F405460

General Info

Members Datasets Scaffolds Average Seq Length
320 224 640 266

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100007020|Ga0068860_10000702014
Length 296
Sequence MPDRLASSHETPSRWDRPWADGHVPETVLMSTVLVSHPVAGVTLVTLNRPDRLNAMTAELVTELHAVLEDIGADRTCRVVVLTGAGRGFCAGLDLGGYGTGPDGEGRGPVGGRFATQQHIAALVPRLRSLHQPVIAAVNGAAAGGGFALALGSDVRIAATSAKFNVAFVKLGLSGCDIGVSWLLPRLVGAGRAWELMLTGRIVDSAEADDLGLLTKVVPDDELLEAAFDTARLIVTNSPWGVRMTKEVAWSQLEVGSLQAGIDLENRTQILSSMTGDLDEASAAFLAKRPPSWVEA

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
119 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
120 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
121 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
122 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
123 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
217 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
218 2619618881 Frankia sp. ACN1ag Isolate Unclassified
219 2619619003 Frankia sp. CpI1-P Isolate Nodule
220 2626541554 Frankia sp. AvcI.1 Isolate Nodule
221 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
222 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
223 8002784119 Frankia sp. AgB1.9 Isolate Nodule
224 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 0.31
Isolates 2.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.81
Nodule 1.25
Rhizoplane 4.06
Rhizosphere 88.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100007020 3300005843 Bacteria 11277
2 JGI25407J50210_10002235 3300003373 Bacteria 4530
3 Ga0070658_10000787 3300005327 Bacteria 27200
4 Ga0070658_10009647 3300005327 Bacteria 7750
5 Ga0068869_100320328 3300005334 Bacteria 1257
6 Ga0070680_100000852 3300005336 Bacteria 21628
7 Ga0068868_100025252 3300005338 Bacteria 4517
8 Ga0070671_100035481 3300005355 Bacteria 4131
9 Ga0070674_100068904 3300005356 Bacteria 2494
10 Ga0070659_100602724 3300005366 Bacteria 944
11 Ga0070709_10175345 3300005434 Bacteria 1501
12 Ga0070714_100208048 3300005435 Bacteria 1792
13 Ga0070714_100312364 3300005435 Bacteria 1468
14 Ga0070710_10019416 3300005437 Bacteria 3512
15 Ga0070711_100077869 3300005439 Bacteria 2354
16 Ga0070681_10017458 3300005458 Bacteria 7173
17 Ga0070681_10090919 3300005458 Bacteria 3003
18 Ga0070681_10174373 3300005458 Bacteria 2072
19 Ga0070679_100000559 3300005530 Bacteria 31597
20 Ga0070679_100354359 3300005530 Bacteria 1415
21 Ga0070697_100380741 3300005536 Bacteria 1222
22 Ga0070693_100061442 3300005547 Bacteria 2184
23 Ga0070665_100238260 3300005548 Bacteria 1820
24 Ga0068855_100073761 3300005563 Bacteria 3964
25 Ga0068852_100572269 3300005616 Bacteria 1132
26 Ga0068859_100102514 3300005617 Bacteria 2919
27 Ga0068864_100018045 3300005618 Bacteria 5889
28 Ga0068861_100519505 3300005719 Bacteria 1080
29 Ga0068863_100036218 3300005841 Bacteria 4700
30 Ga0068858_100173363 3300005842 Bacteria 2035
31 Ga0068860_100928144 3300005843 Bacteria 887
32 Ga0068862_100076485 3300005844 Bacteria 2897
33 Ga0081455_10012642 3300005937 Bacteria 8407
34 Ga0081538_10000655 3300005981 Bacteria 38278
35 Ga0081538_10002818 3300005981 Bacteria 16632
36 Ga0081538_10111781 3300005981 Bacteria 1339
37 Ga0075365_10012876 3300006038 Bacteria 4985
38 Ga0075364_10037171 3300006051 Bacteria 3151
39 Ga0070715_10061140 3300006163 Bacteria 1654
40 Ga0070716_100137447 3300006173 Bacteria 1553
41 Ga0070712_100066012 3300006175 Bacteria 2570
42 Ga0075367_10089395 3300006178 Bacteria 1872
43 Ga0075428_100000074 3300006844 Bacteria 82188
44 Ga0075430_100001223 3300006846 Bacteria 20659
45 Ga0075431_100004093 3300006847 Bacteria 14235
46 Ga0075429_100000159 3300006880 Bacteria 42611
47 Ga0097620_100102514 3300006931 Bacteria 2919
48 Ga0105240_10487713 3300009093 Bacteria 1372
49 Ga0111539_10073993 3300009094 Bacteria 4015
50 Ga0111539_10449883 3300009094 Bacteria 1500
51 Ga0111539_10625587 3300009094 Bacteria 1254
52 Ga0111539_10763408 3300009094 Bacteria 1125
53 Ga0105245_10008622 3300009098 Bacteria 8893
54 Ga0105245_10011381 3300009098 Bacteria 7749
55 Ga0105245_10033477 3300009098 Bacteria 4556
56 Ga0105245_10271810 3300009098 Bacteria 1653
57 Ga0105247_10523806 3300009101 Bacteria 867
58 Ga0114129_10000111 3300009147 Bacteria 81023
59 Ga0105243_10106938 3300009148 Bacteria 2333
60 Ga0105243_10421165 3300009148 Bacteria 1246
61 Ga0105241_10585676 3300009174 Bacteria 1006
62 Ga0105249_10047536 3300009553 Bacteria 3910
63 Ga0105246_10027581 3300011119 Bacteria 3723
64 Ga0157369_10576473 3300013105 Bacteria 1162
65 Ga0157375_10150424 3300013308 Bacteria 2463
66 Ga0163163_10223879 3300014325 Bacteria 1930
67 Ga0163163_10481610 3300014325 Bacteria 1302
68 Ga0163163_10604998 3300014325 Bacteria 1159
69 Ga0157379_10184103 3300014968 Bacteria 1887
70 Ga0157376_10247041 3300014969 Bacteria 1665
71 Ga0163161_10039257 3300017792 Bacteria 3398
72 Ga0206353_11044095 3300020082 Bacteria 25879
73 Ga0213873_10009611 3300021358 Bacteria 2014
74 Ga0213876_10027990 3300021384 Bacteria 2972
75 Ga0213876_10156575 3300021384 Bacteria 1212
76 Ga0213876_10184451 3300021384 Bacteria 1110
77 Ga0213875_10004143 3300021388 Bacteria 8031
78 Ga0207685_10138983 3300025905 Bacteria 1087
79 Ga0207699_10022801 3300025906 Bacteria 3399
80 Ga0207705_10000524 3300025909 Bacteria 32614
81 Ga0207705_10005720 3300025909 Bacteria 9286
82 Ga0207707_10000327 3300025912 Bacteria 50101
83 Ga0207707_10096079 3300025912 Bacteria 2590
84 Ga0207695_10439381 3300025913 Bacteria 1188
85 Ga0207663_10173902 3300025916 Bacteria 1532
86 Ga0207663_10335174 3300025916 Bacteria 1141
87 Ga0207660_10000114 3300025917 Bacteria 46511
88 Ga0207652_10000237 3300025921 Bacteria 57585
89 Ga0207687_10042062 3300025927 Bacteria 3141
90 Ga0207687_10096472 3300025927 Bacteria 2167
91 Ga0207687_10106617 3300025927 Bacteria 2072
92 Ga0207687_10141470 3300025927 Bacteria 1826
93 Ga0207664_10161803 3300025929 Bacteria 1909
94 Ga0207664_10334630 3300025929 Bacteria 1338
95 Ga0207690_10448287 3300025932 Bacteria 1037
96 Ga0207670_10135419 3300025936 Bacteria 1810
97 Ga0207670_10292167 3300025936 Bacteria 1273
98 Ga0207665_10006367 3300025939 Bacteria 7829
99 Ga0207689_10239757 3300025942 Bacteria 1499
100 Ga0207661_10301334 3300025944 Bacteria 1437
101 Ga0207667_10620794 3300025949 Bacteria 1089
102 Ga0207651_10589439 3300025960 Bacteria 971
103 Ga0207668_10105170 3300025972 Bacteria 2106
104 Ga0207668_10415182 3300025972 Bacteria 1141
105 Ga0207677_10224256 3300026023 Bacteria 1509
106 Ga0207703_10105902 3300026035 Bacteria 2391
107 Ga0207639_10187297 3300026041 Bacteria 1765
108 Ga0207678_10168673 3300026067 Bacteria 1869
109 Ga0207641_10103027 3300026088 Bacteria 2517
110 Ga0207675_100592814 3300026118 Bacteria 1111
111 Ga0268265_10036329 3300028380 Bacteria 3608
112 Ga0268264_10005956 3300028381 Bacteria 10316
113 Ga0268264_10096713 3300028381 Bacteria 2558
114 Ga0268264_10197864 3300028381 Bacteria 1836
115 Ga0265334_10029179 3300028573 Bacteria 2212
116 Ga0265338_10013088 3300028800 Bacteria 9401
117 Ga0265338_10260407 3300028800 Bacteria 1275
118 Ga0265338_10295744 3300028800 Bacteria 1178
119 Ga0307511_10136557 3300030521 Bacteria 1458
120 Ga0265325_10003724 3300031241 Bacteria 9854
121 Ga0265339_10000606 3300031249 Bacteria 27912
122 Ga0265327_10001628 3300031251 Bacteria 27077
123 Ga0265327_10129735 3300031251 Bacteria 1187
124 Ga0265316_10076493 3300031344 Bacteria 2572
125 Ga0265313_10001754 3300031595 Bacteria 19889
126 Ga0307413_10011811 3300031824 Bacteria 4315
127 Ga0307410_10003999 3300031852 Bacteria 7524
128 Ga0307410_10122716 3300031852 Bacteria 1897
129 Ga0307407_10066280 3300031903 Bacteria 2129
130 Ga0307409_100037104 3300031995 Bacteria 3590
131 Ga0307409_100042715 3300031995 Bacteria 3397
132 Ga0307409_100244039 3300031995 Bacteria 1637
133 Ga0307416_100023083 3300032002 Bacteria 4507
134 Ga0307416_100376418 3300032002 Bacteria 1448
135 Ga0307411_10045754 3300032005 Bacteria 2817
136 Ga0307411_10102602 3300032005 Bacteria 2027
137 Ga0307415_100391001 3300032126 Bacteria 1184
138 Ga0373926_0001628 3300035083 Bacteria 6927
139 Ga0373934_0098187 3300035086 Bacteria 1183
140 Ga0373944_0000812 3300035089 Bacteria 7654
141 Ga0373936_0000122 3300035113 Bacteria 27464
142 Ga0373936_0003266 3300035113 Bacteria 6080
143 Ga0373945_0002195 3300035116 Bacteria 6098
144 Ga0373957_0030045 3300035120 Bacteria 1989
145 Ga0373943_0023739 3300035170 Bacteria 2854
146 Ga0373946_0000106 3300035171 Bacteria 23756
147 Ga0373946_0110425 3300035171 Bacteria 1244
148 Ga0373955_0023503 3300035172 Bacteria 3141
149 Ga0373935_0030399 3300035692 Bacteria 3347
150 Ga0373927_0001916 3300035695 Bacteria 15375
151 Ga0373933_0023590 3300035724 Bacteria 3516
152 Ga0373947_0199426 3300035725 Bacteria 1309
153 Ga0373937_0029932 3300036401 Bacteria 4931
154 Ga0373937_0614030 3300036401 Bacteria 1032
155 Ga0373925_0022334 3300037068 Bacteria 4614
156 Ga0373925_0168910 3300037068 Bacteria 1726
157 Ga0436364_1026390 3300037853 Bacteria 7729
158 Ga0436365_0780260 3300039437 Bacteria 4887
159 Ga0436365_1130064 3300039437 Bacteria 16558
160 Ga0436365_1838010 3300039437 Bacteria 2151
161 Ga0436362_0167134 3300039453 Bacteria 6424
162 Ga0439466_0055896 3300041411 Bacteria 1282
163 Ga0439450_000786 3300042008 Bacteria 4337
164 Ga0439463_022642 3300042016 Bacteria 1573
165 Ga0439434_0101404 3300042435 Bacteria 928
166 Ga0439444_0009314 3300042437 Bacteria 1545
167 Ga0439464_0003916 3300042439 Bacteria 3788
168 Ga0466965_0135611 3300044683 Bacteria 1279
169 Ga0453684_0019361 3300044712 Bacteria 10365
170 Ga0466960_0216216 3300044901 Bacteria 1053
171 Ga0466967_0082112 3300045976 Bacteria 2912
172 Ga0466967_0124291 3300045976 Bacteria 2388
173 Ga0495629_0072490 3300046459 Bacteria 2404
174 Ga0495629_0112386 3300046459 Bacteria 1899
175 Ga0495651_0058298 3300046462 Bacteria 2963
176 Ga0495651_0234329 3300046462 Bacteria 1262
177 Ga0495653_0010216 3300046463 Bacteria 7684
178 Ga0495653_0041836 3300046463 Bacteria 3574
179 Ga0495653_0260534 3300046463 Bacteria 1147
180 Ga0495582_0039040 3300046473 Bacteria 2614
181 Ga0495639_0006528 3300046475 Bacteria 5019
182 Ga0495664_0010909 3300046477 Bacteria 5110
183 Ga0495608_0262682 3300046511 Bacteria 1074
184 Ga0495618_0025540 3300046514 Bacteria 3667
185 Ga0495618_0086948 3300046514 Bacteria 1999
186 Ga0495628_0092375 3300046516 Bacteria 2341
187 Ga0495628_0179315 3300046516 Bacteria 1603
188 Ga0495630_0037890 3300046517 Bacteria 3605
189 Ga0495652_0055022 3300046529 Bacteria 3386
190 Ga0495652_0236666 3300046529 Bacteria 1362
191 Ga0495665_0063643 3300046531 Bacteria 1947
192 Ga0495640_0128493 3300046533 Bacteria 1641
193 Ga0495640_0292238 3300046533 Bacteria 1013
194 Ga0495587_0170611 3300046536 Bacteria 1236
195 Ga0495621_0172045 3300046539 Bacteria 861
196 Ga0495597_0006813 3300046542 Bacteria 5873
197 Ga0495645_0056820 3300046543 Bacteria 2842
198 Ga0495667_0015513 3300046559 Bacteria 5149
199 Ga0495667_0029881 3300046559 Bacteria 3665
200 Ga0495668_0134373 3300046616 Bacteria 1354
201 Ga0495634_0009103 3300046642 Bacteria 7339
202 Ga0495634_0012938 3300046642 Bacteria 6037
203 Ga0495635_0000480 3300046663 Bacteria 25170
204 Ga0495635_0003153 3300046663 Bacteria 11353
205 Ga0495657_0054680 3300046675 Bacteria 2665
206 Ga0495657_0062815 3300046675 Bacteria 2452
207 Ga0495599_0100410 3300046678 Bacteria 1804
208 Ga0495599_0144938 3300046678 Bacteria 1472
209 Ga0495623_0224940 3300046679 Bacteria 1067
210 Ga0495613_0000239 3300046689 Bacteria 52322
211 Ga0495624_0004417 3300046690 Bacteria 10288
212 Ga0495600_0023694 3300046809 Bacteria 3949
213 Ga0495600_0025378 3300046809 Bacteria 3820
214 Ga0495581_0172680 3300047315 Bacteria 1264
215 Ga0495604_0175249 3300047317 Bacteria 1504
216 Ga0495674_0000991 3300047319 Bacteria 27284
217 Ga0495674_0132371 3300047319 Bacteria 2101
218 Ga0495676_0013981 3300047321 Bacteria 7190
219 Ga0495676_0139088 3300047321 Bacteria 1742
220 Ga0495680_0012273 3300047322 Bacteria 7550
221 Ga0495680_0024641 3300047322 Bacteria 4990
222 Ga0495680_0026066 3300047322 Bacteria 4827
223 Ga0495687_000406 3300047443 Bacteria 53268
224 Ga0495684_0026144 3300047471 Bacteria 4485
225 Ga0495684_0034291 3300047471 Bacteria 3894
226 Ga0495602_0177851 3300048088 Bacteria 1644
227 Ga0496101_0394452 3300048904 Bacteria 1090
228 Ga0496102_0721300 3300048905 Bacteria 920
229 Ga0496104_0381147 3300048907 Bacteria 1323
230 Ga0496108_0017827 3300048911 Bacteria 5807
231 Ga0496108_0045211 3300048911 Bacteria 3677
232 Ga0496109_0020403 3300048912 Bacteria 5853
233 Ga0496111_0018980 3300048914 Bacteria 4768
234 Ga0496112_0018617 3300048915 Bacteria 6543
235 Ga0496112_0026504 3300048915 Bacteria 5578
236 Ga0496114_0063122 3300048917 Bacteria 3101
237 Ga0496114_0119660 3300048917 Bacteria 2264
238 Ga0496114_0355939 3300048917 Bacteria 1295
239 Ga0496115_0062774 3300048918 Bacteria 2998
240 Ga0501031_0014238 3300049568 Bacteria 5174
241 Ga0501032_0129260 3300049569 Bacteria 1667
242 Ga0501033_0063277 3300049570 Bacteria 2723
243 Ga0501034_0000559 3300049571 Bacteria 58910
244 Ga0501036_0057084 3300049572 Bacteria 3307
245 Ga0501036_0166804 3300049572 Bacteria 1856
246 Ga0501037_0024478 3300049573 Bacteria 4465
247 Ga0501038_0026790 3300049574 Bacteria 5132
248 Ga0501039_0005833 3300049575 Bacteria 9326
249 Ga0501040_0013735 3300049576 Bacteria 5327
250 Ga0501041_0013522 3300049577 Bacteria 4840
251 Ga0501042_0016070 3300049578 Bacteria 5135
252 Ga0501046_0008694 3300049580 Bacteria 8826
253 Ga0501048_0008053 3300049582 Bacteria 7983
254 Ga0501048_0464186 3300049582 Bacteria 907
255 Ga0501067_0021380 3300049583 Bacteria 3580
256 Ga0501068_0000033 3300049584 Bacteria 51001
257 Ga0501068_0001516 3300049584 Bacteria 12357
258 Ga0501069_0000030 3300049585 Bacteria 102077
259 Ga0501069_0080237 3300049585 Bacteria 1837
260 Ga0501070_0000030 3300049586 Bacteria 139270
261 Ga0501070_0002496 3300049586 Bacteria 16119
262 Ga0501070_0030015 3300049586 Bacteria 4555
263 Ga0501071_0004502 3300049587 Bacteria 8840
264 Ga0501072_0001850 3300049588 Bacteria 15751
265 Ga0501072_0014945 3300049588 Bacteria 5949
266 Ga0501072_0046258 3300049588 Bacteria 3424
267 Ga0501073_0000331 3300049589 Bacteria 31798
268 Ga0501073_0001388 3300049589 Bacteria 17858
269 Ga0501073_0031353 3300049589 Bacteria 3793
270 Ga0501073_0071273 3300049589 Bacteria 2422
271 Ga0501073_0120868 3300049589 Bacteria 1815
272 Ga0501074_0000214 3300049590 Bacteria 31807
273 Ga0501074_0168197 3300049590 Bacteria 1565
274 Ga0501075_0032536 3300049591 Bacteria 3875
275 Ga0501076_0002799 3300049592 Bacteria 12081
276 Ga0501076_0189056 3300049592 Bacteria 1680
277 Ga0501077_0013570 3300049593 Bacteria 5108
278 Ga0501079_0019522 3300049741 Bacteria 5177
279 Ga0501079_0034600 3300049741 Bacteria 3888
280 Ga0501080_0001502 3300049742 Bacteria 19690
281 Ga0501080_0002760 3300049742 Bacteria 15425
282 Ga0501080_0093274 3300049742 Bacteria 2796
283 Ga0501080_0351291 3300049742 Bacteria 1331
284 Ga0501080_0717810 3300049742 Bacteria 881
285 Ga0501081_0002863 3300049743 Bacteria 10955
286 Ga0501083_0000155 3300049744 Bacteria 45460
287 Ga0501083_0028737 3300049744 Bacteria 3831
288 Ga0501035_0107394 3300049822 Bacteria 2447
289 Ga0501044_0001187 3300049823 Bacteria 30876
290 Ga0501045_0017050 3300049824 Bacteria 5157
291 nmdc:mga00v17_6282_c1 3300050491 Bacteria 6298
292 nmdc:mga0yw44_385232_c1 3300050492 Bacteria 947
293 nmdc:mga0yw44_93018_c1 3300050492 Bacteria 1909
294 nmdc:mga06z11_243013_c1 3300050494 Bacteria 1058
295 nmdc:mga07m45_87809_c1 3300050496 Bacteria 1779
296 nmdc:mga05p37_599_c1 3300050507 Bacteria 39739
297 nmdc:mga09592_683_c1 3300050508 Bacteria 25905
298 nmdc:mga0qj67_970_c1 3300050509 Bacteria 19746
299 nmdc:mga06r32_66147_c1 3300050510 Bacteria 3487
300 nmdc:mga0rr50_333097_c1 3300050513 Bacteria 1274
301 nmdc:mga0rr50_429395_c1 3300050513 Bacteria 1118
302 Ga0495619_0027733 3300053085 Bacteria 3651
303 Ga0495619_0090214 3300053085 Bacteria 2075
304 Ga0495619_0129359 3300053085 Bacteria 1735
305 Ga0500658_0000447 3300053134 Bacteria 17605
306 Ga0501084_0000517 3300054114 Bacteria 29536
307 Ga0501084_0007387 3300054114 Bacteria 9058
308 Ga0501084_0530449 3300054114 Bacteria 995
309 Ga0501082_0018042 3300060353 Bacteria 6078
310 Ga0501082_0140738 3300060353 Bacteria 2094
311 Ga0501082_0654722 3300060353 Bacteria 919
312 Ga0530510_0005251 3300061734 Bacteria 8943
313 2579854259 2579778521 Bacteria 7624758
314 2619853203 2619618881 Bacteria 7521104
315 2620350449 2619619003 Bacteria 7619552
316 2626639534 2626541554 Bacteria 7741902
317 2744958582 2744054611 Bacteria 5611514
318 2816507322 2816332139 Bacteria 9138787
319 8002789689 8002784119 Bacteria 9788632
320 8054923845 8054920844 Bacteria 7068637
321 Ga0068860_100007020
322 JGI25407J50210_10002235
323 Ga0070658_10000787
324 Ga0070658_10009647
325 Ga0068869_100320328
326 Ga0070680_100000852
327 Ga0068868_100025252
328 Ga0070671_100035481
329 Ga0070674_100068904
330 Ga0070659_100602724
331 Ga0070709_10175345
332 Ga0070714_100208048
333 Ga0070714_100312364
334 Ga0070710_10019416
335 Ga0070711_100077869
336 Ga0070681_10017458
337 Ga0070681_10090919
338 Ga0070681_10174373
339 Ga0070679_100000559
340 Ga0070679_100354359
341 Ga0070697_100380741
342 Ga0070693_100061442
343 Ga0070665_100238260
344 Ga0068855_100073761
345 Ga0068852_100572269
346 Ga0068859_100102514
347 Ga0068864_100018045
348 Ga0068861_100519505
349 Ga0068863_100036218
350 Ga0068858_100173363
351 Ga0068860_100928144
352 Ga0068862_100076485
353 Ga0081455_10012642
354 Ga0081538_10000655
355 Ga0081538_10002818
356 Ga0081538_10111781
357 Ga0075365_10012876
358 Ga0075364_10037171
359 Ga0070715_10061140
360 Ga0070716_100137447
361 Ga0070712_100066012
362 Ga0075367_10089395
363 Ga0075428_100000074
364 Ga0075430_100001223
365 Ga0075431_100004093
366 Ga0075429_100000159
367 Ga0097620_100102514
368 Ga0105240_10487713
369 Ga0111539_10073993
370 Ga0111539_10449883
371 Ga0111539_10625587
372 Ga0111539_10763408
373 Ga0105245_10008622
374 Ga0105245_10011381
375 Ga0105245_10033477
376 Ga0105245_10271810
377 Ga0105247_10523806
378 Ga0114129_10000111
379 Ga0105243_10106938
380 Ga0105243_10421165
381 Ga0105241_10585676
382 Ga0105249_10047536
383 Ga0105246_10027581
384 Ga0157369_10576473
385 Ga0157375_10150424
386 Ga0163163_10223879
387 Ga0163163_10481610
388 Ga0163163_10604998
389 Ga0157379_10184103
390 Ga0157376_10247041
391 Ga0163161_10039257
392 Ga0206353_11044095
393 Ga0213873_10009611
394 Ga0213876_10027990
395 Ga0213876_10156575
396 Ga0213876_10184451
397 Ga0213875_10004143
398 Ga0207685_10138983
399 Ga0207699_10022801
400 Ga0207705_10000524
401 Ga0207705_10005720
402 Ga0207707_10000327
403 Ga0207707_10096079
404 Ga0207695_10439381
405 Ga0207663_10173902
406 Ga0207663_10335174
407 Ga0207660_10000114
408 Ga0207652_10000237
409 Ga0207687_10042062
410 Ga0207687_10096472
411 Ga0207687_10106617
412 Ga0207687_10141470
413 Ga0207664_10161803
414 Ga0207664_10334630
415 Ga0207690_10448287
416 Ga0207670_10135419
417 Ga0207670_10292167
418 Ga0207665_10006367
419 Ga0207689_10239757
420 Ga0207661_10301334
421 Ga0207667_10620794
422 Ga0207651_10589439
423 Ga0207668_10105170
424 Ga0207668_10415182
425 Ga0207677_10224256
426 Ga0207703_10105902
427 Ga0207639_10187297
428 Ga0207678_10168673
429 Ga0207641_10103027
430 Ga0207675_100592814
431 Ga0268265_10036329
432 Ga0268264_10005956
433 Ga0268264_10096713
434 Ga0268264_10197864
435 Ga0265334_10029179
436 Ga0265338_10013088
437 Ga0265338_10260407
438 Ga0265338_10295744
439 Ga0307511_10136557
440 Ga0265325_10003724
441 Ga0265339_10000606
442 Ga0265327_10001628
443 Ga0265327_10129735
444 Ga0265316_10076493
445 Ga0265313_10001754
446 Ga0307413_10011811
447 Ga0307410_10003999
448 Ga0307410_10122716
449 Ga0307407_10066280
450 Ga0307409_100037104
451 Ga0307409_100042715
452 Ga0307409_100244039
453 Ga0307416_100023083
454 Ga0307416_100376418
455 Ga0307411_10045754
456 Ga0307411_10102602
457 Ga0307415_100391001
458 Ga0373926_0001628
459 Ga0373934_0098187
460 Ga0373944_0000812
461 Ga0373936_0000122
462 Ga0373936_0003266
463 Ga0373945_0002195
464 Ga0373957_0030045
465 Ga0373943_0023739
466 Ga0373946_0000106
467 Ga0373946_0110425
468 Ga0373955_0023503
469 Ga0373935_0030399
470 Ga0373927_0001916
471 Ga0373933_0023590
472 Ga0373947_0199426
473 Ga0373937_0029932
474 Ga0373937_0614030
475 Ga0373925_0022334
476 Ga0373925_0168910
477 Ga0436364_1026390
478 Ga0436365_0780260
479 Ga0436365_1130064
480 Ga0436365_1838010
481 Ga0436362_0167134
482 Ga0439466_0055896
483 Ga0439450_000786
484 Ga0439463_022642
485 Ga0439434_0101404
486 Ga0439444_0009314
487 Ga0439464_0003916
488 Ga0466965_0135611
489 Ga0453684_0019361
490 Ga0466960_0216216
491 Ga0466967_0082112
492 Ga0466967_0124291
493 Ga0495629_0072490
494 Ga0495629_0112386
495 Ga0495651_0058298
496 Ga0495651_0234329
497 Ga0495653_0010216
498 Ga0495653_0041836
499 Ga0495653_0260534
500 Ga0495582_0039040
501 Ga0495639_0006528
502 Ga0495664_0010909
503 Ga0495608_0262682
504 Ga0495618_0025540
505 Ga0495618_0086948
506 Ga0495628_0092375
507 Ga0495628_0179315
508 Ga0495630_0037890
509 Ga0495652_0055022
510 Ga0495652_0236666
511 Ga0495665_0063643
512 Ga0495640_0128493
513 Ga0495640_0292238
514 Ga0495587_0170611
515 Ga0495621_0172045
516 Ga0495597_0006813
517 Ga0495645_0056820
518 Ga0495667_0015513
519 Ga0495667_0029881
520 Ga0495668_0134373
521 Ga0495634_0009103
522 Ga0495634_0012938
523 Ga0495635_0000480
524 Ga0495635_0003153
525 Ga0495657_0054680
526 Ga0495657_0062815
527 Ga0495599_0100410
528 Ga0495599_0144938
529 Ga0495623_0224940
530 Ga0495613_0000239
531 Ga0495624_0004417
532 Ga0495600_0023694
533 Ga0495600_0025378
534 Ga0495581_0172680
535 Ga0495604_0175249
536 Ga0495674_0000991
537 Ga0495674_0132371
538 Ga0495676_0013981
539 Ga0495676_0139088
540 Ga0495680_0012273
541 Ga0495680_0024641
542 Ga0495680_0026066
543 Ga0495687_000406
544 Ga0495684_0026144
545 Ga0495684_0034291
546 Ga0495602_0177851
547 Ga0496101_0394452
548 Ga0496102_0721300
549 Ga0496104_0381147
550 Ga0496108_0017827
551 Ga0496108_0045211
552 Ga0496109_0020403
553 Ga0496111_0018980
554 Ga0496112_0018617
555 Ga0496112_0026504
556 Ga0496114_0063122
557 Ga0496114_0119660
558 Ga0496114_0355939
559 Ga0496115_0062774
560 Ga0501031_0014238
561 Ga0501032_0129260
562 Ga0501033_0063277
563 Ga0501034_0000559
564 Ga0501036_0057084
565 Ga0501036_0166804
566 Ga0501037_0024478
567 Ga0501038_0026790
568 Ga0501039_0005833
569 Ga0501040_0013735
570 Ga0501041_0013522
571 Ga0501042_0016070
572 Ga0501046_0008694
573 Ga0501048_0008053
574 Ga0501048_0464186
575 Ga0501067_0021380
576 Ga0501068_0000033
577 Ga0501068_0001516
578 Ga0501069_0000030
579 Ga0501069_0080237
580 Ga0501070_0000030
581 Ga0501070_0002496
582 Ga0501070_0030015
583 Ga0501071_0004502
584 Ga0501072_0001850
585 Ga0501072_0014945
586 Ga0501072_0046258
587 Ga0501073_0000331
588 Ga0501073_0001388
589 Ga0501073_0031353
590 Ga0501073_0071273
591 Ga0501073_0120868
592 Ga0501074_0000214
593 Ga0501074_0168197
594 Ga0501075_0032536
595 Ga0501076_0002799
596 Ga0501076_0189056
597 Ga0501077_0013570
598 Ga0501079_0019522
599 Ga0501079_0034600
600 Ga0501080_0001502
601 Ga0501080_0002760
602 Ga0501080_0093274
603 Ga0501080_0351291
604 Ga0501080_0717810
605 Ga0501081_0002863
606 Ga0501083_0000155
607 Ga0501083_0028737
608 Ga0501035_0107394
609 Ga0501044_0001187
610 Ga0501045_0017050
611 nmdc:mga00v17_6282_c1
612 nmdc:mga0yw44_385232_c1
613 nmdc:mga0yw44_93018_c1
614 nmdc:mga06z11_243013_c1
615 nmdc:mga07m45_87809_c1
616 nmdc:mga05p37_599_c1
617 nmdc:mga09592_683_c1
618 nmdc:mga0qj67_970_c1
619 nmdc:mga06r32_66147_c1
620 nmdc:mga0rr50_333097_c1
621 nmdc:mga0rr50_429395_c1
622 Ga0495619_0027733
623 Ga0495619_0090214
624 Ga0495619_0129359
625 Ga0500658_0000447
626 Ga0501084_0000517
627 Ga0501084_0007387
628 Ga0501084_0530449
629 Ga0501082_0018042
630 Ga0501082_0140738
631 Ga0501082_0654722
632 Ga0530510_0005251
633 2579854259
634 2619853203
635 2620350449
636 2626639534
637 2744958582
638 2816507322
639 8002789689
640 8054923845

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

38

296

0.93

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

42

234

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wtb-assembly1.cif.gz_A arabidopsis thaliana multifuctional protein, mfp2 0.8979 3 136
3sll-assembly1.cif.gz_E crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus 0.8969 3 247
3sll-assembly1.cif.gz_D crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus 0.8907 4 247
3sll-assembly1.cif.gz_A crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus 0.8899 3 247
3sll-assembly1.cif.gz_B crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus 0.8867 1 247
ID Description Score Start End Superfamily
5jbwA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9672 188 247 1.10.12.10
4fzwA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9632 189 247 1.10.12.10
4fzwB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9617 189 247 1.10.12.10
4fzwA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9476 189 247 1.10.12.10
af_P96404_205_262_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9474 189 247 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A358A583-F1-model_v4 Enoyl-CoA hydratase 0.9824 3 134 GO:0003824
GO:0006631
GO:0016020
AF-A0A7Y6CNR8-F1-model_v4 deleted 0.9719 1 118
AF-D3D7K8-F1-model_v4 Enoyl-CoA hydratase/isomerase 0.959 1 115 GO:0006635
GO:0016853
AF-A0A6I3GE89-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9579 1 107 GO:0006631
GO:0016853
AF-T0Y3W3-F1-model_v4 Crotonase, core domain protein (EC 4.1.1.41) 0.9424 3 118 GO:0006635
GO:0016829

Map