F405355

General Info

Members Datasets Scaffolds Average Seq Length
320 164 640 150

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10125629|rootH1_101256293
Length 150
Sequence VSWFPILLVAHIALAVSLLTPSLLLPFLLRRSSAGPPANPAMRVLLAMQGTGSVVIAIGLALTGIGLLLVLGTQLLSQPWLLVALTIYAVNLVVAAFVSRPNLRRLLWPGAGADDVAWQRRARTQRYVAYGMAAATGVIGFLMSTKPALW

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
86 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
87 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
88 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
89 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
90 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.88
Rhizosphere 87.19
Stem 0
Stem Tuber 0
Unclassified 13.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10125629 3300003316 Bacteria 2200
2 rootH2_10129115 3300003320 Bacteria 4760
3 rootH1_10006405 3300003323 Bacteria 4675
4 Ga0068869_100353740 3300005334 Bacteria 1198
5 Ga0068868_101224474 3300005338 Unclassified 695
6 Ga0070660_100336813 3300005339 Bacteria 1241
7 Ga0070687_100572124 3300005343 Bacteria 772
8 Ga0070692_10066482 3300005345 Bacteria 1911
9 Ga0070675_101102312 3300005354 Bacteria 730
10 Ga0070675_101525484 3300005354 Bacteria 616
11 Ga0070674_100312279 3300005356 Bacteria 1257
12 Ga0070701_10274374 3300005438 Bacteria 1027
13 Ga0070711_100113243 3300005439 Bacteria 1995
14 Ga0070705_100069726 3300005440 Bacteria 2121
15 Ga0070705_100204507 3300005440 Bacteria 1356
16 Ga0070700_100393627 3300005441 Bacteria 1040
17 Ga0070708_100212627 3300005445 Bacteria 1812
18 Ga0070708_100412889 3300005445 Bacteria 1273
19 Ga0070662_100090127 3300005457 Bacteria 2301
20 Ga0070662_100755047 3300005457 Bacteria 825
21 Ga0070681_10177350 3300005458 Bacteria 2053
22 Ga0070681_10998165 3300005458 Unclassified 757
23 Ga0070706_100000808 3300005467 Bacteria 34703
24 Ga0070706_100031836 3300005467 Bacteria 4863
25 Ga0070707_100002458 3300005468 Bacteria 17652
26 Ga0070707_100137182 3300005468 Bacteria 2380
27 Ga0070698_100051446 3300005471 Bacteria 4195
28 Ga0070699_100014012 3300005518 Bacteria 6897
29 Ga0070699_100026280 3300005518 Bacteria 5021
30 Ga0070699_100952749 3300005518 Bacteria 787
31 Ga0070679_100247249 3300005530 Bacteria 1740
32 Ga0070684_100130764 3300005535 Bacteria 2264
33 Ga0070697_100039018 3300005536 Bacteria 3839
34 Ga0068853_100071697 3300005539 Bacteria 3017
35 Ga0068853_100309451 3300005539 Bacteria 1462
36 Ga0070686_100370054 3300005544 Bacteria 1082
37 Ga0070695_100118082 3300005545 Bacteria 1811
38 Ga0070695_100693463 3300005545 Unclassified 808
39 Ga0070696_100013213 3300005546 Bacteria 5541
40 Ga0070696_100035812 3300005546 Bacteria 3419
41 Ga0070696_100191994 3300005546 Bacteria 1520
42 Ga0070704_100021630 3300005549 Bacteria 4175
43 Ga0070704_100027177 3300005549 Bacteria 3791
44 Ga0068855_100126346 3300005563 Bacteria 2924
45 Ga0068856_101521224 3300005614 Unclassified 683
46 Ga0070702_100161525 3300005615 Bacteria 1449
47 Ga0068859_100141496 3300005617 Bacteria 2479
48 Ga0068859_100544785 3300005617 Bacteria 1255
49 Ga0068864_100493645 3300005618 Bacteria 1177
50 Ga0068864_101198092 3300005618 Unclassified 758
51 Ga0068863_100810942 3300005841 Unclassified 934
52 Ga0068858_100580788 3300005842 Bacteria 1086
53 Ga0068860_100013674 3300005843 Bacteria 7956
54 Ga0068860_101172771 3300005843 Bacteria 788
55 Ga0081539_10011989 3300005985 Bacteria 6755
56 Ga0068871_101039956 3300006358 Unclassified 764
57 Ga0075428_100448360 3300006844 Bacteria 1382
58 Ga0075434_100105774 3300006871 Bacteria 2824
59 Ga0075434_100384882 3300006871 Unclassified 1424
60 Ga0097620_100141494 3300006931 Bacteria 2479
61 Ga0097620_100544783 3300006931 Bacteria 1255
62 Ga0075435_100043771 3300007076 Bacteria 3585
63 Ga0075435_100108980 3300007076 Unclassified 2301
64 Ga0105240_12573800 3300009093 Bacteria 526
65 Ga0111539_10054347 3300009094 Bacteria 4765
66 Ga0105245_13008297 3300009098 Unclassified 522
67 Ga0105247_10449170 3300009101 Bacteria 929
68 Ga0105243_11554775 3300009148 Bacteria 687
69 Ga0105248_10204084 3300009177 Bacteria 2227
70 Ga0105238_11762450 3300009551 Unclassified 651
71 Ga0105249_10887319 3300009553 Bacteria 958
72 Ga0105246_11349851 3300011119 Unclassified 663
73 Ga0157374_11208681 3300013296 Bacteria 777
74 Ga0163162_10480410 3300013306 Unclassified 1374
75 Ga0163162_12268939 3300013306 Bacteria 623
76 Ga0157375_10315888 3300013308 Unclassified 1727
77 Ga0157375_10604664 3300013308 Bacteria 1255
78 Ga0157380_10202339 3300014326 Bacteria 1763
79 Ga0157380_11174536 3300014326 Bacteria 810
80 Ga0157380_12228364 3300014326 Bacteria 612
81 Ga0157380_13231300 3300014326 Unclassified 521
82 Ga0157379_10017362 3300014968 Bacteria 6340
83 Ga0157379_10308057 3300014968 Bacteria 1444
84 Ga0157376_10077283 3300014969 Unclassified 2847
85 Ga0157376_10665882 3300014969 Bacteria 1043
86 Ga0207642_10073809 3300025899 Bacteria 1633
87 Ga0207643_10407044 3300025908 Unclassified 861
88 Ga0207684_10009338 3300025910 Bacteria 8665
89 Ga0207684_10022836 3300025910 Bacteria 5342
90 Ga0207707_10943597 3300025912 Bacteria 711
91 Ga0207652_10096868 3300025921 Bacteria 2599
92 Ga0207652_10251413 3300025921 Bacteria 1594
93 Ga0207646_10005282 3300025922 Bacteria 13621
94 Ga0207646_11274201 3300025922 Bacteria 643
95 Ga0207650_10513832 3300025925 Bacteria 1002
96 Ga0207687_10709465 3300025927 Unclassified 854
97 Ga0207706_10049365 3300025933 Bacteria 3719
98 Ga0207709_10687903 3300025935 Bacteria 817
99 Ga0207704_10714841 3300025938 Bacteria 830
100 Ga0207711_10346884 3300025941 Bacteria 1374
101 Ga0207689_11429112 3300025942 Bacteria 579
102 Ga0207667_10391400 3300025949 Bacteria 1415
103 Ga0207703_10660213 3300026035 Bacteria 992
104 Ga0207708_10241855 3300026075 Bacteria 1452
105 Ga0207708_10313800 3300026075 Unclassified 1278
106 Ga0207648_10294586 3300026089 Bacteria 1454
107 Ga0207676_10282419 3300026095 Bacteria 1508
108 Ga0207676_10641953 3300026095 Bacteria 1024
109 Ga0207676_10891357 3300026095 Bacteria 872
110 Ga0207675_100107295 3300026118 Bacteria 2633
111 Ga0207675_100402270 3300026118 Bacteria 1349
112 Ga0268264_10066655 3300028381 Bacteria 3036
113 Ga0373945_0126702 3300035116 Bacteria 1020
114 Ga0373927_0493402 3300035695 Unclassified 809
115 Ga0373947_0094387 3300035725 Unclassified 1871
116 Ga0373937_0117454 3300036401 Bacteria 2478
117 Ga0373925_0018287 3300037068 Bacteria 5094
118 Ga0395901_0320202 3300038443 Bacteria 1605
119 Ga0439465_0068775 3300041413 Bacteria 1184
120 Ga0451793_0664500 3300041452 Unclassified 860
121 Ga0451800_0973007 3300041459 Unclassified 663
122 Ga0439434_0125662 3300042435 Unclassified 839
123 Ga0450918_036580 3300042531 Bacteria 875
124 Ga0495590_0111347 3300046457 Bacteria 977
125 Ga0495629_0118607 3300046459 Bacteria 1844
126 Ga0495651_0130575 3300046462 Bacteria 1834
127 Ga0495653_0070547 3300046463 Bacteria 2615
128 Ga0495608_0462808 3300046511 Bacteria 771
129 Ga0495628_0229300 3300046516 Bacteria 1393
130 Ga0495628_0286610 3300046516 Bacteria 1222
131 Ga0495630_1142872 3300046517 Bacteria 590
132 Ga0495666_0302815 3300046526 Bacteria 723
133 Ga0495640_0652458 3300046533 Bacteria 633
134 Ga0495586_0277940 3300046535 Unclassified 958
135 Ga0495656_0032058 3300046615 Bacteria 2136
136 Ga0495634_0380758 3300046642 Bacteria 841
137 Ga0495657_0151272 3300046675 Bacteria 1441
138 Ga0495623_0191979 3300046679 Bacteria 1179
139 Ga0495658_0141862 3300046683 Bacteria 1470
140 Ga0495613_0472065 3300046689 Unclassified 848
141 Ga0495674_0081933 3300047319 Bacteria 2767
142 Ga0495674_0857536 3300047319 Bacteria 703
143 Ga0495676_0463662 3300047321 Unclassified 835
144 Ga0495676_0568197 3300047321 Bacteria 740
145 Ga0495680_0273439 3300047322 Bacteria 1192
146 Ga0495680_0321063 3300047322 Bacteria 1084
147 Ga0496100_0017687 3300048903 Bacteria 4214
148 Ga0496100_0357751 3300048903 Bacteria 1104
149 Ga0496101_0028157 3300048904 Bacteria 3921
150 Ga0496102_0344143 3300048905 Bacteria 1404
151 Ga0496102_0348660 3300048905 Bacteria 1394
152 Ga0496103_0531788 3300048906 Bacteria 751
153 Ga0496103_0558123 3300048906 Bacteria 731
154 Ga0496104_0011304 3300048907 Bacteria 7991
155 Ga0496104_0123928 3300048907 Bacteria 2481
156 Ga0496104_0154792 3300048907 Bacteria 2200
157 Ga0496105_0015658 3300048908 Bacteria 6050
158 Ga0496105_0023292 3300048908 Bacteria 5019
159 Ga0496105_0168351 3300048908 Unclassified 1797
160 Ga0496106_0073151 3300048909 Bacteria 2622
161 Ga0496106_0223633 3300048909 Unclassified 1502
162 Ga0496106_0246688 3300048909 Bacteria 1427
163 Ga0496107_0358519 3300048910 Bacteria 1085
164 Ga0496107_0457869 3300048910 Bacteria 947
165 Ga0496108_0011723 3300048911 Bacteria 7130
166 Ga0496108_0120543 3300048911 Bacteria 2249
167 Ga0496108_0740852 3300048911 Bacteria 850
168 Ga0496109_0006898 3300048912 Bacteria 9579
169 Ga0496109_0007144 3300048912 Bacteria 9435
170 Ga0496109_0148977 3300048912 Unclassified 2190
171 Ga0496110_0012173 3300048913 Bacteria 7068
172 Ga0496110_0121636 3300048913 Bacteria 2352
173 Ga0496111_0017156 3300048914 Bacteria 5000
174 Ga0496111_0100085 3300048914 Bacteria 2129
175 Ga0496112_0090449 3300048915 Bacteria 3029
176 Ga0496112_0169634 3300048915 Unclassified 2148
177 Ga0496113_0008057 3300048916 Bacteria 6837
178 Ga0496113_0152675 3300048916 Bacteria 1823
179 Ga0496114_0024398 3300048917 Bacteria 4936
180 Ga0496114_0451183 3300048917 Bacteria 1139
181 Ga0496114_0533319 3300048917 Bacteria 1038
182 Ga0496115_1134779 3300048918 Unclassified 591
183 Ga0501031_0007162 3300049568 Bacteria 7282
184 Ga0501031_0019449 3300049568 Bacteria 4425
185 Ga0501031_0029073 3300049568 Bacteria 3604
186 Ga0501031_0076585 3300049568 Bacteria 2179
187 Ga0501031_0146301 3300049568 Bacteria 1544
188 Ga0501032_0099671 3300049569 Unclassified 1925
189 Ga0501033_0251977 3300049570 Bacteria 1251
190 Ga0501036_0021428 3300049572 Bacteria 5434
191 Ga0501036_0057355 3300049572 Bacteria 3299
192 Ga0501036_0961584 3300049572 Bacteria 700
193 Ga0501036_1115339 3300049572 Bacteria 644
194 Ga0501037_0072809 3300049573 Bacteria 2499
195 Ga0501037_0339031 3300049573 Bacteria 1039
196 Ga0501037_0510838 3300049573 Unclassified 814
197 Ga0501038_0214125 3300049574 Bacteria 1540
198 Ga0501038_0349980 3300049574 Bacteria 1151
199 Ga0501038_0394438 3300049574 Bacteria 1072
200 Ga0501038_0524366 3300049574 Unclassified 904
201 Ga0501039_0001647 3300049575 Bacteria 16466
202 Ga0501039_0028269 3300049575 Bacteria 4316
203 Ga0501039_0046680 3300049575 Bacteria 3347
204 Ga0501039_1422990 3300049575 Bacteria 533
205 Ga0501040_0004917 3300049576 Bacteria 8649
206 Ga0501040_0010245 3300049576 Bacteria 6131
207 Ga0501040_0046526 3300049576 Bacteria 2962
208 Ga0501040_0047938 3300049576 Bacteria 2919
209 Ga0501040_0789157 3300049576 Bacteria 687
210 Ga0501040_0812836 3300049576 Bacteria 676
211 Ga0501040_1044627 3300049576 Bacteria 592
212 Ga0501041_0048668 3300049577 Bacteria 2582
213 Ga0501041_0103236 3300049577 Bacteria 1766
214 Ga0501041_0160847 3300049577 Bacteria 1404
215 Ga0501042_0031351 3300049578 Bacteria 3760
216 Ga0501042_0245763 3300049578 Bacteria 1291
217 Ga0501042_0288545 3300049578 Bacteria 1185
218 Ga0501042_0536662 3300049578 Unclassified 850
219 Ga0501042_1078595 3300049578 Bacteria 585
220 Ga0501043_0142159 3300049579 Bacteria 1879
221 Ga0501043_0569956 3300049579 Bacteria 839
222 Ga0501046_0029385 3300049580 Bacteria 4468
223 Ga0501046_0188187 3300049580 Unclassified 1541
224 Ga0501048_0043407 3300049582 Bacteria 3218
225 Ga0501048_0047302 3300049582 Bacteria 3070
226 Ga0501048_0225578 3300049582 Bacteria 1329
227 Ga0501048_0410436 3300049582 Bacteria 968
228 Ga0501048_1025635 3300049582 Bacteria 593
229 Ga0501067_0024648 3300049583 Bacteria 3336
230 Ga0501067_0138706 3300049583 Bacteria 1354
231 Ga0501068_0028442 3300049584 Unclassified 3306
232 Ga0501068_0056588 3300049584 Bacteria 2378
233 Ga0501068_0551074 3300049584 Bacteria 750
234 Ga0501069_0078944 3300049585 Bacteria 1852
235 Ga0501069_0087196 3300049585 Bacteria 1763
236 Ga0501071_0052922 3300049587 Bacteria 2927
237 Ga0501071_0070807 3300049587 Bacteria 2541
238 Ga0501071_0073275 3300049587 Bacteria 2497
239 Ga0501071_0118679 3300049587 Bacteria 1960
240 Ga0501071_0229852 3300049587 Bacteria 1397
241 Ga0501071_0234885 3300049587 Bacteria 1382
242 Ga0501071_0288569 3300049587 Bacteria 1242
243 Ga0501071_0605289 3300049587 Bacteria 842
244 Ga0501071_1433629 3300049587 Bacteria 533
245 Ga0501072_0016574 3300049588 Bacteria 5660
246 Ga0501072_0034187 3300049588 Bacteria 3984
247 Ga0501072_0070873 3300049588 Bacteria 2753
248 Ga0501072_0094601 3300049588 Bacteria 2374
249 Ga0501072_0105651 3300049588 Bacteria 2239
250 Ga0501072_0707451 3300049588 Bacteria 792
251 Ga0501072_0728215 3300049588 Bacteria 779
252 Ga0501073_0380513 3300049589 Bacteria 975
253 Ga0501074_0062623 3300049590 Unclassified 2679
254 Ga0501074_0062882 3300049590 Bacteria 2674
255 Ga0501074_0068011 3300049590 Bacteria 2561
256 Ga0501074_0460522 3300049590 Bacteria 901
257 Ga0501074_0684992 3300049590 Bacteria 724
258 Ga0501074_0708074 3300049590 Bacteria 711
259 Ga0501075_0026922 3300049591 Bacteria 4235
260 Ga0501075_0037250 3300049591 Bacteria 3633
261 Ga0501075_0049202 3300049591 Bacteria 3168
262 Ga0501075_0065961 3300049591 Bacteria 2731
263 Ga0501075_0230755 3300049591 Bacteria 1411
264 Ga0501076_0000713 3300049592 Bacteria 21435
265 Ga0501076_0051066 3300049592 Bacteria 3272
266 Ga0501076_0078225 3300049592 Bacteria 2654
267 Ga0501076_0130342 3300049592 Bacteria 2039
268 Ga0501076_0178990 3300049592 Bacteria 1728
269 Ga0501076_0381110 3300049592 Unclassified 1159
270 Ga0501077_0040845 3300049593 Bacteria 2954
271 Ga0501077_0166075 3300049593 Bacteria 1402
272 Ga0501077_0236595 3300049593 Bacteria 1161
273 Ga0501079_0022789 3300049741 Bacteria 4807
274 Ga0501079_0035218 3300049741 Bacteria 3853
275 Ga0501079_0108263 3300049741 Bacteria 2158
276 Ga0501079_0109286 3300049741 Bacteria 2147
277 Ga0501079_0127783 3300049741 Bacteria 1977
278 Ga0501079_0160806 3300049741 Bacteria 1751
279 Ga0501079_0949222 3300049741 Bacteria 677
280 Ga0501080_0008271 3300049742 Bacteria 9423
281 Ga0501080_0305865 3300049742 Bacteria 1441
282 Ga0501081_0048616 3300049743 Bacteria 2919
283 Ga0501081_0059877 3300049743 Bacteria 2637
284 Ga0501081_0076931 3300049743 Bacteria 2331
285 Ga0501081_0591337 3300049743 Bacteria 830
286 Ga0501083_0063268 3300049744 Bacteria 2468
287 Ga0501083_0139936 3300049744 Bacteria 1585
288 Ga0501035_0138077 3300049822 Bacteria 2121
289 Ga0501035_1049971 3300049822 Bacteria 638
290 Ga0501045_0017838 3300049824 Bacteria 5041
291 Ga0501045_0075757 3300049824 Bacteria 2478
292 Ga0501045_0163493 3300049824 Bacteria 1657
293 Ga0501045_0647635 3300049824 Bacteria 781
294 Ga0501045_0924800 3300049824 Bacteria 640
295 nmdc:mga09592_934252_c1 3300050508 Bacteria 728
296 nmdc:mga08y16_89255_c1 3300050511 Bacteria 3212
297 nmdc:mga0n895_264558_c1 3300050512 Unclassified 1745
298 nmdc:mga0n895_361495_c1 3300050512 Bacteria 1470
299 nmdc:mga0rr50_205531_c1 3300050513 Bacteria 1620
300 nmdc:mga0rr50_78460_c1 3300050513 Bacteria 2541
301 Ga0495601_0011340 3300053077 Bacteria 5328
302 Ga0495612_0000388 3300053078 Bacteria 17619
303 Ga0495612_0287501 3300053078 Bacteria 736
304 Ga0495595_0019530 3300053084 Bacteria 2941
305 Ga0495619_0163996 3300053085 Bacteria 1535
306 Ga0501084_0017859 3300054114 Bacteria 5905
307 Ga0501084_0026644 3300054114 Bacteria 4825
308 Ga0501084_0089897 3300054114 Bacteria 2578
309 Ga0501084_0096220 3300054114 Bacteria 2487
310 Ga0501084_0142049 3300054114 Bacteria 2022
311 Ga0501084_0143420 3300054114 Bacteria 2011
312 Ga0501082_0001497 3300060353 Bacteria 20567
313 Ga0501082_0213474 3300060353 Unclassified 1679
314 Ga0501082_0465624 3300060353 Unclassified 1105
315 Ga0530510_0001440 3300061734 Bacteria 15938
316 Ga0530510_0026648 3300061734 Bacteria 4138
317 Ga0530510_0096359 3300061734 Bacteria 2162
318 Ga0530510_0123356 3300061734 Bacteria 1903
319 Ga0530510_0127002 3300061734 Bacteria 1875
320 Ga0530510_0234447 3300061734 Bacteria 1365
321 rootH1_10125629
322 rootH2_10129115
323 rootH1_10006405
324 Ga0068869_100353740
325 Ga0068868_101224474
326 Ga0070660_100336813
327 Ga0070687_100572124
328 Ga0070692_10066482
329 Ga0070675_101102312
330 Ga0070675_101525484
331 Ga0070674_100312279
332 Ga0070701_10274374
333 Ga0070711_100113243
334 Ga0070705_100069726
335 Ga0070705_100204507
336 Ga0070700_100393627
337 Ga0070708_100212627
338 Ga0070708_100412889
339 Ga0070662_100090127
340 Ga0070662_100755047
341 Ga0070681_10177350
342 Ga0070681_10998165
343 Ga0070706_100000808
344 Ga0070706_100031836
345 Ga0070707_100002458
346 Ga0070707_100137182
347 Ga0070698_100051446
348 Ga0070699_100014012
349 Ga0070699_100026280
350 Ga0070699_100952749
351 Ga0070679_100247249
352 Ga0070684_100130764
353 Ga0070697_100039018
354 Ga0068853_100071697
355 Ga0068853_100309451
356 Ga0070686_100370054
357 Ga0070695_100118082
358 Ga0070695_100693463
359 Ga0070696_100013213
360 Ga0070696_100035812
361 Ga0070696_100191994
362 Ga0070704_100021630
363 Ga0070704_100027177
364 Ga0068855_100126346
365 Ga0068856_101521224
366 Ga0070702_100161525
367 Ga0068859_100141496
368 Ga0068859_100544785
369 Ga0068864_100493645
370 Ga0068864_101198092
371 Ga0068863_100810942
372 Ga0068858_100580788
373 Ga0068860_100013674
374 Ga0068860_101172771
375 Ga0081539_10011989
376 Ga0068871_101039956
377 Ga0075428_100448360
378 Ga0075434_100105774
379 Ga0075434_100384882
380 Ga0097620_100141494
381 Ga0097620_100544783
382 Ga0075435_100043771
383 Ga0075435_100108980
384 Ga0105240_12573800
385 Ga0111539_10054347
386 Ga0105245_13008297
387 Ga0105247_10449170
388 Ga0105243_11554775
389 Ga0105248_10204084
390 Ga0105238_11762450
391 Ga0105249_10887319
392 Ga0105246_11349851
393 Ga0157374_11208681
394 Ga0163162_10480410
395 Ga0163162_12268939
396 Ga0157375_10315888
397 Ga0157375_10604664
398 Ga0157380_10202339
399 Ga0157380_11174536
400 Ga0157380_12228364
401 Ga0157380_13231300
402 Ga0157379_10017362
403 Ga0157379_10308057
404 Ga0157376_10077283
405 Ga0157376_10665882
406 Ga0207642_10073809
407 Ga0207643_10407044
408 Ga0207684_10009338
409 Ga0207684_10022836
410 Ga0207707_10943597
411 Ga0207652_10096868
412 Ga0207652_10251413
413 Ga0207646_10005282
414 Ga0207646_11274201
415 Ga0207650_10513832
416 Ga0207687_10709465
417 Ga0207706_10049365
418 Ga0207709_10687903
419 Ga0207704_10714841
420 Ga0207711_10346884
421 Ga0207689_11429112
422 Ga0207667_10391400
423 Ga0207703_10660213
424 Ga0207708_10241855
425 Ga0207708_10313800
426 Ga0207648_10294586
427 Ga0207676_10282419
428 Ga0207676_10641953
429 Ga0207676_10891357
430 Ga0207675_100107295
431 Ga0207675_100402270
432 Ga0268264_10066655
433 Ga0373945_0126702
434 Ga0373927_0493402
435 Ga0373947_0094387
436 Ga0373937_0117454
437 Ga0373925_0018287
438 Ga0395901_0320202
439 Ga0439465_0068775
440 Ga0451793_0664500
441 Ga0451800_0973007
442 Ga0439434_0125662
443 Ga0450918_036580
444 Ga0495590_0111347
445 Ga0495629_0118607
446 Ga0495651_0130575
447 Ga0495653_0070547
448 Ga0495608_0462808
449 Ga0495628_0229300
450 Ga0495628_0286610
451 Ga0495630_1142872
452 Ga0495666_0302815
453 Ga0495640_0652458
454 Ga0495586_0277940
455 Ga0495656_0032058
456 Ga0495634_0380758
457 Ga0495657_0151272
458 Ga0495623_0191979
459 Ga0495658_0141862
460 Ga0495613_0472065
461 Ga0495674_0081933
462 Ga0495674_0857536
463 Ga0495676_0463662
464 Ga0495676_0568197
465 Ga0495680_0273439
466 Ga0495680_0321063
467 Ga0496100_0017687
468 Ga0496100_0357751
469 Ga0496101_0028157
470 Ga0496102_0344143
471 Ga0496102_0348660
472 Ga0496103_0531788
473 Ga0496103_0558123
474 Ga0496104_0011304
475 Ga0496104_0123928
476 Ga0496104_0154792
477 Ga0496105_0015658
478 Ga0496105_0023292
479 Ga0496105_0168351
480 Ga0496106_0073151
481 Ga0496106_0223633
482 Ga0496106_0246688
483 Ga0496107_0358519
484 Ga0496107_0457869
485 Ga0496108_0011723
486 Ga0496108_0120543
487 Ga0496108_0740852
488 Ga0496109_0006898
489 Ga0496109_0007144
490 Ga0496109_0148977
491 Ga0496110_0012173
492 Ga0496110_0121636
493 Ga0496111_0017156
494 Ga0496111_0100085
495 Ga0496112_0090449
496 Ga0496112_0169634
497 Ga0496113_0008057
498 Ga0496113_0152675
499 Ga0496114_0024398
500 Ga0496114_0451183
501 Ga0496114_0533319
502 Ga0496115_1134779
503 Ga0501031_0007162
504 Ga0501031_0019449
505 Ga0501031_0029073
506 Ga0501031_0076585
507 Ga0501031_0146301
508 Ga0501032_0099671
509 Ga0501033_0251977
510 Ga0501036_0021428
511 Ga0501036_0057355
512 Ga0501036_0961584
513 Ga0501036_1115339
514 Ga0501037_0072809
515 Ga0501037_0339031
516 Ga0501037_0510838
517 Ga0501038_0214125
518 Ga0501038_0349980
519 Ga0501038_0394438
520 Ga0501038_0524366
521 Ga0501039_0001647
522 Ga0501039_0028269
523 Ga0501039_0046680
524 Ga0501039_1422990
525 Ga0501040_0004917
526 Ga0501040_0010245
527 Ga0501040_0046526
528 Ga0501040_0047938
529 Ga0501040_0789157
530 Ga0501040_0812836
531 Ga0501040_1044627
532 Ga0501041_0048668
533 Ga0501041_0103236
534 Ga0501041_0160847
535 Ga0501042_0031351
536 Ga0501042_0245763
537 Ga0501042_0288545
538 Ga0501042_0536662
539 Ga0501042_1078595
540 Ga0501043_0142159
541 Ga0501043_0569956
542 Ga0501046_0029385
543 Ga0501046_0188187
544 Ga0501048_0043407
545 Ga0501048_0047302
546 Ga0501048_0225578
547 Ga0501048_0410436
548 Ga0501048_1025635
549 Ga0501067_0024648
550 Ga0501067_0138706
551 Ga0501068_0028442
552 Ga0501068_0056588
553 Ga0501068_0551074
554 Ga0501069_0078944
555 Ga0501069_0087196
556 Ga0501071_0052922
557 Ga0501071_0070807
558 Ga0501071_0073275
559 Ga0501071_0118679
560 Ga0501071_0229852
561 Ga0501071_0234885
562 Ga0501071_0288569
563 Ga0501071_0605289
564 Ga0501071_1433629
565 Ga0501072_0016574
566 Ga0501072_0034187
567 Ga0501072_0070873
568 Ga0501072_0094601
569 Ga0501072_0105651
570 Ga0501072_0707451
571 Ga0501072_0728215
572 Ga0501073_0380513
573 Ga0501074_0062623
574 Ga0501074_0062882
575 Ga0501074_0068011
576 Ga0501074_0460522
577 Ga0501074_0684992
578 Ga0501074_0708074
579 Ga0501075_0026922
580 Ga0501075_0037250
581 Ga0501075_0049202
582 Ga0501075_0065961
583 Ga0501075_0230755
584 Ga0501076_0000713
585 Ga0501076_0051066
586 Ga0501076_0078225
587 Ga0501076_0130342
588 Ga0501076_0178990
589 Ga0501076_0381110
590 Ga0501077_0040845
591 Ga0501077_0166075
592 Ga0501077_0236595
593 Ga0501079_0022789
594 Ga0501079_0035218
595 Ga0501079_0108263
596 Ga0501079_0109286
597 Ga0501079_0127783
598 Ga0501079_0160806
599 Ga0501079_0949222
600 Ga0501080_0008271
601 Ga0501080_0305865
602 Ga0501081_0048616
603 Ga0501081_0059877
604 Ga0501081_0076931
605 Ga0501081_0591337
606 Ga0501083_0063268
607 Ga0501083_0139936
608 Ga0501035_0138077
609 Ga0501035_1049971
610 Ga0501045_0017838
611 Ga0501045_0075757
612 Ga0501045_0163493
613 Ga0501045_0647635
614 Ga0501045_0924800
615 nmdc:mga09592_934252_c1
616 nmdc:mga08y16_89255_c1
617 nmdc:mga0n895_264558_c1
618 nmdc:mga0n895_361495_c1
619 nmdc:mga0rr50_205531_c1
620 nmdc:mga0rr50_78460_c1
621 Ga0495601_0011340
622 Ga0495612_0000388
623 Ga0495612_0287501
624 Ga0495595_0019530
625 Ga0495619_0163996
626 Ga0501084_0017859
627 Ga0501084_0026644
628 Ga0501084_0089897
629 Ga0501084_0096220
630 Ga0501084_0142049
631 Ga0501084_0143420
632 Ga0501082_0001497
633 Ga0501082_0213474
634 Ga0501082_0465624
635 Ga0530510_0001440
636 Ga0530510_0026648
637 Ga0530510_0096359
638 Ga0530510_0123356
639 Ga0530510_0127002
640 Ga0530510_0234447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pe5-assembly1.cif.gz_F yeast vo motor in complex with 2 vopq molecules 0.5558 2 69
6pe5-assembly1.cif.gz_F yeast vo motor in complex with 2 vopq molecules 0.4992 2 69
8otz-assembly1.cif.gz_EY 48-nm repeat of the native axonemal doublet microtubule from bovine sperm 0.4395 4 149
6jx6-assembly1.cif.gz_A tetrameric form of smac 0.3576 2 147
6r1j-assembly1.cif.gz_J-2 structure of the soluble ahlc triple head mutant of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila. 0.3535 7 145
ID Description Score Start End Superfamily
af_Q8IVQ6_85_218_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7025 3 71 3.30.40.10
af_Q03289_125_249_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6306 3 71 3.30.70.100
af_Q8I3I3_211_336_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6173 3 69 3.30.40.10
af_Q59NR8_108_226_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5962 3 67 3.30.40.10
af_Q9VBM6_98_233_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.579 3 78 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A7S1U4X8-F1-model_v4 Uncharacterized protein 0.674 7 70 GO:0007018
GO:0008569
GO:0030286
GO:0045505
GO:0051959
AF-A0A663EW23-F1-model_v4 Dynein axonemal heavy chain 1 0.6393 7 75 GO:0007018
GO:0008569
GO:0030286
GO:0045505
GO:0051959
AF-A0A7S0ZZI5-F1-model_v4 Dynein heavy chain region D6 P-loop domain-containing protein 0.6355 7 70 GO:0007018
GO:0008569
GO:0030286
GO:0045505
GO:0051959
AF-A0A1F8S239-F1-model_v4 DUF2269 domain-containing protein 0.61 3 150 GO:0016020
AF-A0A1F8S239-F1-model_v4 DUF2269 domain-containing protein 0.6003 3 150 GO:0016020

Map