_10193582
449 Ga0157370_10474826
450 Ga0157374_10157127
451 Ga0157374_10377026
452 Ga0157374_11287835
453 Ga0157378_10016448
454 Ga0157378_10144456
455 Ga0157378_10558170
456 Ga0163162_10105971
457 Ga0163162_10198594
458 Ga0163162_10382472
459 Ga0157372_10345405
460 Ga0157375_10103195
461 Ga0157375_10136265
462 Ga0163163_10033655
463 Ga0163163_10091148
464 Ga0157377_10076147
465 Ga0157377_10217440
466 Ga0157379_10128313
467 Ga0157379_10159081
468 Ga0157376_10031224
469 Ga0183363_1002
470 Ga0206356_11442520
471 Ga0206353_11985358
472 Ga0209233_1000104
473 Ga0209257_1012325
474 Ga0207656_10046365
475 Ga0207642_10056013
476 Ga0207710_10183704
477 Ga0207688_10016578
478 Ga0207688_10415630
479 Ga0207688_10662509
480 Ga0207647_10090551
481 Ga0207647_10097073
482 Ga0207645_10337522
483 Ga0207643_10185292
484 Ga0207705_10060920
485 Ga0207695_10031334
486 Ga0207693_10298471
487 Ga0207660_10009217
488 Ga0207649_10009202
489 Ga0207649_10548584
490 Ga0207652_10361401
491 Ga0207681_10034400
492 Ga0207681_10395620
493 Ga0207659_10011906
494 Ga0207659_10217875
495 Ga0207687_10000981
496 Ga0207687_10060076
497 Ga0207700_10139042
498 Ga0207664_10033038
499 Ga0207644_10048112
500 Ga0207690_10459031
501 Ga0207706_10025321
502 Ga0207686_10135780
503 Ga0207709_10034690
504 Ga0207709_10074585
505 Ga0207709_10400646
506 Ga0207669_10020494
507 Ga0207669_10032385
508 Ga0207704_10093009
509 Ga0207704_10250825
510 Ga0207704_10405637
511 Ga0207691_10072521
512 Ga0207691_10115136
513 Ga0207711_10005036
514 Ga0207711_10006244
515 Ga0207689_10018033
516 Ga0207679_10136166
517 Ga0207679_10145948
518 Ga0207667_10191377
519 Ga0207667_10266123
520 Ga0207667_10352402
521 Ga0207651_10035814
522 Ga0207651_10892027
523 Ga0207712_10008457
524 Ga0207668_10015191
525 Ga0207640_10023109
526 Ga0207640_10159258
527 Ga0207640_10171596
528 Ga0207640_10541762
529 Ga0207658_10022638
530 Ga0207658_10024573
531 Ga0207658_10528357
532 Ga0207658_11346063
533 Ga0207677_10076465
534 Ga0207677_10079510
535 Ga0207703_10003295
536 Ga0207703_10009294
537 Ga0207703_10105822
538 Ga0207639_10181474
539 Ga0207639_10409474
540 Ga0207678_10001321
541 Ga0207678_10127830
542 Ga0207678_10769701
543 Ga0207702_10064979
544 Ga0207641_10022458
545 Ga0207641_10042272
546 Ga0207641_10048781
547 Ga0207641_10082202
548 Ga0207641_10217339
549 Ga0207648_10070509
550 Ga0207676_10557676
551 Ga0207674_10000626
552 Ga0207674_10781396
553 Ga0207675_100000011
554 Ga0207683_10009098
555 Ga0207698_10003206
556 Ga0207698_10435973
557 Ga0209974_10156613
558 Ga0268265_10004883
559 Ga0268265_10015518
560 Ga0268265_10080953
561 Ga0268265_10459513
562 Ga0268264_10002314
563 Ga0268264_10673613
564 Ga0307408_100033351
565 Ga0307408_100039950
566 Ga0307508_10000198
567 Ga0307405_10131046
568 Ga0307410_10421869
569 Ga0307412_10411532
570 Ga0307409_100004214
571 Ga0307409_100068459
572 Ga0307409_100073511
573 Ga0307409_100291720
574 Ga0307416_100292674
575 Ga0307416_101735375
576 Ga0307411_10106838
577 Ga0307411_10156662
578 Ga0307411_10237029
579 Ga0373946_0031484
580 Ga0373935_0013673
581 Ga0373927_0630690
582 Ga0395900_0006312
583 Ga0395900_0132445
584 Ga0395905_0121605
585 Ga0395905_0309297
586 Ga0395905_0877643
587 Ga0395901_0000372
588 Ga0395901_0048314
589 Ga0395901_0193583
590 Ga0436363_0671966
591 Ga0466966_0052815
592 Ga0495617_044806
593 Ga0495627_000273
594 Ga0495638_0000350
595 Ga0495610_0000311
596 Ga0495652_0340896
597 Ga0495654_0003556
598 Ga0495668_0236887
599 Ga0495625_0001297
600 Ga0495669_0031355
601 Ga0495670_0216363
602 Ga0495649_0257349
603 Ga0495589_0095380
604 Ga0495681_0000059
605 Ga0495686_0011665
606 Ga0495686_0020518
607 Ga0496101_0017963
608 Ga0496101_0037819
609 Ga0496103_0027404
610 Ga0496104_0071686
611 Ga0496105_0084189
612 Ga0496106_0039569
613 Ga0496108_0006028
614 Ga0496108_0543752
615 Ga0496110_0024073
616 Ga0496111_0068823
617 Ga0496111_0093226
618 Ga0496112_0071405
619 Ga0496112_0151817
620 Ga0496113_0063209
621 Ga0496121_0046332
622 Ga0496123_0140259
623 Ga0495678_119745
624 Ga0501241_029521
625 nmdc:mga0n895_1139512_c1
626 nmdc:mga0n895_332113_c1
627 nmdc:mga0rr50_153685_c1
628 nmdc:mga0a205_146234_c1
629 Ga0500643_002158
630 Ga0500643_030175
631 Ga0500643_048692
632 Ga0500562_044300
633 Ga0500595_007855
634 Ga0500658_0010415
635 Ga0500559_0100786
636 Ga0500568_0030928
637 Ga0500604_0002414
638 Ga0500627_0000538
639 2600201567
640 8057102918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

36

161

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y9k-assembly3.cif.gz_C iaa acetyltransferase from bacillus cereus atcc 14579 0.825 33 166
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.824 74 163
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8164 73 163
6ao7-assembly1.cif.gz_A-2 crystal structure of a gnat family acetyltransferase from elizabethkingia anophelis with acetyl-coa bound 0.8147 30 166
7wx7-assembly1.cif.gz_A complex of a legionella acetyltransferase vipf and coa/aco 0.8059 8 174
ID Description Score Start End Superfamily
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8376 103 166 3.40.630.30
af_Q94AC8_62_254_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8172 90 166 3.40.630.30
af_I1KF23_15_150_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8161 67 171 3.40.630.30
6ao7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8147 30 166 3.40.630.30
af_O64737_28_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7964 73 166 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A5N8AKU4-F1-model_v4 GNAT family N-acetyltransferase 0.9851 1 192 GO:0016747
AF-A0A520HH95-F1-model_v4 GNAT family N-acetyltransferase 0.9851 48 195 GO:0016747
AF-A0A1G4UH31-F1-model_v4 deleted 0.9838 1 192
AF-A0A6H2DJU5-F1-model_v4 GNAT family N-acetyltransferase 0.9779 1 192 GO:0016747
AF-A0A127MF91-F1-model_v4 GCN5 family acetyltransferase 0.9723 1 192 GO:0016747

Map